HHsearch alignment for GI: 254780328 and conserved domain: COG0300

>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only].
Probab=99.25  E-value=2e-12  Score=96.09  Aligned_cols=163  Identities=18%  Similarity=0.162  Sum_probs=111.7

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHH----HHC----CCCEEEEECCCHHHHHHHHHH-----C
Q ss_conf             964479996878827799999999879889999268767521----302----386798426899999999875-----6
Q gi|254780328|r    1 MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAE----FVL----WGPLEQVDICDYTNLRAVFAK-----Y   67 (333)
Q Consensus         1 m~~kkIlItG~tGfiGs~l~~~L~~~g~~v~~~d~~~~~~~~----~~~----~~~~~~~Di~d~~~l~~~~~~-----~   67 (333)
T Consensus         4 ~~~~~~lITGASsGIG~~~A~~lA~~g~~liLvaR~~~kL~~la~~l~~~~~v~v~vi~~DLs~~~~~~~l~~~l~~~~~   83 (265)
T COG0300           4 MKGKTALITGASSGIGAELAKQLARRGYNLILVARREDKLEALAKELEDKTGVEVEVIPADLSDPEALERLEDELKERGG   83 (265)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHHCCC
T ss_conf             77867999778864899999999977997999967699999999999873086279997767883679999999982488


Q ss_pred             CCCEEEECHHHCCCC----CCCCCCEEEEEECCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             988999571440112----23431001233012333222112----2222222222233332222222222222222222
Q gi|254780328|r   68 QPASVMHFAGLTNIS----ESVKNPSLFYEINIKGSFNLIAT----AIESNVRRFIFSSTCATYGIPHNTIITENDPQES  139 (333)
Q Consensus        68 ~~d~ViHlAa~~~~~----~~~~~p~~~~~~Nv~gt~~ll~~----~~~~~~~~~i~~SS~~vYG~~~~~~~~E~~~~~p  139 (333)
T Consensus        84 ~IdvLVNNAG~g~~g~f~~~~~~~~~~mi~lN~~a~~~LT~~~lp~m~~~~~G~IiNI~S~ag~~-----------p~p~  152 (265)
T COG0300          84 PIDVLVNNAGFGTFGPFLELSLDEEEEMIQLNILALTRLTKAVLPGMVERGAGHIINIGSAAGLI-----------PTPY  152 (265)
T ss_pred             CCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCC-----------CCCC
T ss_conf             52389977874776654218858999999999999999999999999865896699984345328-----------8863


Q ss_pred             CCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCC
Q ss_conf             2222222223332222222---2222222222222222
Q gi|254780328|r  140 ITPYGYTKYVVERELLQHN---KVNGLRSVVLRYFNAA  174 (333)
Q Consensus       140 ~~~Yg~sK~~~E~~~~~~~---~~~~~~~~~~R~~~vy  174 (333)
T Consensus       153 ~avY~ATKa~v~~fSeaL~~EL~~~gV~V~~v~PG~~~  190 (265)
T COG0300         153 MAVYSATKAFVLSFSEALREELKGTGVKVTAVCPGPTR  190 (265)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             27999999999999999999835898499999657333