BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780324|ref|YP_003064737.1| hypothetical protein CLIBASIA_01045 [Candidatus Liberibacter asiaticus str. psy62] (61 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780324|ref|YP_003064737.1| hypothetical protein CLIBASIA_01045 [Candidatus Liberibacter asiaticus str. psy62] Length = 61 Score = 125 bits (313), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 61/61 (100%), Positives = 61/61 (100%) Query: 1 MGNSVNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLYHDYR 60 MGNSVNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLYHDYR Sbjct: 1 MGNSVNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLYHDYR 60 Query: 61 R 61 R Sbjct: 61 R 61 >gi|254781052|ref|YP_003065465.1| dihydrolipoamide succinyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 436 Score = 21.6 bits (44), Expect = 2.7, Method: Composition-based stats. Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 34 MVYFSISFSSRIVD 47 M+Y ++S+ RIVD Sbjct: 398 MMYLALSYDHRIVD 411 >gi|254781033|ref|YP_003065446.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 492 Score = 20.0 bits (40), Expect = 7.3, Method: Composition-based stats. Identities = 6/22 (27%), Positives = 14/22 (63%) Query: 38 SISFSSRIVDYVDQKHDLYHDY 59 +I + ++ YV Q+H +++Y Sbjct: 99 NIPLARKMHSYVSQQHTFHNEY 120 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.138 0.426 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,043 Number of Sequences: 1233 Number of extensions: 1152 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 61 length of database: 328,796 effective HSP length: 33 effective length of query: 28 effective length of database: 288,107 effective search space: 8066996 effective search space used: 8066996 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.1 bits) S2: 31 (16.5 bits)