>TIGR00166 S6 ribosomal protein S6; InterPro: IPR000529 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , . Ribosomal protein S6 is one of the proteins from the small ribosomal subunit. In Escherichia coli, S6 is known to bind together with S18 to 16S ribosomal RNA. It belongs to a family of ribosomal proteins which, on the basis of sequence similarities, groups bacterial, red algal chloroplast and cyanelle S6 ribosomal proteins.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome.

Probab=99.59  E-value=1.4e-15  Score=111.95  Aligned_cols=94  Identities=33%  Similarity=0.666  Sum_probs=91.0

Q ss_pred             CCCCEEEEEECCCCCHHH---HHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEECC----CCCEEEEEEEEEECCHHHHH
Q ss_conf             987059999878999999---99999999999985697899970368653530322----24189999999808977999
Q gi|254780329|r    1 MKLYEHVFLLRQDISSQQ---IKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIR----KNRKAYYVFMNIASPPAAIH   73 (135)
Q Consensus         1 M~~YE~~~i~~p~~~~~~---~~~~~~~~~~~i~~~gg~i~~~e~wG~r~LAY~I~----k~~~G~Y~~~~f~~~~~~i~   73 (135)
T Consensus         1 ~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~l~~~~~~d~~~~~~~~~~~~~~~~~~~~~~   80 (102)
T TIGR00166         1 LRHYELIFLVRPTLSEEPKLEVKGLIERYKKLLTLNGGEIVGSEDWGLRRLAYPIKKDQEKHLRGHYYLWNFSGEGAVIK   80 (102)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEHHHHHHHHHHHHHHCCCHHHHCCCEEEEEEECCCHHHHH
T ss_conf             95411577751552101333335567777655531132000012220233321210002332032157886336335789


Q ss_pred             HHHHHHCCCCHHEEEEEEEEC
Q ss_conf             999980898021001124411
Q gi|254780329|r   74 EMKRKMRIDENVLRSLTLLVD   94 (135)
Q Consensus        74 el~~~lk~~~~VLR~l~vk~~   94 (135)
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~  101 (102)
T TIGR00166        81 EFERTLKLNDDVLRSLVIKLE  101 (102)
T ss_pred             HHHHHHCCCHHHHHHHHHHCC
T ss_conf             888874103667777764236