>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirem

Probab=99.63 E-value=2.8e-15 Score=108.50 Aligned_cols=107 Identities=26% Similarity=0.284 Sum_probs=76.4 Q ss_pred EEEEEEECCCEEEEEEECCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCCCCEEEEEE Q ss_conf 99999935986999991789888983822573101787488999988887626520244202556652057886069999 Q gi|254780325|r 13 VACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLLMPF 92 (141) Q Consensus 13 v~~~ii~~~~~iLl~~R~~~~~~~g~W~lPGG~ve~gEs~~~a~~REv~EEtgi~~~~~~~~~~~~~~~~~~~~~~~~~~ 92 (141) T Consensus 5 V~il~~~~~~~i~lv~QyR~~~~~~~~E~PaG~id~gE~~~~aA~REL~EETG~~~~~~~~--l~~~~~~pg~~~~~~~~ 82 (137) T cd03424 5 VAVLPYDDDGKVVLVRQYRPPVGGWLLELPAGLIDPGEDPEEAARRELEEETGYEAGDLEK--LGSFYPSPGFSDERIHL 82 (137) T ss_pred EEEEEECCCCEEEEEEEEECCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEE--CCCCCCCCCCCCCEEEE T ss_conf 9999986999899998144289983898155468899799999999974120651386789--33625888233717999 Q ss_pred EEEEEECCE----ECCCHHHEEEECCHHHHCCC Q ss_conf 999975483----76882331570277883248 Q gi|254780325|r 93 FVCHCFEGI----PQSCEGQQLQWVALDDLQNY 121 (141) Q Consensus 93 ~~~~~~~~~----~~~~E~~~~~Wi~~~el~~~ 121 (141) T Consensus 83 ~~a~~~~~~~~~~~d~~E~i~v~~~~~~e~~~~ 115 (137) T cd03424 83 FLAEDLSPGEEGLLDEGEDIEVVLVPLDEALEL 115 (137) T ss_pred EEEEECCCCCCCCCCCCCCEEEEEECHHHHHHH T ss_conf 999944045567888775268999669999999

HHsearch alignment for GI: 254780325 and conserved domain: cd03424