HHsearch alignment of GI: 254780330 and MMDB domain: 3bbn_R_

>3bbn_R (R:) Ribosomal protein S18; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}
Probab=99.90  E-value=2.9e-25  Score=162.27  Aligned_cols=64  Identities=36%  Similarity=0.664  Sum_probs=58.5

Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHCCCCCEECCCHHHCCCHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             8854350388511446889999962899848550331748999999999999999704658676
Q gi|254780330|r   19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN   82 (83)
Q Consensus        19 k~c~~~~~~~~~iDYKn~~lL~~Fis~~GkI~prr~TG~~~k~Qr~i~~aIKrAR~~gLlPy~~   82 (83)
                      +.|+++..+.+.|||||+++|++|||++|+|+||++||+|+++||+|++|||+||+||||||+.
T Consensus        16 ~~~~~~~~~~~~idyknv~lL~~Fis~~GkIlprr~TGl~~k~Qr~l~~aIkrAR~~gLlP~~~   79 (103)
T 3bbn_R           16 RRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITSAIKQARILSLLPFLN   79 (103)
T ss_dssp             ---------CCSSCCSCHHHHTTTSCSSSSCCCSSSTTCCTTTTTTTHHHHHHHTTTTSSCTTC
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             7778987778867765889999865888868676337769999999999999999961678565