>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like. E1, a highly conserved small protein present universally in eukaryotic cells, is part of cascade to attach ubiquitin (Ub) covalently to substrate proteins. This cascade consists of activating (E1), conjugating (E2), and/or ligating (E3) enzymes and then targets them for degradation by the 26S proteasome. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and ubiquitin's C-terminus. E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. A set of novel molecules with a structural similarity to Ub, called Ub-like proteins (Ubls), have similar conjugation cascades. In contrast to ubiquitin-E1, which is a single-chain protein with a weakly conserved two-fold repeat, many of the Ubls-E1are a heterodimer where each subunit corresponds to one half of a single-chain E1. This CD represents the family homologou

Probab=94.69 E-value=0.13 Score=29.24 Aligned_cols=121 Identities=19% Similarity=0.066 Sum_probs=61.6 Q ss_pred EEEEECCCCHHHHHHHHHHHHCCC-EEEEEECCCCCCHHHHCCCCEEEEECCCH--HHHHHHHHHCCCCEEE--ECHHHC Q ss_conf 799968788277999999998798-89999268767521302386798426899--9999998756988999--571440 Q gi|254780328|r 5 NVLVVGGAGYIGAHTCRVLYERGF-LPIVLDNLSSGHAEFVLWGPLEQVDICDY--TNLRAVFAKYQPASVM--HFAGLT 79 (333) Q Consensus 5 kIlItG~tGfiGs~l~~~L~~~g~-~v~~~d~~~~~~~~~~~~~~~~~~Di~d~--~~l~~~~~~~~~d~Vi--HlAa~~ 79 (333) T Consensus 1 KVlvvGaGg-lGce~~k~La~~Gvg~i~iiD~D~Ie~SNLnRQfLf~~~dvGk~Ka~vAa~~l~~~Np~~~I~~~~~~v~ 79 (234) T cd01484 1 KVLLVGAGG-IGCELLKNLALMGFGQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKSEVAAEAVNDRNPNCKVVPYQNKVG 79 (234) T ss_pred CEEEECCCH-HHHHHHHHHHHCCCCEEEEECCCEECCCCCCHHHCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECCCC T ss_conf 989994888-7999999999839986999759900567701302446442688229999999998789977999805568 Q ss_pred CCC----CCCCCCEEE--EEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC Q ss_conf 112----234310012--330123332221122222222222233332222222 Q gi|254780328|r 80 NIS----ESVKNPSLF--YEINIKGSFNLIATAIESNVRRFIFSSTCATYGIPH 127 (333) Q Consensus 80 ~~~----~~~~~p~~~--~~~Nv~gt~~ll~~~~~~~~~~~i~~SS~~vYG~~~ 127 (333) T Consensus 80 ~e~~~~~~f~~~~DvVi~alDN~~aR~~vN~~c~~~~~-PLIegGt~G~~Gqv~ 132 (234) T cd01484 80 PEQDFNDTFFEQFHIIVNALDNIIARRYVNGMLIFLIV-PLIESGTEGFKGNAQ 132 (234) T ss_pred CCCCCCHHHHHHCCEEEECCCCHHHHHHHHHHHHHHCC-CEEEECCCCCEEEEE T ss_conf 62105798885299999885788899999999998099-859720246147999

HHsearch alignment for GI: 254780328 and conserved domain: cd01484