HHsearch alignment for GI: 254780328 and conserved domain: smart00859

>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain. The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase, an enzyme involved in the biosynthesis of various amino acids from aspartate. This family is also found in yeast and fungal Arg5,6 protein, which is cleaved into the enzymes N-acety-gamma-glutamyl-phosphate reductase and acetylglutamate kinase. These are also involved in arginine biosynthesis. All proteins in this entry contain a NAD binding region of semialdehyde dehydrogenase.
Probab=94.52  E-value=0.048  Score=31.85  Aligned_cols=29  Identities=38%  Similarity=0.700  Sum_probs=23.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHC-CCEEEEE
Q ss_conf             7999687882779999999987-9889999
Q gi|254780328|r    5 NVLVVGGAGYIGAHTCRVLYER-GFLPIVL   33 (333)
Q Consensus         5 kIlItG~tGfiGs~l~~~L~~~-g~~v~~~   33 (333)
T Consensus         1 kVaIvGatGyvG~eli~lL~~hp~~~~~~l   30 (122)
T smart00859        1 KVAIVGATGYVGQELLRLLAEHPDFEVVAL   30 (122)
T ss_pred             CEEEECCCHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             989989451999999999985899745777