HHsearch alignment of GI: 254780330 and MMDB domain: 3i1m_R_

>3i1m_R (R:) 30S ribosomal protein S18; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_R* 1vs5_R 3i1o_R 3i1q_R 3i1s_R 3i1z_R 3i21_R 2qal_R* 1p6g_R 1p87_R 2aw7_R 2avy_R 2i2u_R 2i2p_R* 2qan_R* 2qb9_R* 2qbb_R* 2qbd_R 2qbf_R 2qbh_R* ...
Probab=99.95  E-value=1.1e-28  Score=181.43  Aligned_cols=70  Identities=50%  Similarity=0.850  Sum_probs=66.8

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCEECCCHHHCCCHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             7777888854350388511446889999962899848550331748999999999999999704658676
Q gi|254780330|r   13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN   82 (83)
Q Consensus        13 ~~~~~~k~c~~~~~~~~~iDYKn~~lL~~Fis~~GkI~prr~TG~~~k~Qr~i~~aIKrAR~~gLlPy~~   82 (83)
                      +...++++|+||.++++++||||+++|++||||+|+|+||++||+|+++||+|++|||+||.||||||++
T Consensus         3 k~~~r~k~c~~~~~~~~~idykn~~lL~~Fis~~GkIl~Rr~TGl~~k~Qrki~~aIkrAR~~gLlP~~~   72 (75)
T 3i1m_R            3 RYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTD   72 (75)
T ss_dssp             -----------------CCSTTCHHHHGGGBCTTCCBCCHHHHCCCHHHHHHHHHHHHHHHTTTSSCSSS
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             6467898897766799857865889999866888728177227868999999999999999843576354