>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex. Decapping is a key step in both general and nonsense-mediated 5'-3' mRNA-decay pathways. Dcp2p contains an all-alpha helical N-terminal domain and a C-terminal domain which has the Nudix fold. While decapping is not dependent on the N-terminus of Dcp2p, it does affect its efficiency. Dcp1p binds the N-terminal domain of Dcp2p stimulating the decapping activity of Dcp2p. Decapping permits the degradation of the transcript and is a site of numerous control inputs. It is responsible for nonsense-mediated decay as well as AU-rich element (ARE)-mediated decay. In addition, it may also play a role in the levels of mRNA. Enzymes belonging to the Nudix superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V).

Probab=99.69 E-value=1.5e-16 Score=115.73 Aligned_cols=104 Identities=22% Similarity=0.379 Sum_probs=69.7 Q ss_pred EEEEEEEEECC-CEEEEEEECCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCCCCEEE Q ss_conf 99999999359-86999991789888983822573101787488999988887626520244202556652057886069 Q gi|254780325|r 11 LVVACAVFEPG-GKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLL 89 (141) Q Consensus 11 ~vv~~~ii~~~-~~iLl~~R~~~~~~~g~W~lPGG~ve~gEs~~~a~~REv~EEtgi~~~~~~~~~~~~~~~~~~~~~~~ 89 (141) T Consensus 2 Pv~GaIiln~~~~kvLLVk~~~----~~~W~fPkGki~~~E~~~~~AiREv~EEtG~Dv~~~i-~~~~~Ie~~~~~q~~- 75 (145) T cd03672 2 PVYGAIILNEDLDKVLLVKGWK----SKSWSFPKGKINKDEDDHDCAIREVYEETGFDISKYI-DKDDYIELIIRGQNV- 75 (145) T ss_pred CEEEEEEEECCCCEEEEEEECC----CCCEECCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHC-CCCEEEEEEECCEEE- T ss_conf 7259999918999899999438----9958599641689979899998887773275754215-846069999789089- Q ss_pred EEEEEEEEEC----CEECC-CHHHEEEECCHHHHCCC Q ss_conf 9999999754----83768-82331570277883248 Q gi|254780325|r 90 MPFFVCHCFE----GIPQS-CEGQQLQWVALDDLQNY 121 (141) Q Consensus 90 ~~~~~~~~~~----~~~~~-~E~~~~~Wi~~~el~~~ 121 (141) T Consensus 76 -rlyiv~gVp~dt~F~p~TRkEI~~I~W~~i~~Lp~~ 111 (145) T cd03672 76 -KLYIVPGVPEDTPFEPKTRKEISKIEWFDIKDLPTK 111 (145) T ss_pred -EEEEECCCCCCCCCCCCCCCCEEEEEEEEHHHHHHH T ss_conf -999982888887517887232765788898884444

HHsearch alignment for GI: 254780325 and conserved domain: cd03672