RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780324|ref|YP_003064737.1| hypothetical protein CLIBASIA_01045 [Candidatus Liberibacter asiaticus str. psy62] (61 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 26.4 bits (58), Expect = 1.4 Identities = 6/14 (42%), Positives = 8/14 (57%) Query: 47 DYVDQKHDLYHDYR 60 DY ++ DLY Y Sbjct: 168 DYFEELRDLYQTYH 181 >2bde_A Cytosolic IMP-GMP specific 5'-nucleotidase; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.90A {Legionella pneumophila} SCOP: c.108.1.23 Length = 470 Score = 25.2 bits (55), Expect = 4.0 Identities = 9/34 (26%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Query: 30 FGVVMVYFSISFS---SRIVDYVDQKHDLYHDYR 60 + + FSI+F ++VD D D Y+ Sbjct: 121 YMAIDTSFSIAFCILYGQLVDLKDTNPDKMPSYQ 154 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.325 0.138 0.426 Gapped Lambda K H 0.267 0.0582 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 525,262 Number of extensions: 16932 Number of successful extensions: 53 Number of sequences better than 10.0: 1 Number of HSP's gapped: 53 Number of HSP's successfully gapped: 4 Length of query: 61 Length of database: 5,693,230 Length adjustment: 32 Effective length of query: 29 Effective length of database: 4,917,422 Effective search space: 142605238 Effective search space used: 142605238 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.4 bits)