HHsearch alignment for GI: 254780328 and conserved domain: KOG1207

>KOG1207 consensus.
Probab=98.56  E-value=7.2e-08  Score=67.89  Aligned_cols=205  Identities=16%  Similarity=0.152  Sum_probs=129.3

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCH----HHHCCCCEEEEECCCHHHHHHHHHHCC-CCEEEEC
Q ss_conf             96447999687882779999999987988999926876752----130238679842689999999987569-8899957
Q gi|254780328|r    1 MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHA----EFVLWGPLEQVDICDYTNLRAVFAKYQ-PASVMHF   75 (333)
Q Consensus         1 m~~kkIlItG~tGfiGs~l~~~L~~~g~~v~~~d~~~~~~~----~~~~~~~~~~~Di~d~~~l~~~~~~~~-~d~ViHl   75 (333)
T Consensus         5 laG~~vlvTgagaGIG~~~v~~La~aGA~ViAvaR~~a~L~sLV~e~p~~I~Pi~~Dls~wea~~~~l~~v~pidgLVNN   84 (245)
T KOG1207           5 LAGVIVLVTGAGAGIGKEIVLSLAKAGAQVIAVARNEANLLSLVKETPSLIIPIVGDLSAWEALFKLLVPVFPIDGLVNN   84 (245)
T ss_pred             CCCEEEEEECCCCCCCHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCCHHHHHCC
T ss_conf             46619996056664149999999866887999956988999998529764245575133899999761465751343035


Q ss_pred             HHHCCCCC----CCCCCEEEEEECCCCCCCCCCCCC----CCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             14401122----343100123301233322211222----22222-2222333322222222222222222222222222
Q gi|254780328|r   76 AGLTNISE----SVKNPSLFYEINIKGSFNLIATAI----ESNVR-RFIFSSTCATYGIPHNTIITENDPQESITPYGYT  146 (333)
Q Consensus        76 Aa~~~~~~----~~~~p~~~~~~Nv~gt~~ll~~~~----~~~~~-~~i~~SS~~vYG~~~~~~~~E~~~~~p~~~Yg~s  146 (333)
T Consensus        85 AgvA~~~pf~eiT~q~fDr~F~VNvravi~v~Q~var~lv~R~~~GaIVNvSSqas~-----R------~~~nHtvYcat  153 (245)
T KOG1207          85 AGVATNHPFGEITQQSFDRTFAVNVRAVILVAQLVARNLVDRQIKGAIVNVSSQASI-----R------PLDNHTVYCAT  153 (245)
T ss_pred             CHHHHCCHHHHHHHHHHCCEEEEEEEEEEEHHHHHHHHHHHCCCCCEEEEECCHHCC-----C------CCCCCEEEEEC
T ss_conf             014431637888687630004542122210899988766640588608974021103-----6------66883477513


Q ss_pred             CCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2233322222222222---2222222222222222222222333332222222222222222222222222222232211
Q gi|254780328|r  147 KYVVERELLQHNKVNG---LRSVVLRYFNAAGATLDSIIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLR  223 (333)
Q Consensus       147 K~~~E~~~~~~~~~~~---~~~~~~R~~~vyGp~~~~~~g~~~~~~~~~~~~~i~~~~~~~~~i~i~g~~~~~~dg~~~R  223 (333)
T Consensus       154 KaALDmlTk~lAlELGp~kIRVNsVNPTVVmT~---MG~dnWSDP~K~------k~mL~----------------riPl~  208 (245)
T KOG1207         154 KAALDMLTKCLALELGPQKIRVNSVNPTVVMTD---MGRDNWSDPDKK------KKMLD----------------RIPLK  208 (245)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCCEEEEEC---CCCCCCCCCHHC------CCHHH----------------HCCHH
T ss_conf             878999999988751864157405587188811---464446891010------53554----------------37655


Q ss_pred             CCCCCCCCCCCCHHHHHH
Q ss_conf             001111100000001110
Q gi|254780328|r  224 DYIHVLDLANAHIMALEY  241 (333)
Q Consensus       224 dfi~v~D~~~a~~~~~~~  241 (333)
T Consensus       209 rFaEV~eVVnA~lfLLSd  226 (245)
T KOG1207         209 RFAEVDEVVNAVLFLLSD  226 (245)
T ss_pred             HHHHHHHHHHHHEEEEEC
T ss_conf             555799997563256525