RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780329|ref|YP_003064742.1| 30S ribosomal protein S6 [Candidatus Liberibacter asiaticus str. psy62] (135 letters) >d2qalf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]} Length = 100 Score = 103 bits (259), Expect = 5e-24 Identities = 31/100 (31%), Positives = 53/100 (53%), Gaps = 1/100 (1%) Query: 1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60 M+ YE VF++ D S +Q+ I +Y + I G++ + + G R +AY I K KA+Y Sbjct: 1 MRHYEIVFMVHPDQS-EQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59 Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100 V MN+ +P I E++ R ++ V+RS+ + Sbjct: 60 VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEA 99 >d1loua_ d.58.14.1 (A:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]} Length = 97 Score = 102 bits (255), Expect = 1e-23 Identities = 25/96 (26%), Positives = 48/96 (50%) Query: 1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60 M+ YE +L ++ Q+ Q + G V V ELG+R +AY I K+ + Y+ Sbjct: 1 MRRYEVNIVLNPNLDQSQLALEKEIIQRAAENYGARVEKVEELGLRRLAYPIAKDPQGYF 60 Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96 ++ + P ++++ R++RI +NV R + + Sbjct: 61 LWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEP 96 >d1vmba_ d.58.14.1 (A:) Ribosomal protein S6 {Thermotoga maritima [TaxId: 2336]} Length = 107 Score = 98.7 bits (246), Expect = 2e-22 Identities = 20/98 (20%), Positives = 48/98 (48%), Gaps = 1/98 (1%) Query: 1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQEN-GGEVRLVNELGMRTIAYRIRKNRKAY 59 ++YE +F++ ++ ++ ++ + + + +I+E G++ V +GMR AY I+K + Sbjct: 2 ERIYESMFIIAPNVPEEERENLVERVKKIIEERVKGKIDKVERMGMRKFAYEIKKFNEGD 61 Query: 60 YVFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHE 97 Y + + E++ R+ ++R T E Sbjct: 62 YTVIYFRCDGQNLQELENFYRVTPEIIRWQTFRRFDLE 99 >d2j5aa1 d.58.14.1 (A:3-108) Ribosomal protein S6 {Aquifex aeolicus [TaxId: 63363]} Length = 106 Score = 94.5 bits (235), Expect = 3e-21 Identities = 29/98 (29%), Positives = 54/98 (55%), Gaps = 1/98 (1%) Query: 1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60 ++ YE VF ++ +S +++K Q + I++ GGE+ + GMR +AY I+K A Y Sbjct: 5 LRYYETVFAVKPTLSEEEMKKKFEQVKEFIKQKGGEILYEEDWGMRQLAYPIQKFNNARY 64 Query: 61 VFMNI-ASPPAAIHEMKRKMRIDENVLRSLTLLVDSHE 97 + P +E+ +++IDE+V+R L + + E Sbjct: 65 FLVQFKTENPQLPNELDFQLKIDEDVIRWLNIQIKESE 102 >d1wzaa1 b.71.1.1 (A:437-515) Bacterial alpha-Amylase {Halothermothrix orenii [TaxId: 31909]} Length = 79 Score = 25.0 bits (54), Expect = 2.2 Identities = 10/38 (26%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Query: 35 GEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAI 72 G++ ++N G+ +A+R +++ YV+ N+ + P I Sbjct: 1 GKIEIING-GLNVVAFRRYNDKRDLYVYHNLVNRPVKI 37 >d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Length = 263 Score = 25.0 bits (53), Expect = 2.6 Identities = 10/66 (15%), Positives = 26/66 (39%), Gaps = 9/66 (13%) Query: 16 SQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEM 75 S ++K I +Y+ + G V Y++ + Y+ M + +++ Sbjct: 6 SPELKKLIEKYRCVKDTEGMSPAKV---------YKLVGENENLYLKMTDSRYKGTTYDV 56 Query: 76 KRKMRI 81 +R+ + Sbjct: 57 EREKDM 62 >d2r85a1 c.30.1.8 (A:1-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Length = 99 Score = 23.8 bits (52), Expect = 5.7 Identities = 9/51 (17%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Query: 44 GMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMRIDENVL----RSLT 90 G TIA+ K + Y + +A + ++ + N + S Sbjct: 24 GFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELL-NLNAVVVPTGSFV 73 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.135 0.375 Gapped Lambda K H 0.267 0.0746 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 463,020 Number of extensions: 19186 Number of successful extensions: 51 Number of sequences better than 10.0: 1 Number of HSP's gapped: 48 Number of HSP's successfully gapped: 14 Length of query: 135 Length of database: 2,407,596 Length adjustment: 76 Effective length of query: 59 Effective length of database: 1,364,116 Effective search space: 80482844 Effective search space used: 80482844 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (22.2 bits)