RPSBLAST alignment for GI: 254780325 and conserved domain: cd03673

>gnl|CDD|72893 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily. Ap6A hydrolase specifically hydrolyzes diadenosine polyphosphates, but not ATP or diadenosine triphosphate, and it generates ATP as the product. Ap6A, the most preferred substrate, hydrolyzes to produce two ATP molecules, which is a novel hydrolysis mode for Ap6A. These results indicate that Ap6A hydrolase is a diadenosine polyphosphate hydrolase. It requires the presence of a divalent cation, such as Mn2+, Mg2+, Zn2+, and Co2+, for activity. Members of the Nudix superfamily are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site.. Length = 131
 Score = 49.1 bits (117), Expect = 4e-07
 Identities = 26/64 (40%), Positives = 34/64 (53%), Gaps = 6/64 (9%)

Query: 20 PGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFI 79
           G +VLL  RP+    G+ W  P GK+E GETP EA  RE+ EE  I  +     PL  I
Sbjct: 14 GGIEVLLIHRPR----GDDWSLPKGKLEPGETPPEAAVREVEEETGIRAEV--GDPLGTI 67

Query: 80 SHPY 83
           + +
Sbjct: 68 RYWF 71