>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homolog

Probab=94.39 E-value=0.32 Score=26.82 Aligned_cols=71 Identities=17% Similarity=0.252 Sum_probs=41.5 Q ss_pred CEEEEE-----CCCCHHHHHHHHHHHHCCCEEEEEECCCCCC-HHHHCCCCEEEEE-------------CCCHHHHHHHH Q ss_conf 479996-----8788277999999998798899992687675-2130238679842-------------68999999998 Q gi|254780328|r 4 KNVLVV-----GGAGYIGAHTCRVLYERGFLPIVLDNLSSGH-AEFVLWGPLEQVD-------------ICDYTNLRAVF 64 (333) Q Consensus 4 kkIlIt-----G~tGfiGs~l~~~L~~~g~~v~~~d~~~~~~-~~~~~~~~~~~~D-------------i~d~~~l~~~~ 64 (333) T Consensus 1 MkI~i~~~P~~GG~e~~v~~La~~L~~~GHeV~vit~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~ 80 (371) T cd04962 1 MKIGIVCYPTYGGSGVVATELGKALARRGHEVHFITSSRPFRLDEYSPNIFFHEVEVPQYPLFQYPPYDLALASKIAEVA 80 (371) T ss_pred CEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHH T ss_conf 97999899999869999999999999759999999568987655568973799846877653446721378999999999 Q ss_pred HHCCCCEEEEC Q ss_conf 75698899957 Q gi|254780328|r 65 AKYQPASVMHF 75 (333) Q Consensus 65 ~~~~~d~ViHl 75 (333) T Consensus 81 ~~~~~Dvv-H~ 90 (371) T cd04962 81 KRYKLDLL-HV 90 (371) T ss_pred HHCCCCEE-EE T ss_conf 97399889-97

HHsearch alignment for GI: 254780328 and conserved domain: cd04962