HHsearch alignment for GI: 254780328 and conserved domain: PRK05808

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated.
Probab=94.80  E-value=0.064  Score=31.11  Aligned_cols=35  Identities=23%  Similarity=0.375  Sum_probs=32.2

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             964479996878827799999999879889999268
Q gi|254780328|r    1 MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNL   36 (333)
Q Consensus         1 m~~kkIlItG~tGfiGs~l~~~L~~~g~~v~~~d~~   36 (333)
T Consensus         1 m~i~~VaViGa-G~mG~~IA~~~a~~G~~V~l~D~~   35 (282)
T PRK05808          1 MSIQKIGVIGA-GTMGNGIAQVCAVAGYDVVMVDIS   35 (282)
T ss_pred             CCCCEEEEECC-CHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             97268999897-889999999999579938999799