>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate

Probab=99.89 E-value=1.5e-22 Score=150.47 Aligned_cols=114 Identities=29% Similarity=0.329 Sum_probs=86.4 Q ss_pred EEEEEEECCCEEEEEEECCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCCCCEEEEEE Q ss_conf 99999935986999991789888983822573101787488999988887626520244202556652057886069999 Q gi|254780325|r 13 VACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLLMPF 92 (141) Q Consensus 13 v~~~ii~~~~~iLl~~R~~~~~~~g~W~lPGG~ve~gEs~~~a~~REv~EEtgi~~~~~~~~~~~~~~~~~~~~~~~~~~ 92 (141) T Consensus 3 v~~vv~~~~g~vLL~rr~~----~~~W~lPGG~ve~gEs~~~aa~RE~~EEtGl~v~~~~~l-~~~~~~~~~~~~~~~~~ 77 (120) T cd04680 3 ARAVVTDADGRVLLVRHTY----GPGWYLPGGGLERGETFAEAARRELLEELGIRLAVVAEL-LGVYYHSASGSWDHVIV 77 (120) T ss_pred EEEEEECCCCEEEEEEECC----CCEEECCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEEEE-EEEEECCCCCCCEEEEE T ss_conf 9999992999099998679----991999954716998999999999999869755515479-99982589997539999 Q ss_pred EEEEEECCEEC--CCHHHEEEECCHHHHCCCCCCCCCHHHHH Q ss_conf 99997548376--88233157027788324889736989999 Q gi|254780325|r 93 FVCHCFEGIPQ--SCEGQQLQWVALDDLQNYSMLPADLSLIS 132 (141) Q Consensus 93 ~~~~~~~~~~~--~~E~~~~~Wi~~~el~~~~~~~~~~~ii~ 132 (141) T Consensus 78 f~~~~~~~~~~~~~~E~~e~~Wf~~d~LPe-~l~p~~~~~i~ 118 (120) T cd04680 78 FRARADTQPVIRPSHEISEARFFPPDALPE-PTTPATRRRIA 118 (120) T ss_pred EEEEECCCCCCCCCHHHHCEEEECHHHCCC-CCCHHHHHHHH T ss_conf 999824888679983674113988889888-78977999975

HHsearch alignment for GI: 254780325 and conserved domain: cd04680