HHsearch alignment for GI: 254780328 and conserved domain: PRK02472

>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional.
Probab=95.40  E-value=0.015  Score=35.00  Aligned_cols=35  Identities=34%  Similarity=0.360  Sum_probs=30.2

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             964479996878827799999999879889999268
Q gi|254780328|r    1 MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNL   36 (333)
Q Consensus         1 m~~kkIlItG~tGfiGs~l~~~L~~~g~~v~~~d~~   36 (333)
T Consensus         7 ~~~k~i~viGlG~-sG~s~a~~L~~~G~~V~~~D~~   41 (450)
T PRK02472          7 FQNKKVLVLGLAK-SGYAAAKLLHKLGANVTVNDGK   41 (450)
T ss_pred             CCCCEEEEEEECH-HHHHHHHHHHHCCCEEEEEECC
T ss_conf             5899899997789-9999999999886989998488