>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily. This class of enzymes is unique from other members of the superfamily in two aspects. First, it contains a modified Nudix signature sequence. The slight changes to the conserved sequence motif, GX5EX7REUXEEXGU, where U = I, L or V), are believed to contribute to the removal of all magnesium binding sites but one, retaining only the metal site that coordinates the pyrophosphate of the substrate. Secondly, it is not a pyrophosphatase that substitutes at a phosphorus; instead, it hydrolyzes nucleotide sugars such as GDP-mannose to GDP and mannose, cleaving the phosphoglycosyl bond by substituting at a carbon position. GDP-mannose provides mannosyl components for cell wall synthesis and is required for the synthesis of other glycosyl donors (such as GDP-fucose and colitose) for the cell wall. The importance of GDP-sugar hydrolase activities is thus close

Probab=99.90 E-value=3.9e-23 Score=153.76 Aligned_cols=112 Identities=23% Similarity=0.309 Sum_probs=86.9 Q ss_pred EEEEEEEECCCEEEEEEECCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCC------- Q ss_conf 9999999359869999917898889838225731017874889999888876265202442025566520578------- Q gi|254780325|r 12 VVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYE------- 84 (141) Q Consensus 12 vv~~~ii~~~~~iLl~~R~~~~~~~g~W~lPGG~ve~gEs~~~a~~REv~EEtgi~~~~~~~~~~~~~~~~~~------- 84 (141) T Consensus 14 ~V~~vI~n~~g~iLL~kR~~~p~-~g~W~~PGG~i~~gEt~~~a~~Re~~eE~Gl~i~~~~~~~~Gv~eh~y~d~~~~~~ 92 (144) T cd03430 14 SIDLIVENEDGQYLLGKRTNRPA-QGYWFVPGGRIRKNETLTEAFERIAKDELGLEFLISDAELLGVFEHFYDDNFFGDD 92 (144) T ss_pred EEEEEEECCCCCEEEEECCCCCC-CCEEECCCCCCCCCCCHHHHHHHHHHHHHCCCEEECCCEEEEEEEEECCCCCCCCC T ss_conf 99999997999699998169988-99498983447799799999999999974971640344897758998267777898 Q ss_pred -CCEEEEEEEEEEEECCEECC--CHHHEEEECCHHHHCCCCCC Q ss_conf -86069999999975483768--82331570277883248897 Q gi|254780325|r 85 -KFHLLMPFFVCHCFEGIPQS--CEGQQLQWVALDDLQNYSML 124 (141) Q Consensus 85 -~~~~~~~~~~~~~~~~~~~~--~E~~~~~Wi~~~el~~~~~~ 124 (141) T Consensus 93 ~~~H~V~l~y~~~~~~~e~~~~ddeh~e~~Wf~~del~~~~~v 135 (144) T cd03430 93 FSTHYVVLGYVLKLSSNELLLPDEQHSEYQWLTSDELLADDDV 135 (144) T ss_pred CCEEEEEEEEEEEECCCCCCCCHHHCCEEEEECHHHHHCCCCC T ss_conf 5309999999999558975599457006699679995217766

HHsearch alignment for GI: 254780325 and conserved domain: cd03430