BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780330|ref|YP_003064743.1| 30S ribosomal protein S18
[Candidatus Liberibacter asiaticus str. psy62]
         (83 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780330|ref|YP_003064743.1| 30S ribosomal protein S18 [Candidatus Liberibacter asiaticus str.
          psy62]
 gi|254040007|gb|ACT56803.1| 30S ribosomal protein S18 [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 83

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK
Sbjct: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60

Query: 61 KQRELAKAIKRARYLGLIAYVNL 83
          KQRELAKAIKRARYLGLIAYVNL
Sbjct: 61 KQRELAKAIKRARYLGLIAYVNL 83


>gi|315122245|ref|YP_004062734.1| 30S ribosomal protein S18 [Candidatus Liberibacter solanacearum
          CLso-ZC1]
 gi|313495647|gb|ADR52246.1| 30S ribosomal protein S18 [Candidatus Liberibacter solanacearum
          CLso-ZC1]
          Length = 84

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 76/79 (96%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          +P PLLRRN+SHRRKSCP SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVS KKQRE
Sbjct: 6  SPAPLLRRNMSHRRKSCPFSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSQKKQRE 65

Query: 65 LAKAIKRARYLGLIAYVNL 83
          LAKAIKRARYLGLIAYVN+
Sbjct: 66 LAKAIKRARYLGLIAYVNI 84


>gi|227821459|ref|YP_002825429.1| 30S ribosomal protein S18 [Sinorhizobium fredii NGR234]
 gi|254812951|sp|C3M9B0|RS18_RHISN RecName: Full=30S ribosomal protein S18
 gi|227340458|gb|ACP24676.1| 30S ribosomal protein S18 [Sinorhizobium fredii NGR234]
          Length = 82

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 68/81 (83%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MAEV+  P+ RR    RRK+CP SG  APRIDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MAEVSSAPV-RRPFHRRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA+AIKRAR+LGL+ YV
Sbjct: 60 KQRELAQAIKRARFLGLLPYV 80


>gi|15964890|ref|NP_385243.1| 30S ribosomal protein S18 [Sinorhizobium meliloti 1021]
 gi|150395964|ref|YP_001326431.1| 30S ribosomal protein S18 [Sinorhizobium medicae WSM419]
 gi|307300961|ref|ZP_07580730.1| ribosomal protein S18 [Sinorhizobium meliloti BL225C]
 gi|307322231|ref|ZP_07601599.1| ribosomal protein S18 [Sinorhizobium meliloti AK83]
 gi|20978707|sp|Q92QZ8|RS18_RHIME RecName: Full=30S ribosomal protein S18
 gi|166222244|sp|A6U7G6|RS18_SINMW RecName: Full=30S ribosomal protein S18
 gi|15074069|emb|CAC45716.1| Putative 30S ribosomal protein S18 [Sinorhizobium meliloti 1021]
 gi|150027479|gb|ABR59596.1| ribosomal protein S18 [Sinorhizobium medicae WSM419]
 gi|306892118|gb|EFN22936.1| ribosomal protein S18 [Sinorhizobium meliloti AK83]
 gi|306903916|gb|EFN34502.1| ribosomal protein S18 [Sinorhizobium meliloti BL225C]
          Length = 82

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 55/81 (67%), Positives = 68/81 (83%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MAEV+  P+ RR    RRK+CP SG  APRIDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MAEVSSAPV-RRPFHRRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA+AIKRAR+LGL+ Y+
Sbjct: 60 KQRELAQAIKRARFLGLLPYI 80


>gi|222085435|ref|YP_002543965.1| ribosomal protein S18 [Agrobacterium radiobacter K84]
 gi|254765402|sp|B9JCB8|RS18_AGRRK RecName: Full=30S ribosomal protein S18
 gi|221722883|gb|ACM26039.1| ribosomal protein S18 [Agrobacterium radiobacter K84]
          Length = 82

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/81 (67%), Positives = 68/81 (83%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M+EV+  P+ RR    RRK+CP SG  APRIDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MSEVSSAPV-RRPFHRRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA+AIKRAR+LGL+ YV
Sbjct: 60 KQRELAQAIKRARFLGLLPYV 80


>gi|222148135|ref|YP_002549092.1| 30S ribosomal protein S18 [Agrobacterium vitis S4]
 gi|254765403|sp|B9JUU1|RS18_AGRVS RecName: Full=30S ribosomal protein S18
 gi|221735123|gb|ACM36086.1| 30S ribosomal protein S18 [Agrobacterium vitis S4]
          Length = 82

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/81 (67%), Positives = 68/81 (83%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MAEV+ +  +RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MAEVSSS-TVRRPFHRRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|116251320|ref|YP_767158.1| 30S ribosomal protein S18 [Rhizobium leguminosarum bv. viciae
          3841]
 gi|209548656|ref|YP_002280573.1| 30S ribosomal protein S18 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|241203934|ref|YP_002975030.1| 30S ribosomal protein S18 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|122988597|sp|Q1MJ11|RS18_RHIL3 RecName: Full=30S ribosomal protein S18
 gi|229560056|sp|B5ZWC8|RS18_RHILW RecName: Full=30S ribosomal protein S18
 gi|115255968|emb|CAK07049.1| putative 30S ribosomal protein S18 [Rhizobium leguminosarum bv.
          viciae 3841]
 gi|209534412|gb|ACI54347.1| ribosomal protein S18 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|240857824|gb|ACS55491.1| ribosomal protein S18 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 82

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 67/81 (82%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M+E +  P+ RR    RRK+CP SG  APRIDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MSETSSAPV-RRPFHRRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA+AIKRAR+LGL+ YV
Sbjct: 60 KQRELAQAIKRARFLGLLPYV 80


>gi|86357077|ref|YP_468969.1| 30S ribosomal protein S18 [Rhizobium etli CFN 42]
 gi|190891121|ref|YP_001977663.1| 30S ribosomal protein S18 [Rhizobium etli CIAT 652]
 gi|123724812|sp|Q2KA94|RS18_RHIEC RecName: Full=30S ribosomal protein S18
 gi|229560055|sp|B3PUT6|RS18_RHIE6 RecName: Full=30S ribosomal protein S18
 gi|86281179|gb|ABC90242.1| 30S ribosomal protein S18 [Rhizobium etli CFN 42]
 gi|190696400|gb|ACE90485.1| 30S ribosomal protein S18 [Rhizobium etli CIAT 652]
 gi|327188000|gb|EGE55230.1| 30S ribosomal protein S18 [Rhizobium etli CNPAF512]
          Length = 82

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 67/81 (82%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M+E +  P+ RR    RRK+CP SG  APRIDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MSEASSAPV-RRPFHRRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA+AIKRAR+LGL+ YV
Sbjct: 60 KQRELAQAIKRARFLGLLPYV 80


>gi|83311200|ref|YP_421464.1| 30S ribosomal protein S18 [Magnetospirillum magneticum AMB-1]
 gi|123768010|sp|Q2W5H0|RS18_MAGMM RecName: Full=30S ribosomal protein S18
 gi|82946041|dbj|BAE50905.1| Ribosomal protein S18 [Magnetospirillum magneticum AMB-1]
          Length = 92

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 64/71 (90%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG+GAP+IDYKDI+LL+RF+S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 20 RRPFFRRRKTCPFSGEGAPKIDYKDIKLLSRFISERGKIVPSRITAVSAKKQRELAQAIK 79

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 80 RARFLGLLPYV 90


>gi|319408306|emb|CBI81959.1| 30S ribosomal protein S18 [Bartonella schoenbuchensis R1]
          Length = 82

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 66/81 (81%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M E+  TP+ RR    RRK+CP SG  AP+IDYKDI+LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MIEINQTPV-RRPFHRRRKTCPFSGANAPKIDYKDIKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA AIKRAR+LGL+ YV
Sbjct: 60 KQRELANAIKRARFLGLLPYV 80


>gi|319404042|emb|CBI77630.1| 30S ribosomal protein S18 [Bartonella rochalimae ATCC BAA-1498]
          Length = 83

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++  T + RR   HRRK+CP SG  AP+IDYKDI+LL R++S+RGKI+PSRI++VS K
Sbjct: 2  MTDIQQTSI-RRPFHHRRKTCPFSGANAPKIDYKDIKLLQRYISERGKIIPSRITAVSQK 60

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA AIKRAR+LGL+ YV
Sbjct: 61 KQRELANAIKRARFLGLLPYV 81


>gi|300023234|ref|YP_003755845.1| ribosomal protein S18 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525055|gb|ADJ23524.1| ribosomal protein S18 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 84

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 68/82 (82%), Gaps = 1/82 (1%)

Query: 1  MAEVAPTPL-LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSH 59
          MAE+A +    RR    RRK+CP SG+GAP+IDYKD+R L R++S+RGKIVPSRI++VS 
Sbjct: 1  MAEIASSGGGARRPFQRRRKTCPFSGEGAPKIDYKDVRTLGRYISERGKIVPSRITAVSA 60

Query: 60 KKQRELAKAIKRARYLGLIAYV 81
          KKQRELA+AIKRAR+LGL+ YV
Sbjct: 61 KKQRELAQAIKRARFLGLLPYV 82


>gi|319405479|emb|CBI79098.1| 30S ribosomal protein S18 [Bartonella sp. AR 15-3]
          Length = 82

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++  TP  RR   HRRK+CP S   AP+IDYKDI+LL R++S+RGKI+PSRI++VS K
Sbjct: 1  MTDIHQTPT-RRPFHHRRKTCPFSSTNAPKIDYKDIKLLQRYISERGKIIPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA AIKRAR+LGL+ YV
Sbjct: 60 KQRELATAIKRARFLGLLPYV 80


>gi|144899044|emb|CAM75908.1| 30S ribosomal protein S18 [Magnetospirillum gryphiswaldense
          MSR-1]
          Length = 90

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 51/71 (71%), Positives = 63/71 (88%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG+GAP+IDYKD +LL+RF+S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 18 RRPFFRRRKTCPFSGEGAPKIDYKDTKLLSRFISERGKIVPSRITAVSAKKQRELAQAIK 77

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 78 RARFLGLLPYV 88


>gi|319407054|emb|CBI80691.1| 30S ribosomal protein S18 [Bartonella sp. 1-1C]
          Length = 82

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++  T + RR   HRRK+CP SG  AP+IDYKDI+LL R++S+RGKI+PSRI++VS K
Sbjct: 1  MTDIHQTSV-RRPFHHRRKTCPFSGANAPKIDYKDIKLLQRYISERGKIIPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA AIKRAR+LGL+ YV
Sbjct: 60 KQRELANAIKRARFLGLLPYV 80


>gi|13476509|ref|NP_108079.1| 30S ribosomal protein S18 [Mesorhizobium loti MAFF303099]
 gi|260466964|ref|ZP_05813146.1| ribosomal protein S18 [Mesorhizobium opportunistum WSM2075]
 gi|319784439|ref|YP_004143915.1| ribosomal protein S18 [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|20978722|sp|Q984T9|RS18_RHILO RecName: Full=30S ribosomal protein S18
 gi|14027270|dbj|BAB54224.1| 30S ribosomal protein S18 [Mesorhizobium loti MAFF303099]
 gi|259029261|gb|EEW30555.1| ribosomal protein S18 [Mesorhizobium opportunistum WSM2075]
 gi|317170327|gb|ADV13865.1| ribosomal protein S18 [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 82

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|163759110|ref|ZP_02166196.1| 30S ribosomal protein S18 [Hoeflea phototrophica DFL-43]
 gi|162283514|gb|EDQ33799.1| 30S ribosomal protein S18 [Hoeflea phototrophica DFL-43]
          Length = 82

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|326529315|dbj|BAK01051.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 81

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/71 (71%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS KKQRELAKAIK
Sbjct: 9  RRPFHRRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSQKKQRELAKAIK 68

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 69 RARFLGLLPYV 79


>gi|153007913|ref|YP_001369128.1| 30S ribosomal protein S18 [Ochrobactrum anthropi ATCC 49188]
 gi|239831324|ref|ZP_04679653.1| ribosomal protein S18 [Ochrobactrum intermedium LMG 3301]
 gi|166220966|sp|A6WWE5|RS18_OCHA4 RecName: Full=30S ribosomal protein S18
 gi|151559801|gb|ABS13299.1| ribosomal protein S18 [Ochrobactrum anthropi ATCC 49188]
 gi|239823591|gb|EEQ95159.1| ribosomal protein S18 [Ochrobactrum intermedium LMG 3301]
          Length = 82

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    RRK+CP SG  AP+IDYKDI+LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRRKTCPFSGANAPKIDYKDIKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|319898717|ref|YP_004158810.1| 30S ribosomal protein S18 [Bartonella clarridgeiae 73]
 gi|319402681|emb|CBI76227.1| 30S ribosomal protein S18 [Bartonella clarridgeiae 73]
          Length = 82

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/81 (62%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++  T + RR   HRRK+CP SG  AP+IDYKD +LL R++S+RGKI+PSRI++VS K
Sbjct: 1  MTDINQTSV-RRPFHHRRKTCPFSGANAPKIDYKDTKLLQRYISERGKIIPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA AIKRAR+LGL+ YV
Sbjct: 60 KQRELANAIKRARFLGLLPYV 80


>gi|58038780|ref|YP_190744.1| 30S ribosomal protein S18 [Gluconobacter oxydans 621H]
 gi|81672744|sp|Q5FU58|RS18_GLUOX RecName: Full=30S ribosomal protein S18
 gi|58001194|gb|AAW60088.1| SSU ribosomal protein S18P [Gluconobacter oxydans 621H]
          Length = 96

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 24 RRPFYRRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIK 83

Query: 71 RARYLGLIAYV 81
          RAR+L L+ YV
Sbjct: 84 RARFLALLPYV 94


>gi|258542090|ref|YP_003187523.1| 30S ribosomal protein S18 [Acetobacter pasteurianus IFO 3283-01]
 gi|329114157|ref|ZP_08242919.1| 30S ribosomal protein S18 [Acetobacter pomorum DM001]
 gi|256633168|dbj|BAH99143.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636225|dbj|BAI02194.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639280|dbj|BAI05242.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642334|dbj|BAI08289.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645389|dbj|BAI11337.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648444|dbj|BAI14385.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651497|dbj|BAI17431.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO
          3283-01-42C]
 gi|256654488|dbj|BAI20415.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-12]
 gi|326696233|gb|EGE47912.1| 30S ribosomal protein S18 [Acetobacter pomorum DM001]
          Length = 91

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 19 RRPFYRRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIK 78

Query: 71 RARYLGLIAYV 81
          RAR+L L+ YV
Sbjct: 79 RARFLALLPYV 89


>gi|17987764|ref|NP_540398.1| 30S ribosomal protein S18 [Brucella melitensis bv. 1 str. 16M]
 gi|23501355|ref|NP_697482.1| 30S ribosomal protein S18 [Brucella suis 1330]
 gi|62289439|ref|YP_221232.1| 30S ribosomal protein S18 [Brucella abortus bv. 1 str. 9-941]
 gi|82699365|ref|YP_413939.1| 30S ribosomal protein S18 [Brucella melitensis biovar Abortus
          2308]
 gi|148560401|ref|YP_001258473.1| 30S ribosomal protein S18 [Brucella ovis ATCC 25840]
 gi|161618425|ref|YP_001592312.1| 30S ribosomal protein S18 [Brucella canis ATCC 23365]
 gi|189023689|ref|YP_001934457.1| 30S ribosomal protein S18 [Brucella abortus S19]
 gi|225626962|ref|ZP_03785001.1| ribosomal protein S18 [Brucella ceti str. Cudo]
 gi|225851990|ref|YP_002732223.1| 30S ribosomal protein S18 [Brucella melitensis ATCC 23457]
 gi|237814927|ref|ZP_04593925.1| ribosomal protein S18 [Brucella abortus str. 2308 A]
 gi|254688751|ref|ZP_05152005.1| 30S ribosomal protein S18 [Brucella abortus bv. 6 str. 870]
 gi|254693234|ref|ZP_05155062.1| 30S ribosomal protein S18 [Brucella abortus bv. 3 str. Tulya]
 gi|254696880|ref|ZP_05158708.1| 30S ribosomal protein S18 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701258|ref|ZP_05163086.1| 30S ribosomal protein S18 [Brucella suis bv. 5 str. 513]
 gi|254703805|ref|ZP_05165633.1| 30S ribosomal protein S18 [Brucella suis bv. 3 str. 686]
 gi|254707817|ref|ZP_05169645.1| 30S ribosomal protein S18 [Brucella pinnipedialis M163/99/10]
 gi|254709601|ref|ZP_05171412.1| 30S ribosomal protein S18 [Brucella pinnipedialis B2/94]
 gi|254712983|ref|ZP_05174794.1| 30S ribosomal protein S18 [Brucella ceti M644/93/1]
 gi|254716663|ref|ZP_05178474.1| 30S ribosomal protein S18 [Brucella ceti M13/05/1]
 gi|254718630|ref|ZP_05180441.1| 30S ribosomal protein S18 [Brucella sp. 83/13]
 gi|254729784|ref|ZP_05188362.1| 30S ribosomal protein S18 [Brucella abortus bv. 4 str. 292]
 gi|256031093|ref|ZP_05444707.1| 30S ribosomal protein S18 [Brucella pinnipedialis M292/94/1]
 gi|256044170|ref|ZP_05447077.1| 30S ribosomal protein S18 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060587|ref|ZP_05450755.1| 30S ribosomal protein S18 [Brucella neotomae 5K33]
 gi|256112978|ref|ZP_05453881.1| 30S ribosomal protein S18 [Brucella melitensis bv. 3 str. Ether]
 gi|256159166|ref|ZP_05456979.1| 30S ribosomal protein S18 [Brucella ceti M490/95/1]
 gi|256254496|ref|ZP_05460032.1| 30S ribosomal protein S18 [Brucella ceti B1/94]
 gi|256256998|ref|ZP_05462534.1| 30S ribosomal protein S18 [Brucella abortus bv. 9 str. C68]
 gi|256264503|ref|ZP_05467035.1| predicted protein [Brucella melitensis bv. 2 str. 63/9]
 gi|256368907|ref|YP_003106413.1| 30S ribosomal protein S18 [Brucella microti CCM 4915]
 gi|260168224|ref|ZP_05755035.1| 30S ribosomal protein S18 [Brucella sp. F5/99]
 gi|260545810|ref|ZP_05821551.1| predicted protein [Brucella abortus NCTC 8038]
 gi|260563528|ref|ZP_05834014.1| predicted protein [Brucella melitensis bv. 1 str. 16M]
 gi|260566942|ref|ZP_05837412.1| predicted protein [Brucella suis bv. 4 str. 40]
 gi|260754230|ref|ZP_05866578.1| SSU ribosomal protein S18P [Brucella abortus bv. 6 str. 870]
 gi|260757450|ref|ZP_05869798.1| SSU ribosomal protein S18P [Brucella abortus bv. 4 str. 292]
 gi|260761275|ref|ZP_05873618.1| SSU ribosomal protein S18P [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883256|ref|ZP_05894870.1| SSU ribosomal protein S18P [Brucella abortus bv. 9 str. C68]
 gi|261213477|ref|ZP_05927758.1| SSU ribosomal protein S18P [Brucella abortus bv. 3 str. Tulya]
 gi|261218464|ref|ZP_05932745.1| SSU ribosomal protein S18P [Brucella ceti M13/05/1]
 gi|261221670|ref|ZP_05935951.1| SSU ribosomal protein S18P [Brucella ceti B1/94]
 gi|261315304|ref|ZP_05954501.1| SSU ribosomal protein S18P [Brucella pinnipedialis M163/99/10]
 gi|261317129|ref|ZP_05956326.1| SSU ribosomal protein S18P [Brucella pinnipedialis B2/94]
 gi|261320686|ref|ZP_05959883.1| SSU ribosomal protein S18P [Brucella ceti M644/93/1]
 gi|261324583|ref|ZP_05963780.1| SSU ribosomal protein S18P [Brucella neotomae 5K33]
 gi|261751797|ref|ZP_05995506.1| SSU ribosomal protein S18P [Brucella suis bv. 5 str. 513]
 gi|261754452|ref|ZP_05998161.1| SSU ribosomal protein S18P [Brucella suis bv. 3 str. 686]
 gi|261757685|ref|ZP_06001394.1| predicted protein [Brucella sp. F5/99]
 gi|265983609|ref|ZP_06096344.1| SSU ribosomal protein S18P [Brucella sp. 83/13]
 gi|265988167|ref|ZP_06100724.1| SSU ribosomal protein S18P [Brucella pinnipedialis M292/94/1]
 gi|265990583|ref|ZP_06103140.1| SSU ribosomal protein S18P [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994413|ref|ZP_06106970.1| SSU ribosomal protein S18P [Brucella melitensis bv. 3 str. Ether]
 gi|265997633|ref|ZP_06110190.1| SSU ribosomal protein S18P [Brucella ceti M490/95/1]
 gi|297247851|ref|ZP_06931569.1| 30S ribosomal protein S18 [Brucella abortus bv. 5 str. B3196]
 gi|306839850|ref|ZP_07472648.1| ribosomal protein S18 [Brucella sp. NF 2653]
 gi|306842261|ref|ZP_07474924.1| ribosomal protein S18 [Brucella sp. BO2]
 gi|306845083|ref|ZP_07477663.1| ribosomal protein S18 [Brucella sp. BO1]
 gi|54039409|sp|P66454|RS18_BRUSU RecName: Full=30S ribosomal protein S18
 gi|54042144|sp|P66453|RS18_BRUME RecName: Full=30S ribosomal protein S18
 gi|75505331|sp|Q57ER3|RS18_BRUAB RecName: Full=30S ribosomal protein S18
 gi|123740899|sp|Q2YMH0|RS18_BRUA2 RecName: Full=30S ribosomal protein S18
 gi|166220928|sp|A5VP26|RS18_BRUO2 RecName: Full=30S ribosomal protein S18
 gi|189029650|sp|A9M8X7|RS18_BRUC2 RecName: Full=30S ribosomal protein S18
 gi|229559967|sp|B2S9V3|RS18_BRUA1 RecName: Full=30S ribosomal protein S18
 gi|254765414|sp|C0RHG1|RS18_BRUMB RecName: Full=30S ribosomal protein S18
 gi|17983486|gb|AAL52662.1| ssu ribosomal protein s18p [Brucella melitensis bv. 1 str. 16M]
 gi|23347248|gb|AAN29397.1| ribosomal protein S18 [Brucella suis 1330]
 gi|62195571|gb|AAX73871.1| RpsR, ribosomal protein s18 [Brucella abortus bv. 1 str. 9-941]
 gi|82615466|emb|CAJ10435.1| Ribosomal protein S18 [Brucella melitensis biovar Abortus 2308]
 gi|148371658|gb|ABQ61637.1| ribosomal protein S18 [Brucella ovis ATCC 25840]
 gi|161335236|gb|ABX61541.1| ribosomal protein S18 [Brucella canis ATCC 23365]
 gi|189019261|gb|ACD71983.1| Ribosomal protein S18 [Brucella abortus S19]
 gi|225618619|gb|EEH15662.1| ribosomal protein S18 [Brucella ceti str. Cudo]
 gi|225640355|gb|ACO00269.1| ribosomal protein S18 [Brucella melitensis ATCC 23457]
 gi|237789764|gb|EEP63974.1| ribosomal protein S18 [Brucella abortus str. 2308 A]
 gi|255999065|gb|ACU47464.1| 30S ribosomal protein S18 [Brucella microti CCM 4915]
 gi|260097217|gb|EEW81092.1| predicted protein [Brucella abortus NCTC 8038]
 gi|260153544|gb|EEW88636.1| predicted protein [Brucella melitensis bv. 1 str. 16M]
 gi|260156460|gb|EEW91540.1| predicted protein [Brucella suis bv. 4 str. 40]
 gi|260667768|gb|EEX54708.1| SSU ribosomal protein S18P [Brucella abortus bv. 4 str. 292]
 gi|260671707|gb|EEX58528.1| SSU ribosomal protein S18P [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674338|gb|EEX61159.1| SSU ribosomal protein S18P [Brucella abortus bv. 6 str. 870]
 gi|260872784|gb|EEX79853.1| SSU ribosomal protein S18P [Brucella abortus bv. 9 str. C68]
 gi|260915084|gb|EEX81945.1| SSU ribosomal protein S18P [Brucella abortus bv. 3 str. Tulya]
 gi|260920254|gb|EEX86907.1| SSU ribosomal protein S18P [Brucella ceti B1/94]
 gi|260923553|gb|EEX90121.1| SSU ribosomal protein S18P [Brucella ceti M13/05/1]
 gi|261293376|gb|EEX96872.1| SSU ribosomal protein S18P [Brucella ceti M644/93/1]
 gi|261296352|gb|EEX99848.1| SSU ribosomal protein S18P [Brucella pinnipedialis B2/94]
 gi|261300563|gb|EEY04060.1| SSU ribosomal protein S18P [Brucella neotomae 5K33]
 gi|261304330|gb|EEY07827.1| SSU ribosomal protein S18P [Brucella pinnipedialis M163/99/10]
 gi|261737669|gb|EEY25665.1| predicted protein [Brucella sp. F5/99]
 gi|261741550|gb|EEY29476.1| SSU ribosomal protein S18P [Brucella suis bv. 5 str. 513]
 gi|261744205|gb|EEY32131.1| SSU ribosomal protein S18P [Brucella suis bv. 3 str. 686]
 gi|262552101|gb|EEZ08091.1| SSU ribosomal protein S18P [Brucella ceti M490/95/1]
 gi|262765526|gb|EEZ11315.1| SSU ribosomal protein S18P [Brucella melitensis bv. 3 str. Ether]
 gi|263001367|gb|EEZ13942.1| SSU ribosomal protein S18P [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094836|gb|EEZ18574.1| predicted protein [Brucella melitensis bv. 2 str. 63/9]
 gi|264660364|gb|EEZ30625.1| SSU ribosomal protein S18P [Brucella pinnipedialis M292/94/1]
 gi|264662201|gb|EEZ32462.1| SSU ribosomal protein S18P [Brucella sp. 83/13]
 gi|297175020|gb|EFH34367.1| 30S ribosomal protein S18 [Brucella abortus bv. 5 str. B3196]
 gi|306274498|gb|EFM56293.1| ribosomal protein S18 [Brucella sp. BO1]
 gi|306287641|gb|EFM59088.1| ribosomal protein S18 [Brucella sp. BO2]
 gi|306405036|gb|EFM61317.1| ribosomal protein S18 [Brucella sp. NF 2653]
 gi|326408486|gb|ADZ65551.1| Ribosomal protein S18 [Brucella melitensis M28]
 gi|326538202|gb|ADZ86417.1| ribosomal protein S18 [Brucella melitensis M5-90]
          Length = 82

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    RRK+CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRRKTCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|312113718|ref|YP_004011314.1| ribosomal protein S18 [Rhodomicrobium vannielii ATCC 17100]
 gi|311218847|gb|ADP70215.1| ribosomal protein S18 [Rhodomicrobium vannielii ATCC 17100]
          Length = 83

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG+ AP IDYKD+RLL RF+S+RGKIVPSRI++VS KKQRELAKAIK
Sbjct: 11 RRPFYRRRKTCPFSGENAPVIDYKDVRLLQRFVSERGKIVPSRITAVSAKKQRELAKAIK 70

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 71 RARFLGLLPYV 81


>gi|159184609|ref|NP_529002.1| 30S ribosomal protein S18 [Agrobacterium tumefaciens str. C58]
 gi|325292469|ref|YP_004278333.1| 30S ribosomal protein S18 [Agrobacterium sp. H13-3]
 gi|23822149|sp|Q8UGE8|RS18_AGRT5 RecName: Full=30S ribosomal protein S18
 gi|17739485|gb|AAL42103.1| 30S ribosomal protein S18 [Agrobacterium tumefaciens str. C58]
 gi|325060322|gb|ADY64013.1| 30S ribosomal protein S18 [Agrobacterium sp. H13-3]
          Length = 82

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 10 RRPFHRRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSQKKQRELAQAIK 69

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 70 RARFLGLLPYV 80


>gi|49475325|ref|YP_033366.1| 30S ribosomal protein S18 [Bartonella henselae str. Houston-1]
 gi|59798706|sp|Q6G447|RS18_BARHE RecName: Full=30S ribosomal protein S18
 gi|49238131|emb|CAF27339.1| 30S ribosomal protein s18 [Bartonella henselae str. Houston-1]
          Length = 82

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M E+  T + RR    RRK+CP SG  AP+IDYKDI+LL R++S+RGKIVPSRI+++S K
Sbjct: 1  MTEMNQTAI-RRPFHRRRKTCPFSGTNAPKIDYKDIKLLQRYISERGKIVPSRITAISQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA AIKRAR+LGL+ YV
Sbjct: 60 KQRELANAIKRARFLGLLPYV 80


>gi|114328879|ref|YP_746036.1| 30S ribosomal protein S18 [Granulibacter bethesdensis CGDNIH1]
 gi|122326172|sp|Q0BPY9|RS18_GRABC RecName: Full=30S ribosomal protein S18
 gi|114317053|gb|ABI63113.1| SSU ribosomal protein S18P [Granulibacter bethesdensis CGDNIH1]
          Length = 91

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 51/71 (71%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 19 RRPFYRRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIK 78

Query: 71 RARYLGLIAYV 81
          RAR+L L+ Y+
Sbjct: 79 RARFLALLPYI 89


>gi|49474087|ref|YP_032129.1| 30S ribosomal protein S18 [Bartonella quintana str. Toulouse]
 gi|59798702|sp|Q6G061|RS18_BARQU RecName: Full=30S ribosomal protein S18
 gi|49239591|emb|CAF25948.1| 30s ribosomal protein s18 [Bartonella quintana str. Toulouse]
          Length = 82

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M+E+  T + RR    RRK+CP SG  AP+IDYKDI+LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MSEINQT-VTRRPFHRRRKTCPFSGANAPKIDYKDIKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          +QRELA AIKRAR+LGL+ YV
Sbjct: 60 RQRELANAIKRARFLGLLPYV 80


>gi|330993922|ref|ZP_08317852.1| 30S ribosomal protein S18 [Gluconacetobacter sp. SXCC-1]
 gi|329758868|gb|EGG75382.1| 30S ribosomal protein S18 [Gluconacetobacter sp. SXCC-1]
          Length = 91

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/71 (71%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 19 RRPFYRRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIK 78

Query: 71 RARYLGLIAYV 81
          RAR+L L+ Y+
Sbjct: 79 RARFLALLPYI 89


>gi|296116662|ref|ZP_06835272.1| 30S ribosomal protein S18 [Gluconacetobacter hansenii ATCC 23769]
 gi|295976874|gb|EFG83642.1| 30S ribosomal protein S18 [Gluconacetobacter hansenii ATCC 23769]
          Length = 91

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/71 (71%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 19 RRPFYRRRKSCPFSGPNAPQIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIK 78

Query: 71 RARYLGLIAYV 81
          RAR+L L+ Y+
Sbjct: 79 RARFLALLPYI 89


>gi|148260511|ref|YP_001234638.1| 30S ribosomal protein S18 [Acidiphilium cryptum JF-5]
 gi|326403703|ref|YP_004283785.1| 30S ribosomal protein S18 [Acidiphilium multivorum AIU301]
 gi|205556745|sp|A5FYN7|RS18_ACICJ RecName: Full=30S ribosomal protein S18
 gi|146402192|gb|ABQ30719.1| SSU ribosomal protein S18P [Acidiphilium cryptum JF-5]
 gi|325050565|dbj|BAJ80903.1| 30S ribosomal protein S18 [Acidiphilium multivorum AIU301]
          Length = 95

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/71 (71%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 23 RRPFYRRRKACPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELARAIK 82

Query: 71 RARYLGLIAYV 81
          RAR+L L+ YV
Sbjct: 83 RARFLALLPYV 93


>gi|162149102|ref|YP_001603563.1| 30S ribosomal protein S18 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|209545155|ref|YP_002277384.1| 30S ribosomal protein S18 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|254812942|sp|A9H1M6|RS18_GLUDA RecName: Full=30S ribosomal protein S18
 gi|161787679|emb|CAP57275.1| putative 30S ribosomal protein S18 [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209532832|gb|ACI52769.1| ribosomal protein S18 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 91

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 19 RRPFYRRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIK 78

Query: 71 RARYLGLIAYV 81
          RAR++ L+ Y+
Sbjct: 79 RARFMALLPYI 89


>gi|296532305|ref|ZP_06895044.1| 30S ribosomal protein S18 [Roseomonas cervicalis ATCC 49957]
 gi|296267381|gb|EFH13267.1| 30S ribosomal protein S18 [Roseomonas cervicalis ATCC 49957]
          Length = 93

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA AIK
Sbjct: 20 RRPFYRRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSGKKQRELANAIK 79

Query: 71 RARYLGLIAYV 81
          RAR+L L+ YV
Sbjct: 80 RARFLALLPYV 90


>gi|110634267|ref|YP_674475.1| 30S ribosomal protein S18 [Mesorhizobium sp. BNC1]
 gi|122965901|sp|Q11H15|RS18_MESSB RecName: Full=30S ribosomal protein S18
 gi|110285251|gb|ABG63310.1| SSU ribosomal protein S18P [Chelativorans sp. BNC1]
          Length = 82

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 51/81 (62%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    RRK+CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRRKTCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA+AIKRAR+LGL+ YV
Sbjct: 60 KQRELARAIKRARFLGLLPYV 80


>gi|240850218|ref|YP_002971611.1| 30S ribosomal protein S18 [Bartonella grahamii as4aup]
 gi|240267341|gb|ACS50929.1| 30S ribosomal protein S18 [Bartonella grahamii as4aup]
          Length = 82

 Score =  106 bits (265), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKDI+LL R++S+RGKIVPSRI++VS KKQRELA AIK
Sbjct: 10 RRPFHRRRKTCPFSGTNAPKIDYKDIKLLQRYISERGKIVPSRITAVSQKKQRELANAIK 69

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 70 RARFLGLLPYV 80


>gi|302383705|ref|YP_003819528.1| ribosomal protein S18 [Brevundimonas subvibrioides ATCC 15264]
 gi|302194333|gb|ADL01905.1| ribosomal protein S18 [Brevundimonas subvibrioides ATCC 15264]
          Length = 90

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 66/88 (75%), Gaps = 7/88 (7%)

Query: 1  MAEVAPTPLL-------RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSR 53
          M +   TP +       RR  + RRK CP +G+GAP+IDYKD++LL R++S+RGKIVPSR
Sbjct: 1  MTDTTSTPGMPVGSGSGRRPFNRRRKVCPFTGEGAPKIDYKDVKLLQRYISERGKIVPSR 60

Query: 54 ISSVSHKKQRELAKAIKRARYLGLIAYV 81
          I++VS  KQRELAKAIKRARYL L+ YV
Sbjct: 61 ITAVSQIKQRELAKAIKRARYLALLPYV 88


>gi|163868014|ref|YP_001609218.1| 30S ribosomal protein S18 [Bartonella tribocorum CIP 105476]
 gi|189029667|sp|A9IRU1|RS18_BART1 RecName: Full=30S ribosomal protein S18
 gi|161017665|emb|CAK01223.1| 30S ribosomal protein S18 [Bartonella tribocorum CIP 105476]
          Length = 82

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKDI+LL R++S+RGKIVPSRI++VS KKQRELA AIK
Sbjct: 10 RRPFHRRRKTCPFSGATAPKIDYKDIKLLQRYISERGKIVPSRITAVSQKKQRELANAIK 69

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 70 RARFLGLLPYV 80


>gi|254473485|ref|ZP_05086882.1| ribosomal protein S18 [Pseudovibrio sp. JE062]
 gi|211957601|gb|EEA92804.1| ribosomal protein S18 [Pseudovibrio sp. JE062]
          Length = 81

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKDIRLL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 9  RRPFFRRRKTCPFSGANAPKIDYKDIRLLQRYISERGKIVPSRITAVSAKKQRELARAIK 68

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ +V
Sbjct: 69 RARFLGLLPFV 79


>gi|163842734|ref|YP_001627138.1| 30S ribosomal protein S18 [Brucella suis ATCC 23445]
 gi|189029668|sp|B0CKD8|RS18_BRUSI RecName: Full=30S ribosomal protein S18
 gi|163673457|gb|ABY37568.1| ribosomal protein S18 [Brucella suis ATCC 23445]
          Length = 82

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/81 (62%), Positives = 64/81 (79%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    R K+CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRHKTCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|254418129|ref|ZP_05031853.1| ribosomal protein S18 [Brevundimonas sp. BAL3]
 gi|196184306|gb|EDX79282.1| ribosomal protein S18 [Brevundimonas sp. BAL3]
          Length = 92

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 59/71 (83%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELAKAIK
Sbjct: 20 RRPFYRRRKVCPFSGANAPKIDYKDVKLLQRYVSERGKIVPSRITAVSQKKQRELAKAIK 79

Query: 71 RARYLGLIAYV 81
          RARYL L+ YV
Sbjct: 80 RARYLALLPYV 90


>gi|294851832|ref|ZP_06792505.1| 30S ribosomal protein S18 [Brucella sp. NVSL 07-0026]
 gi|294820421|gb|EFG37420.1| 30S ribosomal protein S18 [Brucella sp. NVSL 07-0026]
          Length = 82

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/81 (62%), Positives = 64/81 (79%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    RRK+CP S   AP+IDYKD++LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRRKTCPFSSANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|304392028|ref|ZP_07373970.1| ribosomal protein S18 [Ahrensia sp. R2A130]
 gi|303296257|gb|EFL90615.1| ribosomal protein S18 [Ahrensia sp. R2A130]
          Length = 82

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/71 (67%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G+ AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 10 RRPFQRRRKTCPFTGENAPKIDYKDVKLLQRYISERGKIVPSRITAVSLKKQRELARAIK 69

Query: 71 RARYLGLIAYV 81
          RAR+L LI YV
Sbjct: 70 RARFLALIPYV 80


>gi|298291082|ref|YP_003693021.1| ribosomal protein S18 [Starkeya novella DSM 506]
 gi|296927593|gb|ADH88402.1| ribosomal protein S18 [Starkeya novella DSM 506]
          Length = 88

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 16 RRPFFRRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSAKKQRELAQAIK 75

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ +V
Sbjct: 76 RARFLGLLPFV 86


>gi|85708888|ref|ZP_01039954.1| 30S ribosomal protein S18 [Erythrobacter sp. NAP1]
 gi|85690422|gb|EAQ30425.1| 30S ribosomal protein S18 [Erythrobacter sp. NAP1]
          Length = 74

 Score =  105 bits (261), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 61/72 (84%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP SGK AP+IDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELAKAI
Sbjct: 1  MARPFFRRRKSCPFSGKDAPKIDYKDVRLLQGFMSERGKIVPSRITAVSAKKQRELAKAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ Y+
Sbjct: 61 KRARHIGLLPYI 72


>gi|332185156|ref|ZP_08386905.1| ribosomal protein S18 [Sphingomonas sp. S17]
 gi|332014880|gb|EGI56936.1| ribosomal protein S18 [Sphingomonas sp. S17]
          Length = 74

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP S K APRIDYKD+RLL  F+S+RGKIVPSRI+SVS KKQRELA+AI
Sbjct: 1  MARPFFRRRKSCPFSAKDAPRIDYKDVRLLQGFVSERGKIVPSRITSVSAKKQRELAQAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR+LGL+ YV
Sbjct: 61 KRARHLGLLPYV 72


>gi|163797515|ref|ZP_02191466.1| Ribosomal protein S18 [alpha proteobacterium BAL199]
 gi|159177264|gb|EDP61823.1| Ribosomal protein S18 [alpha proteobacterium BAL199]
          Length = 84

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 61/72 (84%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          +RR    RRKSCP SG GAP IDYKD +LL+RF+S+RGKIVPSRI++VS KKQRE+A+AI
Sbjct: 11 VRRPFMRRRKSCPFSGTGAPIIDYKDTKLLSRFISERGKIVPSRITAVSAKKQREMARAI 70

Query: 70 KRARYLGLIAYV 81
          KR+R+L L+ YV
Sbjct: 71 KRSRFLALLPYV 82


>gi|288958519|ref|YP_003448860.1| small subunit ribosomal protein S18 [Azospirillum sp. B510]
 gi|288910827|dbj|BAI72316.1| small subunit ribosomal protein S18 [Azospirillum sp. B510]
          Length = 89

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP IDYKD++LL+RF+S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 17 RRPFFRRRKTCPFSGANAPAIDYKDVKLLSRFISERGKIVPSRITAVSTKKQRELARAIK 76

Query: 71 RARYLGLIAYV 81
          RAR+L L+ YV
Sbjct: 77 RARFLALLPYV 87


>gi|326389001|ref|ZP_08210583.1| 30S ribosomal protein S18 [Novosphingobium nitrogenifigens DSM
          19370]
 gi|326206601|gb|EGD57436.1| 30S ribosomal protein S18 [Novosphingobium nitrogenifigens DSM
          19370]
          Length = 74

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 61/72 (84%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP SGK AP+IDYKD+RLL  F+S+RGKIVPSRI++VS KKQREL++AI
Sbjct: 1  MARPFFRRRKSCPFSGKNAPKIDYKDVRLLQGFMSERGKIVPSRITAVSAKKQRELSQAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR+LGL+ Y+
Sbjct: 61 KRARHLGLLPYI 72


>gi|121602413|ref|YP_988808.1| 30S ribosomal protein S18 [Bartonella bacilliformis KC583]
 gi|166220924|sp|A1US55|RS18_BARBK RecName: Full=30S ribosomal protein S18
 gi|120614590|gb|ABM45191.1| ribosomal protein S18 [Bartonella bacilliformis KC583]
          Length = 82

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 60/73 (82%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          L RR  + RRK+CP SG    +IDYKDI+LL R++S+RGKIVPSRI++VS KKQRELA A
Sbjct: 8  LARRPFNRRRKTCPFSGTNVAKIDYKDIKLLQRYISERGKIVPSRITAVSQKKQRELANA 67

Query: 69 IKRARYLGLIAYV 81
          IKRAR+LGL+ YV
Sbjct: 68 IKRARFLGLLPYV 80


>gi|296285060|ref|ZP_06863058.1| 30S ribosomal protein S18 [Citromicrobium bathyomarinum JL354]
          Length = 74

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 60/72 (83%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK+CP SGK AP IDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELAKAI
Sbjct: 1  MARPFFRRRKTCPFSGKNAPVIDYKDVRLLQGFMSERGKIVPSRITAVSAKKQRELAKAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ YV
Sbjct: 61 KRARHIGLLPYV 72


>gi|148553013|ref|YP_001260595.1| 30S ribosomal protein S18 [Sphingomonas wittichii RW1]
 gi|205617566|sp|A5V2E1|RS18_SPHWW RecName: Full=30S ribosomal protein S18
 gi|148498203|gb|ABQ66457.1| SSU ribosomal protein S18P [Sphingomonas wittichii RW1]
          Length = 74

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 60/72 (83%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP S K APRIDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELA+AI
Sbjct: 1  MARAFFRRRKSCPFSAKDAPRIDYKDVRLLQGFVSERGKIVPSRITAVSAKKQRELAQAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ Y+
Sbjct: 61 KRARHIGLLPYI 72


>gi|87199436|ref|YP_496693.1| 30S ribosomal protein S18 [Novosphingobium aromaticivorans DSM
          12444]
 gi|123763556|sp|Q2G8G4|RS18_NOVAD RecName: Full=30S ribosomal protein S18
 gi|87135117|gb|ABD25859.1| SSU ribosomal protein S18P [Novosphingobium aromaticivorans DSM
          12444]
          Length = 74

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/72 (66%), Positives = 61/72 (84%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP SGK AP+IDYKD+RLL  F+S+RGKIVPSRI++VS KKQREL++AI
Sbjct: 1  MARPFFRRRKSCPFSGKNAPKIDYKDVRLLQGFMSERGKIVPSRITAVSAKKQRELSQAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ Y+
Sbjct: 61 KRARHIGLLPYI 72


>gi|295689696|ref|YP_003593389.1| 30S ribosomal protein S18 [Caulobacter segnis ATCC 21756]
 gi|295431599|gb|ADG10771.1| ribosomal protein S18 [Caulobacter segnis ATCC 21756]
          Length = 92

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 57/65 (87%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELAKAIKRAR+L 
Sbjct: 26 RRKVCPFSGANAPKIDYKDVKLLQRYVSERGKIVPSRITAVSAKKQRELAKAIKRARFLA 85

Query: 77 LIAYV 81
          L+ YV
Sbjct: 86 LLPYV 90


>gi|27379189|ref|NP_770718.1| 30S ribosomal protein S18 [Bradyrhizobium japonicum USDA 110]
 gi|59798894|sp|Q89MW4|RS18_BRAJA RecName: Full=30S ribosomal protein S18
 gi|27352340|dbj|BAC49343.1| 30S ribosomal protein S18 [Bradyrhizobium japonicum USDA 110]
          Length = 79

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 7  RRPFFRRRKSCPFTGANAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|154247048|ref|YP_001418006.1| 30S ribosomal protein S18 [Xanthobacter autotrophicus Py2]
 gi|205618870|sp|A7IK06|RS18_XANP2 RecName: Full=30S ribosomal protein S18
 gi|154161133|gb|ABS68349.1| ribosomal protein S18 [Xanthobacter autotrophicus Py2]
          Length = 88

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS KKQREL+ AIK
Sbjct: 16 RRPFFRRRKTCPFSGPNAPKIDYKDVRLLQRYISERGKIVPSRITAVSAKKQRELSAAIK 75

Query: 71 RARYLGLIAYV 81
          R+R+LGL+ +V
Sbjct: 76 RSRFLGLLPFV 86


>gi|294084212|ref|YP_003550970.1| 30S ribosomal protein S18 [Candidatus Puniceispirillum marinum
          IMCC1322]
 gi|292663785|gb|ADE38886.1| ribosomal protein S18 [Candidatus Puniceispirillum marinum
          IMCC1322]
          Length = 84

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/72 (66%), Positives = 59/72 (81%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          LR+  + RRKSCP SG  AP+IDYKD +LL R+ S+RGKI+PSRIS+VS KKQRELA AI
Sbjct: 11 LRKPFNRRRKSCPFSGANAPKIDYKDTKLLARYTSERGKIIPSRISAVSAKKQRELATAI 70

Query: 70 KRARYLGLIAYV 81
          KR+R+L L+ YV
Sbjct: 71 KRSRFLALMPYV 82


>gi|16125914|ref|NP_420478.1| 30S ribosomal protein S18 [Caulobacter crescentus CB15]
 gi|167646473|ref|YP_001684136.1| 30S ribosomal protein S18 [Caulobacter sp. K31]
 gi|221234677|ref|YP_002517113.1| 30S ribosomal protein S18 [Caulobacter crescentus NA1000]
 gi|20978733|sp|Q9A7Q2|RS18_CAUCR RecName: Full=30S ribosomal protein S18
 gi|189029669|sp|B0SWL0|RS18_CAUSK RecName: Full=30S ribosomal protein S18
 gi|254765418|sp|B8GVN5|RS18_CAUCN RecName: Full=30S ribosomal protein S18
 gi|13423076|gb|AAK23646.1| ribosomal protein S18 [Caulobacter crescentus CB15]
 gi|167348903|gb|ABZ71638.1| ribosomal protein S18 [Caulobacter sp. K31]
 gi|220963849|gb|ACL95205.1| SSU ribosomal protein S18P [Caulobacter crescentus NA1000]
          Length = 92

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 57/65 (87%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELAKAIKRAR+L 
Sbjct: 26 RRKVCPFSGANAPKIDYKDVKLLQRYVSERGKIVPSRITAVSAKKQRELAKAIKRARFLA 85

Query: 77 LIAYV 81
          L+ YV
Sbjct: 86 LLPYV 90


>gi|91977454|ref|YP_570113.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris BisB5]
 gi|123721763|sp|Q135M7|RS18_RHOPS RecName: Full=30S ribosomal protein S18
 gi|91683910|gb|ABE40212.1| SSU ribosomal protein S18P [Rhodopseudomonas palustris BisB5]
          Length = 79

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/71 (67%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 7  RRPFFRRRKTCPFTGTNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|323136068|ref|ZP_08071151.1| ribosomal protein S18 [Methylocystis sp. ATCC 49242]
 gi|322399159|gb|EFY01678.1| ribosomal protein S18 [Methylocystis sp. ATCC 49242]
          Length = 78

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          KSCP SG  AP+IDYKD RLL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LGL+
Sbjct: 14 KSCPFSGANAPKIDYKDTRLLSRYISERGKIVPSRITAVSAKKQRELAQAIKRARFLGLL 73

Query: 79 AYV 81
           YV
Sbjct: 74 PYV 76


>gi|83945280|ref|ZP_00957629.1| 30S ribosomal protein S18 [Oceanicaulis alexandrii HTCC2633]
 gi|83851450|gb|EAP89306.1| 30S ribosomal protein S18 [Oceanicaulis alexandrii HTCC2633]
          Length = 84

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/81 (62%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPL-LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSH 59
          MAE++ + +  RR    RRK CP SG+ AP+IDYKDI+LL R++S+RGKIVPSRI++VS 
Sbjct: 1  MAELSISNVPARRAFQRRRKVCPFSGENAPKIDYKDIKLLQRYMSERGKIVPSRITAVSA 60

Query: 60 KKQRELAKAIKRARYLGLIAY 80
          KKQRELA+AIKRAR L L+ Y
Sbjct: 61 KKQRELARAIKRARVLALLPY 81


>gi|296444436|ref|ZP_06886401.1| ribosomal protein S18 [Methylosinus trichosporium OB3b]
 gi|296258083|gb|EFH05145.1| ribosomal protein S18 [Methylosinus trichosporium OB3b]
          Length = 78

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          KSCP SG  AP+IDYKD RLL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LGL+
Sbjct: 14 KSCPFSGANAPKIDYKDTRLLSRYISERGKIVPSRITAVSAKKQRELAQAIKRARFLGLL 73

Query: 79 AYV 81
           YV
Sbjct: 74 PYV 76


>gi|39936141|ref|NP_948417.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris CGA009]
 gi|192291859|ref|YP_001992464.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris TIE-1]
 gi|316933692|ref|YP_004108674.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris DX-1]
 gi|59798743|sp|Q6N5A3|RS18_RHOPA RecName: Full=30S ribosomal protein S18; AltName: Full=RRP-S18
 gi|229560057|sp|B3Q9T6|RS18_RHOPT RecName: Full=30S ribosomal protein S18
 gi|39649995|emb|CAE28519.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris CGA009]
 gi|192285608|gb|ACF01989.1| ribosomal protein S18 [Rhodopseudomonas palustris TIE-1]
 gi|315601406|gb|ADU43941.1| ribosomal protein S18 [Rhodopseudomonas palustris DX-1]
          Length = 79

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/71 (67%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 7  RRPFFRRRKTCPFTGANAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|158425931|ref|YP_001527223.1| 30S ribosomal protein S18 [Azorhizobium caulinodans ORS 571]
 gi|205556908|sp|A8HVE8|RS18_AZOC5 RecName: Full=30S ribosomal protein S18
 gi|158332820|dbj|BAF90305.1| ribosomal protein S18 [Azorhizobium caulinodans ORS 571]
          Length = 85

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 46/65 (70%), Positives = 58/65 (89%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS KKQREL+ AIKRAR+LG
Sbjct: 19 RRKTCPFSGPNAPKIDYKDVRLLQRYISERGKIVPSRITAVSAKKQRELSAAIKRARFLG 78

Query: 77 LIAYV 81
          L+ +V
Sbjct: 79 LLPFV 83


>gi|85374300|ref|YP_458362.1| 30S ribosomal protein S18 [Erythrobacter litoralis HTCC2594]
 gi|123099521|sp|Q2N9S6|RS18_ERYLH RecName: Full=30S ribosomal protein S18
 gi|84787383|gb|ABC63565.1| ribosomal protein S18 [Erythrobacter litoralis HTCC2594]
          Length = 74

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/72 (66%), Positives = 59/72 (81%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK+CP S K AP+IDYKD RLL  F+S+RGKIVPSRI++VS KKQRELAKAI
Sbjct: 1  MARPFFRRRKTCPFSAKNAPKIDYKDTRLLQGFMSERGKIVPSRITAVSAKKQRELAKAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ Y+
Sbjct: 61 KRARHIGLLPYI 72


>gi|83591753|ref|YP_425505.1| 30S ribosomal protein S18 [Rhodospirillum rubrum ATCC 11170]
 gi|123753309|sp|Q2RXC7|RS18_RHORT RecName: Full=30S ribosomal protein S18
 gi|83574667|gb|ABC21218.1| SSU ribosomal protein S18P [Rhodospirillum rubrum ATCC 11170]
          Length = 78

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG GAP+IDYKDI+LL RF+S+RGKIVPSRI++VS KKQRELA+AIKRAR+L L+
Sbjct: 14 KTCPFSGAGAPKIDYKDIKLLLRFVSERGKIVPSRITAVSAKKQRELARAIKRARFLSLL 73

Query: 79 AYV 81
           YV
Sbjct: 74 PYV 76


>gi|149184753|ref|ZP_01863071.1| 30S ribosomal protein S18 [Erythrobacter sp. SD-21]
 gi|148832073|gb|EDL50506.1| 30S ribosomal protein S18 [Erythrobacter sp. SD-21]
          Length = 74

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/72 (66%), Positives = 59/72 (81%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK+CP S K AP IDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELAKAI
Sbjct: 1  MARPFFRRRKTCPFSAKNAPAIDYKDVRLLQGFMSERGKIVPSRITAVSAKKQRELAKAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ Y+
Sbjct: 61 KRARHIGLLPYI 72


>gi|86749583|ref|YP_486079.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris HaA2]
 gi|115525312|ref|YP_782223.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris BisA53]
 gi|122295614|sp|Q07LE1|RS18_RHOP5 RecName: Full=30S ribosomal protein S18
 gi|123098720|sp|Q2IX92|RS18_RHOP2 RecName: Full=30S ribosomal protein S18
 gi|86572611|gb|ABD07168.1| SSU ribosomal protein S18P [Rhodopseudomonas palustris HaA2]
 gi|115519259|gb|ABJ07243.1| SSU ribosomal protein S18P [Rhodopseudomonas palustris BisA53]
          Length = 79

 Score =  101 bits (251), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/71 (67%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 7  RRPFFRRRKTCPFTGPNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|114704793|ref|ZP_01437701.1| 30S ribosomal protein S18 [Fulvimarina pelagi HTCC2506]
 gi|114539578|gb|EAU42698.1| 30S ribosomal protein S18 [Fulvimarina pelagi HTCC2506]
          Length = 82

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 62/81 (76%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++A  P  RR    RRKS P SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDIAQLPT-RRPFHRRRKSDPFSGNDAPKIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QR LAKAIKRAR LGL+ YV
Sbjct: 60 NQRALAKAIKRARILGLLPYV 80


>gi|294011582|ref|YP_003545042.1| ribosomal protein S18 [Sphingobium japonicum UT26S]
 gi|307294384|ref|ZP_07574228.1| ribosomal protein S18 [Sphingobium chlorophenolicum L-1]
 gi|292674912|dbj|BAI96430.1| ribosomal protein S18 [Sphingobium japonicum UT26S]
 gi|306880535|gb|EFN11752.1| ribosomal protein S18 [Sphingobium chlorophenolicum L-1]
          Length = 74

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/72 (66%), Positives = 60/72 (83%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP + K AP+IDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELA+AI
Sbjct: 1  MARPFFRRRKSCPFAAKDAPKIDYKDVRLLQGFVSERGKIVPSRITAVSAKKQRELAQAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR+LGL+ Y+
Sbjct: 61 KRARHLGLLPYI 72


>gi|92117879|ref|YP_577608.1| 30S ribosomal protein S18 [Nitrobacter hamburgensis X14]
 gi|123083638|sp|Q1QKU9|RS18_NITHX RecName: Full=30S ribosomal protein S18
 gi|91800773|gb|ABE63148.1| SSU ribosomal protein S18P [Nitrobacter hamburgensis X14]
          Length = 79

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+A+K
Sbjct: 7  RRPFFRRRKTCPFTGANAPKIDYKDSKLLMRYISERGKIVPSRITAVSAKKQRELARAVK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|217977084|ref|YP_002361231.1| 30S ribosomal protein S18 [Methylocella silvestris BL2]
 gi|254812948|sp|B8ESH9|RS18_METSB RecName: Full=30S ribosomal protein S18
 gi|217502460|gb|ACK49869.1| ribosomal protein S18 [Methylocella silvestris BL2]
          Length = 80

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD RLL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LGL+
Sbjct: 16 KTCPFSGPNAPKIDYKDTRLLSRYISERGKIVPSRITAVSAKKQRELAQAIKRARFLGLL 75

Query: 79 AYV 81
           YV
Sbjct: 76 PYV 78


>gi|85716345|ref|ZP_01047318.1| 30S ribosomal protein S18 [Nitrobacter sp. Nb-311A]
 gi|85696861|gb|EAQ34746.1| 30S ribosomal protein S18 [Nitrobacter sp. Nb-311A]
          Length = 79

 Score =  100 bits (250), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+A+K
Sbjct: 7  RRPFFRRRKTCPFTGSNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAVK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|75675884|ref|YP_318305.1| 30S ribosomal protein S18 [Nitrobacter winogradskyi Nb-255]
 gi|123773250|sp|Q3SRY8|RS18_NITWN RecName: Full=30S ribosomal protein S18
 gi|74420754|gb|ABA04953.1| SSU ribosomal protein S18P [Nitrobacter winogradskyi Nb-255]
          Length = 79

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+A+K
Sbjct: 7  RRPFFRRRKTCPFTGANAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAVK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|182679260|ref|YP_001833406.1| 30S ribosomal protein S18 [Beijerinckia indica subsp. indica ATCC
          9039]
 gi|205557047|sp|B2IHD2|RS18_BEII9 RecName: Full=30S ribosomal protein S18
 gi|182635143|gb|ACB95917.1| ribosomal protein S18 [Beijerinckia indica subsp. indica ATCC
          9039]
          Length = 80

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD RLL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LGL+
Sbjct: 16 KTCPFSGPNAPKIDYKDTRLLSRYISERGKIVPSRITAVSAKKQRELAQAIKRARFLGLL 75

Query: 79 AYV 81
           YV
Sbjct: 76 PYV 78


>gi|170751790|ref|YP_001758050.1| 30S ribosomal protein S18 [Methylobacterium radiotolerans JCM
          2831]
 gi|205558300|sp|B1LYI3|RS18_METRJ RecName: Full=30S ribosomal protein S18
 gi|170658312|gb|ACB27367.1| ribosomal protein S18 [Methylobacterium radiotolerans JCM 2831]
          Length = 83

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 58/63 (92%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD++LL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LGL+
Sbjct: 19 KTCPFSGANAPKIDYKDVKLLSRYVSERGKIVPSRITAVSAKKQRELAQAIKRARFLGLL 78

Query: 79 AYV 81
           YV
Sbjct: 79 PYV 81


>gi|163853340|ref|YP_001641383.1| ribosomal protein S18 [Methylobacterium extorquens PA1]
 gi|188583606|ref|YP_001927051.1| 30S ribosomal protein S18 [Methylobacterium populi BJ001]
 gi|218532197|ref|YP_002423013.1| 30S ribosomal protein S18 [Methylobacterium chloromethanicum CM4]
 gi|240140756|ref|YP_002965236.1| 30S ribosomal protein S18 [Methylobacterium extorquens AM1]
 gi|254563266|ref|YP_003070361.1| 30S ribosomal protein S18 [Methylobacterium extorquens DM4]
 gi|205558286|sp|A9W8G3|RS18_METEP RecName: Full=30S ribosomal protein S18
 gi|205558291|sp|B1ZFQ7|RS18_METPB RecName: Full=30S ribosomal protein S18
 gi|254812946|sp|B7L2P1|RS18_METC4 RecName: Full=30S ribosomal protein S18
 gi|163664945|gb|ABY32312.1| ribosomal protein S18 [Methylobacterium extorquens PA1]
 gi|179347104|gb|ACB82516.1| ribosomal protein S18 [Methylobacterium populi BJ001]
 gi|218524500|gb|ACK85085.1| ribosomal protein S18 [Methylobacterium chloromethanicum CM4]
 gi|240010733|gb|ACS41959.1| 30S ribosomal protein S18 [Methylobacterium extorquens AM1]
 gi|254270544|emb|CAX26547.1| 30S ribosomal protein S18 [Methylobacterium extorquens DM4]
          Length = 84

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 59/63 (93%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          KSCP SG+ AP+IDYKD++LL+R++S+RGKIVPSRI++VS KKQRELA+AIKR+R+LGL+
Sbjct: 20 KSCPFSGENAPKIDYKDVKLLSRYVSERGKIVPSRITAVSAKKQRELAQAIKRSRFLGLL 79

Query: 79 AYV 81
           YV
Sbjct: 80 PYV 82


>gi|94497409|ref|ZP_01303979.1| 30S ribosomal protein S18 [Sphingomonas sp. SKA58]
 gi|94423040|gb|EAT08071.1| 30S ribosomal protein S18 [Sphingomonas sp. SKA58]
          Length = 74

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/72 (66%), Positives = 59/72 (81%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP + K AP+IDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELA AI
Sbjct: 1  MARPFFRRRKSCPFAAKDAPKIDYKDVRLLQGFVSERGKIVPSRITAVSAKKQRELASAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR+LGL+ Y+
Sbjct: 61 KRARHLGLLPYI 72


>gi|328544026|ref|YP_004304135.1| 30S ribosomal protein S18 [polymorphum gilvum SL003B-26A1]
 gi|326413770|gb|ADZ70833.1| 30S ribosomal protein S18 [Polymorphum gilvum SL003B-26A1]
          Length = 82

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/63 (74%), Positives = 56/63 (88%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG GAP IDYKDIRLL R++S+RGKIVPSRI++VS KKQRELA+AIKRAR LGL+
Sbjct: 18 KTCPFSGAGAPAIDYKDIRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARLLGLL 77

Query: 79 AYV 81
           +V
Sbjct: 78 PFV 80


>gi|154253799|ref|YP_001414623.1| 30S ribosomal protein S18 [Parvibaculum lavamentivorans DS-1]
 gi|205616358|sp|A7HYI3|RS18_PARL1 RecName: Full=30S ribosomal protein S18
 gi|154157749|gb|ABS64966.1| ribosomal protein S18 [Parvibaculum lavamentivorans DS-1]
          Length = 81

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 56/63 (88%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+L LI
Sbjct: 17 KTCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALI 76

Query: 79 AYV 81
           YV
Sbjct: 77 PYV 79


>gi|329850896|ref|ZP_08265741.1| ribosomal protein S18 [Asticcacaulis biprosthecum C19]
 gi|328841211|gb|EGF90782.1| ribosomal protein S18 [Asticcacaulis biprosthecum C19]
          Length = 92

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 54/86 (62%), Positives = 64/86 (74%), Gaps = 7/86 (8%)

Query: 3  EVAPTP-------LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRIS 55
          E APTP         RR    RRK CP SG  AP+IDYKD++LL R++S+RGKIVPSRI+
Sbjct: 5  ETAPTPGAPVGSGPARRPFFRRRKVCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRIT 64

Query: 56 SVSHKKQRELAKAIKRARYLGLIAYV 81
          +VS KKQRELAKAIKRAR+L L+ YV
Sbjct: 65 AVSQKKQRELAKAIKRARFLALLPYV 90


>gi|90423798|ref|YP_532168.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris BisB18]
 gi|122995501|sp|Q215T7|RS18_RHOPB RecName: Full=30S ribosomal protein S18
 gi|90105812|gb|ABD87849.1| SSU ribosomal protein S18P [Rhodopseudomonas palustris BisB18]
          Length = 79

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 7  RRPFFRRRKTCPFTGPNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          R+R+LGL+ YV
Sbjct: 67 RSRFLGLLPYV 77


>gi|99080885|ref|YP_613039.1| 30S ribosomal protein S18 [Ruegeria sp. TM1040]
 gi|126728811|ref|ZP_01744626.1| 30S ribosomal protein S18 [Sagittula stellata E-37]
 gi|254460821|ref|ZP_05074237.1| ribosomal protein S18 [Rhodobacterales bacterium HTCC2083]
 gi|259418563|ref|ZP_05742480.1| ribosomal protein S18 [Silicibacter sp. TrichCH4B]
 gi|123252446|sp|Q1GHT9|RS18_SILST RecName: Full=30S ribosomal protein S18
 gi|99037165|gb|ABF63777.1| SSU ribosomal protein S18P [Ruegeria sp. TM1040]
 gi|126710741|gb|EBA09792.1| 30S ribosomal protein S18 [Sagittula stellata E-37]
 gi|206677410|gb|EDZ41897.1| ribosomal protein S18 [Rhodobacteraceae bacterium HTCC2083]
 gi|259344785|gb|EEW56639.1| ribosomal protein S18 [Silicibacter sp. TrichCH4B]
          Length = 75

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 60/77 (77%), Gaps = 5/77 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK CP SG+ AP+IDYKD RLL R++S+RGKIVPSRI++VS KKQR
Sbjct: 1  MAAKPFFRR-----RKVCPFSGENAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQR 55

Query: 64 ELAKAIKRARYLGLIAY 80
          ELA+AIKRAR+L L+ Y
Sbjct: 56 ELARAIKRARFLALLPY 72


>gi|103487385|ref|YP_616946.1| 30S ribosomal protein S18 [Sphingopyxis alaskensis RB2256]
 gi|123253124|sp|Q1GRV9|RS18_SPHAL RecName: Full=30S ribosomal protein S18
 gi|98977462|gb|ABF53613.1| SSU ribosomal protein S18P [Sphingopyxis alaskensis RB2256]
          Length = 74

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 48/72 (66%), Positives = 59/72 (81%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK+CP S K AP IDYKD+RLL  +LS+RGKIVPSRI++VS KKQRELAKAI
Sbjct: 1  MARPFFRRRKTCPFSAKDAPVIDYKDVRLLQGYLSERGKIVPSRITAVSTKKQRELAKAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ Y+
Sbjct: 61 KRARHIGLLPYI 72


>gi|118588140|ref|ZP_01545550.1| 30S ribosomal protein S18 [Stappia aggregata IAM 12614]
 gi|118439762|gb|EAV46393.1| 30S ribosomal protein S18 [Stappia aggregata IAM 12614]
          Length = 82

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 56/63 (88%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKDIRLL R++S+RGKIVPSRI++VS KKQRELA+AIKRAR LGL+
Sbjct: 18 KTCPFSGTNAPKIDYKDIRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARLLGLL 77

Query: 79 AYV 81
           +V
Sbjct: 78 PFV 80


>gi|114762812|ref|ZP_01442244.1| 30S ribosomal protein S18 [Pelagibaca bermudensis HTCC2601]
 gi|114544422|gb|EAU47429.1| 30S ribosomal protein S18 [Roseovarius sp. HTCC2601]
          Length = 75

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/78 (62%), Positives = 60/78 (76%), Gaps = 5/78 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK CP SG  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQR
Sbjct: 1  MAAKPFFRR-----RKVCPFSGDNAPKIDYKDTKLLQRYISERGKIVPSRITAVSAKKQR 55

Query: 64 ELAKAIKRARYLGLIAYV 81
          ELA+AIKRAR+L L+ YV
Sbjct: 56 ELARAIKRARFLALLPYV 73


>gi|315499768|ref|YP_004088571.1| ribosomal protein s18 [Asticcacaulis excentricus CB 48]
 gi|315417780|gb|ADU14420.1| ribosomal protein S18 [Asticcacaulis excentricus CB 48]
          Length = 92

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELAKAIKRAR+L L+
Sbjct: 28 KVCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQKKQRELAKAIKRARFLALL 87

Query: 79 AYV 81
           YV
Sbjct: 88 PYV 90


>gi|294677546|ref|YP_003578161.1| 30S ribosomal protein S18 [Rhodobacter capsulatus SB 1003]
 gi|6226085|sp|O68127|RS18_RHOCA RecName: Full=30S ribosomal protein S18
 gi|3128365|gb|AAC16217.1| 30S ribosomal protein S18 [Rhodobacter capsulatus SB 1003]
 gi|294476366|gb|ADE85754.1| 30S ribosomal protein S18 [Rhodobacter capsulatus SB 1003]
          Length = 75

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 60/77 (77%), Gaps = 5/77 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK CP SG  AP+IDYKD+RLL R++S+RGKIVP+RI++VS KKQR
Sbjct: 1  MATKPFFRR-----RKVCPFSGDNAPKIDYKDVRLLQRYISERGKIVPARITAVSAKKQR 55

Query: 64 ELAKAIKRARYLGLIAY 80
          ELA+AIKRAR+L L+ Y
Sbjct: 56 ELAQAIKRARFLALLPY 72


>gi|209964875|ref|YP_002297790.1| ribosomal protein S18 [Rhodospirillum centenum SW]
 gi|209958341|gb|ACI98977.1| ribosomal protein S18 [Rhodospirillum centenum SW]
          Length = 89

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 56/63 (88%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP IDYKD++LL+RF+S+RGKIVPSRI++VS KKQRELA+AIKRAR+L L+
Sbjct: 25 KTCPFSGPNAPAIDYKDVKLLSRFISERGKIVPSRITAVSAKKQRELARAIKRARFLALL 84

Query: 79 AYV 81
           YV
Sbjct: 85 PYV 87


>gi|163731326|ref|ZP_02138773.1| 30S ribosomal protein S18 [Roseobacter litoralis Och 149]
 gi|161394780|gb|EDQ19102.1| 30S ribosomal protein S18 [Roseobacter litoralis Och 149]
          Length = 75

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 5/77 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK CP SG  AP+IDYKD RLL R++S+RGKIVPSRI++VS KKQR
Sbjct: 1  MATKPFFRR-----RKVCPFSGDNAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQR 55

Query: 64 ELAKAIKRARYLGLIAY 80
          ELA+AIKRAR+L L+ Y
Sbjct: 56 ELARAIKRARFLALLPY 72


>gi|85707088|ref|ZP_01038176.1| 30S ribosomal protein S18 [Roseovarius sp. 217]
 gi|149203937|ref|ZP_01880905.1| 30S ribosomal protein S18 [Roseovarius sp. TM1035]
 gi|85668374|gb|EAQ23247.1| 30S ribosomal protein S18 [Roseovarius sp. 217]
 gi|149142379|gb|EDM30424.1| 30S ribosomal protein S18 [Roseovarius sp. TM1035]
          Length = 75

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 5/77 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK CP SG  AP+IDYKD RLL R++S+RGKIVPSRI++VS KKQR
Sbjct: 1  MATKPFFRR-----RKVCPFSGDSAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQR 55

Query: 64 ELAKAIKRARYLGLIAY 80
          ELA+AIKRAR+L L+ Y
Sbjct: 56 ELARAIKRARFLALLPY 72


>gi|220924504|ref|YP_002499806.1| 30S ribosomal protein S18 [Methylobacterium nodulans ORS 2060]
 gi|254812947|sp|B8IED1|RS18_METNO RecName: Full=30S ribosomal protein S18
 gi|219949111|gb|ACL59503.1| ribosomal protein S18 [Methylobacterium nodulans ORS 2060]
          Length = 82

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/63 (69%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD++LL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LG +
Sbjct: 18 KTCPFSGPNAPKIDYKDVKLLSRYVSERGKIVPSRITAVSAKKQRELAQAIKRARFLGFL 77

Query: 79 AYV 81
           YV
Sbjct: 78 PYV 80


>gi|56552122|ref|YP_162961.1| 30S ribosomal protein S18 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241762068|ref|ZP_04760152.1| ribosomal protein S18 [Zymomonas mobilis subsp. mobilis ATCC
          10988]
 gi|260752353|ref|YP_003225246.1| 30S ribosomal protein S18 [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
 gi|81677185|sp|Q5NN60|RS18_ZYMMO RecName: Full=30S ribosomal protein S18
 gi|56543696|gb|AAV89850.1| ribosomal protein S18 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373534|gb|EER63121.1| ribosomal protein S18 [Zymomonas mobilis subsp. mobilis ATCC
          10988]
 gi|258551716|gb|ACV74662.1| ribosomal protein S18 [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
          Length = 74

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 60/72 (83%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP + K AP+IDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELA+AI
Sbjct: 1  MARPFFRRRKSCPFAAKDAPKIDYKDVRLLQGFVSERGKIVPSRITAVSAKKQRELARAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ ++
Sbjct: 61 KRARHIGLLPFI 72


>gi|86138735|ref|ZP_01057307.1| 30S ribosomal protein S18 [Roseobacter sp. MED193]
 gi|126739374|ref|ZP_01755067.1| 30S ribosomal protein S18 [Roseobacter sp. SK209-2-6]
 gi|159044730|ref|YP_001533524.1| 30S ribosomal protein S18 [Dinoroseobacter shibae DFL 12]
 gi|163736681|ref|ZP_02144100.1| 30S ribosomal protein S18 [Phaeobacter gallaeciensis BS107]
 gi|163742692|ref|ZP_02150077.1| 30S ribosomal protein S18 [Phaeobacter gallaeciensis 2.10]
 gi|254463996|ref|ZP_05077407.1| ribosomal protein S18 [Rhodobacterales bacterium Y4I]
 gi|254475704|ref|ZP_05089090.1| ribosomal protein S18 [Ruegeria sp. R11]
 gi|254511035|ref|ZP_05123102.1| ribosomal protein S18 [Rhodobacteraceae bacterium KLH11]
 gi|260433335|ref|ZP_05787306.1| ribosomal protein S18 [Silicibacter lacuscaerulensis ITI-1157]
 gi|189029676|sp|A8LQQ6|RS18_DINSH RecName: Full=30S ribosomal protein S18
 gi|85824382|gb|EAQ44585.1| 30S ribosomal protein S18 [Roseobacter sp. MED193]
 gi|126719474|gb|EBA16183.1| 30S ribosomal protein S18 [Roseobacter sp. SK209-2-6]
 gi|157912490|gb|ABV93923.1| 30S ribosomal protein S18 [Dinoroseobacter shibae DFL 12]
 gi|161383947|gb|EDQ08331.1| 30S ribosomal protein S18 [Phaeobacter gallaeciensis 2.10]
 gi|161390551|gb|EDQ14901.1| 30S ribosomal protein S18 [Phaeobacter gallaeciensis BS107]
 gi|206684904|gb|EDZ45386.1| ribosomal protein S18 [Rhodobacterales bacterium Y4I]
 gi|214029947|gb|EEB70782.1| ribosomal protein S18 [Ruegeria sp. R11]
 gi|221534746|gb|EEE37734.1| ribosomal protein S18 [Rhodobacteraceae bacterium KLH11]
 gi|260417163|gb|EEX10422.1| ribosomal protein S18 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 75

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 5/77 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK CP SG  AP+IDYKD RLL R++S+RGKIVPSRI++VS KKQR
Sbjct: 1  MAAKPFFRR-----RKVCPFSGDNAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQR 55

Query: 64 ELAKAIKRARYLGLIAY 80
          ELA+AIKRAR+L L+ Y
Sbjct: 56 ELARAIKRARFLALLPY 72


>gi|197105008|ref|YP_002130385.1| RpsR, ribosomal protein S18 [Phenylobacterium zucineum HLK1]
 gi|196478428|gb|ACG77956.1| RpsR, ribosomal protein S18 [Phenylobacterium zucineum HLK1]
          Length = 96

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 55/63 (87%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELAKAIKRAR+L L+
Sbjct: 32 KVCPFSGANAPKIDYKDVKLLQRYVSERGKIVPSRITAVSAKKQRELAKAIKRARFLALL 91

Query: 79 AYV 81
           YV
Sbjct: 92 PYV 94


>gi|110680236|ref|YP_683243.1| 30S ribosomal protein S18 [Roseobacter denitrificans OCh 114]
 gi|123065436|sp|Q164N6|RS18_ROSDO RecName: Full=30S ribosomal protein S18
 gi|109456352|gb|ABG32557.1| ribosomal protein S18 [Roseobacter denitrificans OCh 114]
          Length = 75

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 5/77 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK CP SG  AP+IDYKD RLL R++S+RGKIVPSRI++VS KKQR
Sbjct: 1  MASKPFFRR-----RKVCPFSGDNAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQR 55

Query: 64 ELAKAIKRARYLGLIAY 80
          ELA+AIKRAR+L L+ Y
Sbjct: 56 ELARAIKRARFLALLPY 72


>gi|170740809|ref|YP_001769464.1| 30S ribosomal protein S18 [Methylobacterium sp. 4-46]
 gi|205558315|sp|B0UL30|RS18_METS4 RecName: Full=30S ribosomal protein S18
 gi|168195083|gb|ACA17030.1| ribosomal protein S18 [Methylobacterium sp. 4-46]
          Length = 83

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/63 (69%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD++LL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LG +
Sbjct: 19 KTCPFSGPNAPKIDYKDVKLLSRYVSERGKIVPSRITAVSAKKQRELAQAIKRARFLGFL 78

Query: 79 AYV 81
           YV
Sbjct: 79 PYV 81


>gi|83949661|ref|ZP_00958394.1| 30S ribosomal protein S18 [Roseovarius nubinhibens ISM]
 gi|84503441|ref|ZP_01001501.1| 30S ribosomal protein S18 [Oceanicola batsensis HTCC2597]
 gi|83837560|gb|EAP76856.1| 30S ribosomal protein S18 [Roseovarius nubinhibens ISM]
 gi|84388228|gb|EAQ01180.1| 30S ribosomal protein S18 [Oceanicola batsensis HTCC2597]
          Length = 75

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 60/77 (77%), Gaps = 5/77 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK CP SG+ AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQR
Sbjct: 1  MAAKPFFRR-----RKVCPFSGENAPKIDYKDTKLLQRYISERGKIVPSRITAVSAKKQR 55

Query: 64 ELAKAIKRARYLGLIAY 80
          ELA+AIKRAR+L L+ Y
Sbjct: 56 ELARAIKRARFLALLPY 72


>gi|304319743|ref|YP_003853386.1| 30S ribosomal protein S18 [Parvularcula bermudensis HTCC2503]
 gi|303298646|gb|ADM08245.1| 30S ribosomal protein S18 [Parvularcula bermudensis HTCC2503]
          Length = 74

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/73 (61%), Positives = 59/73 (80%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + +    RRK+CP SG+ AP+IDYKD +LL R++S++GKIVPSRIS+VS KKQRELA+AI
Sbjct: 1  MAKTFFRRRKTCPFSGEKAPKIDYKDPKLLGRYISEKGKIVPSRISAVSAKKQRELARAI 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y  
Sbjct: 61 KRARFLALLPYTT 73


>gi|260425912|ref|ZP_05779891.1| ribosomal protein S18 [Citreicella sp. SE45]
 gi|260420404|gb|EEX13655.1| ribosomal protein S18 [Citreicella sp. SE45]
          Length = 75

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/78 (62%), Positives = 59/78 (75%), Gaps = 5/78 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK CP SG  AP IDYKD +LL R++S+RGKIVPSRI++VS KKQR
Sbjct: 1  MAAKPFFRR-----RKVCPFSGDNAPAIDYKDTKLLQRYISERGKIVPSRITAVSAKKQR 55

Query: 64 ELAKAIKRARYLGLIAYV 81
          ELA+AIKRAR+L L+ YV
Sbjct: 56 ELARAIKRARFLALLPYV 73


>gi|329890142|ref|ZP_08268485.1| ribosomal protein S18 [Brevundimonas diminuta ATCC 11568]
 gi|328845443|gb|EGF95007.1| ribosomal protein S18 [Brevundimonas diminuta ATCC 11568]
          Length = 64

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/61 (73%), Positives = 54/61 (88%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELAKAIKRARYL L+ Y
Sbjct: 2  CPFSGANAPKIDYKDVKLLQRYVSERGKIVPSRITAVSAKKQRELAKAIKRARYLALLPY 61

Query: 81 V 81
          V
Sbjct: 62 V 62


>gi|254504113|ref|ZP_05116264.1| ribosomal protein S18 [Labrenzia alexandrii DFL-11]
 gi|222440184|gb|EEE46863.1| ribosomal protein S18 [Labrenzia alexandrii DFL-11]
          Length = 82

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 56/63 (88%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKDIRLL R++S+RGKIVPSRI++VS KKQREL++AIKRAR LGL+
Sbjct: 18 KTCPFSGSNAPKIDYKDIRLLQRYISERGKIVPSRITAVSAKKQRELSRAIKRARLLGLL 77

Query: 79 AYV 81
           +V
Sbjct: 78 PFV 80


>gi|114768974|ref|ZP_01446600.1| 30S ribosomal protein S18 [alpha proteobacterium HTCC2255]
 gi|114549891|gb|EAU52772.1| 30S ribosomal protein S18 [alpha proteobacterium HTCC2255]
          Length = 75

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/64 (71%), Positives = 55/64 (85%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRKSCP  G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELAKAIKRAR+L 
Sbjct: 9  RRKSCPFLGDNAPKIDYKDTKLLQRYVSERGKIVPSRITAVSAKKQRELAKAIKRARFLA 68

Query: 77 LIAY 80
          L+ Y
Sbjct: 69 LLPY 72


>gi|56697143|ref|YP_167506.1| 30S ribosomal protein S18 [Ruegeria pomeroyi DSS-3]
 gi|84684848|ref|ZP_01012748.1| 30S ribosomal protein S18 [Maritimibacter alkaliphilus HTCC2654]
 gi|81676223|sp|Q5LR49|RS18_SILPO RecName: Full=30S ribosomal protein S18
 gi|56678880|gb|AAV95546.1| ribosomal protein S18 [Ruegeria pomeroyi DSS-3]
 gi|84667183|gb|EAQ13653.1| 30S ribosomal protein S18 [Rhodobacterales bacterium HTCC2654]
          Length = 75

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 59/77 (76%), Gaps = 5/77 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK CP SG  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQR
Sbjct: 1  MAAKPFFRR-----RKVCPFSGDNAPKIDYKDTKLLQRYISERGKIVPSRITAVSAKKQR 55

Query: 64 ELAKAIKRARYLGLIAY 80
          ELA+AIKRAR+L L+ Y
Sbjct: 56 ELARAIKRARFLALLPY 72


>gi|83943160|ref|ZP_00955620.1| 30S ribosomal protein S18 [Sulfitobacter sp. EE-36]
 gi|83954295|ref|ZP_00963015.1| 30S ribosomal protein S18 [Sulfitobacter sp. NAS-14.1]
 gi|163746685|ref|ZP_02154042.1| 30S ribosomal protein S18 [Oceanibulbus indolifex HEL-45]
 gi|254486472|ref|ZP_05099677.1| ribosomal protein S18 [Roseobacter sp. GAI101]
 gi|83841332|gb|EAP80502.1| 30S ribosomal protein S18 [Sulfitobacter sp. NAS-14.1]
 gi|83846168|gb|EAP84045.1| 30S ribosomal protein S18 [Sulfitobacter sp. EE-36]
 gi|161379799|gb|EDQ04211.1| 30S ribosomal protein S18 [Oceanibulbus indolifex HEL-45]
 gi|214043341|gb|EEB83979.1| ribosomal protein S18 [Roseobacter sp. GAI101]
          Length = 75

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 58/77 (75%), Gaps = 5/77 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK CP SG  AP IDYKD RLL R++S+RGKIVPSRI++VS KKQR
Sbjct: 1  MAAKPFFRR-----RKVCPFSGDNAPAIDYKDTRLLQRYISERGKIVPSRITAVSAKKQR 55

Query: 64 ELAKAIKRARYLGLIAY 80
          ELA+AIKRAR+L L+ Y
Sbjct: 56 ELARAIKRARFLALLPY 72


>gi|209885493|ref|YP_002289350.1| ribosomal protein S18 [Oligotropha carboxidovorans OM5]
 gi|229560048|sp|B6JGW4|RS18_OLICO RecName: Full=30S ribosomal protein S18
 gi|209873689|gb|ACI93485.1| ribosomal protein S18 [Oligotropha carboxidovorans OM5]
          Length = 79

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/71 (64%), Positives = 59/71 (83%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+ID+KD +LL R++S+RGKIVPSRI++VS  KQRELA+AIK
Sbjct: 7  RRPFFRRRKTCPFTGSNAPKIDFKDSKLLMRYVSERGKIVPSRITAVSALKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|299133697|ref|ZP_07026891.1| ribosomal protein S18 [Afipia sp. 1NLS2]
 gi|298591533|gb|EFI51734.1| ribosomal protein S18 [Afipia sp. 1NLS2]
          Length = 79

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/71 (64%), Positives = 59/71 (83%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+ID+KD +LL R++S+RGKIVPSRI++VS  KQRELA+AIK
Sbjct: 7  RRPFFRRRKTCPFTGPNAPKIDFKDSKLLMRYVSERGKIVPSRITAVSALKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|119383641|ref|YP_914697.1| 30S ribosomal protein S18 [Paracoccus denitrificans PD1222]
 gi|166220967|sp|A1B0F7|RS18_PARDP RecName: Full=30S ribosomal protein S18
 gi|119373408|gb|ABL69001.1| SSU ribosomal protein S18P [Paracoccus denitrificans PD1222]
          Length = 75

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/64 (71%), Positives = 54/64 (84%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CP SG  AP IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+L 
Sbjct: 9  RRKVCPFSGDNAPAIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLA 68

Query: 77 LIAY 80
          L+ Y
Sbjct: 69 LLPY 72


>gi|146340285|ref|YP_001205333.1| 30S ribosomal protein S18 [Bradyrhizobium sp. ORS278]
 gi|148255212|ref|YP_001239797.1| 30S ribosomal protein S18 [Bradyrhizobium sp. BTAi1]
 gi|166220926|sp|A5EI97|RS18_BRASB RecName: Full=30S ribosomal protein S18
 gi|166220927|sp|A4YT76|RS18_BRASO RecName: Full=30S ribosomal protein S18
 gi|146193091|emb|CAL77102.1| 30S ribosomal subunit protein S18 [Bradyrhizobium sp. ORS278]
 gi|146407385|gb|ABQ35891.1| SSU ribosomal protein S18P [Bradyrhizobium sp. BTAi1]
          Length = 79

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 56/63 (88%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LGL+
Sbjct: 15 KTCPFSGPNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIKRARFLGLL 74

Query: 79 AYV 81
           YV
Sbjct: 75 PYV 77


>gi|77463711|ref|YP_353215.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides 2.4.1]
 gi|126462540|ref|YP_001043654.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides ATCC 17029]
 gi|146277394|ref|YP_001167553.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides ATCC 17025]
 gi|332558562|ref|ZP_08412884.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides WS8N]
 gi|123591680|sp|Q3J1M0|RS18_RHOS4 RecName: Full=30S ribosomal protein S18
 gi|166220980|sp|A3PKL6|RS18_RHOS1 RecName: Full=30S ribosomal protein S18
 gi|166220981|sp|A4WS84|RS18_RHOS5 RecName: Full=30S ribosomal protein S18
 gi|77388129|gb|ABA79314.1| SSU ribosomal protein S18P [Rhodobacter sphaeroides 2.4.1]
 gi|126104204|gb|ABN76882.1| SSU ribosomal protein S18P [Rhodobacter sphaeroides ATCC 17029]
 gi|145555635|gb|ABP70248.1| SSU ribosomal protein S18P [Rhodobacter sphaeroides ATCC 17025]
 gi|332276274|gb|EGJ21589.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides WS8N]
          Length = 75

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 46/64 (71%), Positives = 53/64 (82%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CP SG  AP IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA AIKRAR+L 
Sbjct: 9  RRKVCPFSGDNAPAIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELAAAIKRARFLA 68

Query: 77 LIAY 80
          L+ Y
Sbjct: 69 LLPY 72


>gi|221639577|ref|YP_002525839.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides KD131]
 gi|254812952|sp|B9KJP1|RS18_RHOSK RecName: Full=30S ribosomal protein S18
 gi|221160358|gb|ACM01338.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides KD131]
          Length = 75

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/64 (71%), Positives = 53/64 (82%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CP SG  AP IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA AIKRAR+L 
Sbjct: 9  RRKVCPFSGDNAPVIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELAAAIKRARFLA 68

Query: 77 LIAY 80
          L+ Y
Sbjct: 69 LLPY 72


>gi|260575000|ref|ZP_05843001.1| ribosomal protein S18 [Rhodobacter sp. SW2]
 gi|259022622|gb|EEW25917.1| ribosomal protein S18 [Rhodobacter sp. SW2]
          Length = 75

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 56/77 (72%), Gaps = 5/77 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK CP SG  AP IDYKD R L R++S+RGKIVPSRI++VS KKQR
Sbjct: 1  MATKPFFRR-----RKVCPFSGDNAPAIDYKDTRTLQRYISERGKIVPSRITAVSAKKQR 55

Query: 64 ELAKAIKRARYLGLIAY 80
          ELA AIKRAR+L L+ Y
Sbjct: 56 ELATAIKRARFLALLPY 72


>gi|126725407|ref|ZP_01741249.1| 30S ribosomal protein S18 [Rhodobacterales bacterium HTCC2150]
 gi|126704611|gb|EBA03702.1| 30S ribosomal protein S18 [Rhodobacterales bacterium HTCC2150]
          Length = 75

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (82%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CP SG  AP IDYKD R L R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+L 
Sbjct: 9  RRKVCPFSGDNAPAIDYKDTRTLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLA 68

Query: 77 LIAY 80
          L+ Y
Sbjct: 69 LLPY 72


>gi|149913883|ref|ZP_01902415.1| 30S ribosomal protein S18 [Roseobacter sp. AzwK-3b]
 gi|149812167|gb|EDM71998.1| 30S ribosomal protein S18 [Roseobacter sp. AzwK-3b]
          Length = 75

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 5/77 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK CP SG  AP IDYKD +LL R++S+RGKIVPSRI++VS KKQR
Sbjct: 1  MAAKPFFRR-----RKVCPFSGDNAPAIDYKDTKLLQRYISERGKIVPSRITAVSAKKQR 55

Query: 64 ELAKAIKRARYLGLIAY 80
          EL++AIKRAR+L L+ Y
Sbjct: 56 ELSRAIKRARFLALLPY 72


>gi|114569762|ref|YP_756442.1| 30S ribosomal protein S18P [Maricaulis maris MCS10]
 gi|122316234|sp|Q0AQD3|RS18_MARMM RecName: Full=30S ribosomal protein S18
 gi|114340224|gb|ABI65504.1| SSU ribosomal protein S18P [Maricaulis maris MCS10]
          Length = 84

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK CP SG+ AP ID+KD +LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 12 RRPFMRRRKVCPFSGENAPAIDFKDPKLLLRYMSERGKIVPSRITAVSAKKQRELARAIK 71

Query: 71 RARYLGLIAYV 81
          RAR L L+ YV
Sbjct: 72 RARQLALLPYV 82


>gi|307946729|ref|ZP_07662064.1| ribosomal protein S18 [Roseibium sp. TrichSKD4]
 gi|307770393|gb|EFO29619.1| ribosomal protein S18 [Roseibium sp. TrichSKD4]
          Length = 82

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 53/61 (86%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          CP SG  +P+IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA+AIKRAR LGL+ +
Sbjct: 20 CPFSGANSPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARLLGLLPF 79

Query: 81 V 81
          V
Sbjct: 80 V 80


>gi|254294300|ref|YP_003060323.1| ribosomal protein S18 [Hirschia baltica ATCC 49814]
 gi|254042831|gb|ACT59626.1| ribosomal protein S18 [Hirschia baltica ATCC 49814]
          Length = 86

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 56/70 (80%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK CP SG  AP +DYKD++LL R++S++GKIVP+RI++VS KKQR L++AIK
Sbjct: 14 RRPFGRRRKVCPFSGDAAPALDYKDVKLLQRYISEKGKIVPARITAVSQKKQRRLSQAIK 73

Query: 71 RARYLGLIAY 80
          RAR+L L+ Y
Sbjct: 74 RARHLALLPY 83


>gi|89054112|ref|YP_509563.1| 30S ribosomal protein S18 [Jannaschia sp. CCS1]
 gi|123286752|sp|Q28RX4|RS18_JANSC RecName: Full=30S ribosomal protein S18
 gi|88863661|gb|ABD54538.1| SSU ribosomal protein S18P [Jannaschia sp. CCS1]
          Length = 75

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/78 (57%), Positives = 56/78 (71%), Gaps = 5/78 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK+ P  G+ AP+IDYKD RLL R++S+RGKIVPSRI++V  K QR
Sbjct: 1  MAAKPFFRR-----RKTDPFEGENAPKIDYKDTRLLQRYISERGKIVPSRITAVGAKNQR 55

Query: 64 ELAKAIKRARYLGLIAYV 81
           LAKAIKRAR+L L+ Y 
Sbjct: 56 ALAKAIKRARFLALLPYA 73


>gi|255263624|ref|ZP_05342966.1| ribosomal protein S18 [Thalassiobium sp. R2A62]
 gi|255105959|gb|EET48633.1| ribosomal protein S18 [Thalassiobium sp. R2A62]
          Length = 75

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 45/78 (57%), Positives = 56/78 (71%), Gaps = 5/78 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RKS P  G+ AP+IDYKD RLL R++S+RGKIVPSRI++V  K QR
Sbjct: 1  MATKPFFRR-----RKSDPFEGENAPKIDYKDTRLLQRYISERGKIVPSRITAVGAKNQR 55

Query: 64 ELAKAIKRARYLGLIAYV 81
           LA+AIKRAR+L L+ Y 
Sbjct: 56 ALARAIKRARFLALLPYA 73


>gi|89068231|ref|ZP_01155641.1| 30S ribosomal protein S18 [Oceanicola granulosus HTCC2516]
 gi|89046148|gb|EAR52206.1| 30S ribosomal protein S18 [Oceanicola granulosus HTCC2516]
          Length = 75

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (71%), Gaps = 5/78 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RK+ P  G+ AP+IDYKD R L R++S+RGKIVPSRI++V  K QR
Sbjct: 1  MAAKPFFRR-----RKTDPFEGENAPKIDYKDTRTLQRYVSERGKIVPSRITAVGSKNQR 55

Query: 64 ELAKAIKRARYLGLIAYV 81
          +LA+AIKRAR+L L+ Y 
Sbjct: 56 QLAQAIKRARFLALLPYA 73


>gi|71083407|ref|YP_266126.1| 30S ribosomal protein S18 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|91762170|ref|ZP_01264135.1| ribosomal protein S18 [Candidatus Pelagibacter ubique HTCC1002]
 gi|123748053|sp|Q4FMR6|RS18_PELUB RecName: Full=30S ribosomal protein S18
 gi|71062520|gb|AAZ21523.1| ribosomal protein S18 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717972|gb|EAS84622.1| ribosomal protein S18 [Candidatus Pelagibacter ubique HTCC1002]
          Length = 92

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/77 (54%), Positives = 58/77 (75%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          +  A   + + N    +K+CPLS KGAP +DYK+IRLL +++S+ GKI+PSRI++VS KK
Sbjct: 16 SNFAKLSIFQPNKYKFKKTCPLSAKGAPEVDYKNIRLLKKYMSENGKILPSRITNVSQKK 75

Query: 62 QRELAKAIKRARYLGLI 78
          QREL+ +IKRAR L LI
Sbjct: 76 QRELSLSIKRARNLALI 92


>gi|126735966|ref|ZP_01751710.1| ribosomal protein S18 [Roseobacter sp. CCS2]
 gi|126714523|gb|EBA11390.1| ribosomal protein S18 [Roseobacter sp. CCS2]
          Length = 75

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (70%), Gaps = 5/78 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RKS P  G  AP+IDYKD RLL R++S+RGKIVP+RI++V  K QR
Sbjct: 1  MATKPFFRR-----RKSDPFEGDNAPKIDYKDTRLLQRYISERGKIVPARITAVGAKNQR 55

Query: 64 ELAKAIKRARYLGLIAYV 81
           LA+AIKRAR+L L+ Y 
Sbjct: 56 ALARAIKRARFLALLPYA 73


>gi|254438780|ref|ZP_05052274.1| ribosomal protein S18 [Octadecabacter antarcticus 307]
 gi|198254226|gb|EDY78540.1| ribosomal protein S18 [Octadecabacter antarcticus 307]
          Length = 75

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 5/78 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RKS P  G  AP+IDYKD R L R++S+RGKIVPSRI++V  K QR
Sbjct: 1  MATKPFFRR-----RKSDPFDGDNAPKIDYKDTRTLQRYVSERGKIVPSRITAVGAKNQR 55

Query: 64 ELAKAIKRARYLGLIAYV 81
           LA+AIKRAR+L L+ Y 
Sbjct: 56 ALARAIKRARFLALLPYA 73


>gi|254454485|ref|ZP_05067922.1| ribosomal protein S18 [Octadecabacter antarcticus 238]
 gi|198268891|gb|EDY93161.1| ribosomal protein S18 [Octadecabacter antarcticus 238]
          Length = 75

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 5/78 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RKS P  G  AP+IDYKD R L R++S+RGKIVPSRI++V  K QR
Sbjct: 1  MATKPFFRR-----RKSDPFEGDNAPKIDYKDTRTLQRYVSERGKIVPSRITAVGAKNQR 55

Query: 64 ELAKAIKRARYLGLIAYV 81
           LA+AIKRAR+L L+ Y 
Sbjct: 56 ALARAIKRARFLALLPYA 73


>gi|84517318|ref|ZP_01004672.1| 30S ribosomal protein S18 [Loktanella vestfoldensis SKA53]
 gi|84508798|gb|EAQ05261.1| 30S ribosomal protein S18 [Loktanella vestfoldensis SKA53]
          Length = 75

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 5/78 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  RR     RKS P  G  AP+IDYKD R L R++S+RGKIVP+RI++V  K QR
Sbjct: 1  MATKPFFRR-----RKSDPFEGTDAPKIDYKDTRTLQRYISERGKIVPARITAVGSKNQR 55

Query: 64 ELAKAIKRARYLGLIAYV 81
           LA+AIKRAR+L L+ Y 
Sbjct: 56 ALARAIKRARFLALLPYA 73


>gi|254456332|ref|ZP_05069761.1| ribosomal protein S18 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083334|gb|EDZ60760.1| ribosomal protein S18 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 90

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 58/77 (75%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          +  A   + + N    +K+CPLS KGAP +DYK+IRLL +++S+ GKI+PSRI++VS KK
Sbjct: 14 SNFAKLSIFQPNKYKFKKNCPLSAKGAPAVDYKNIRLLKKYMSENGKILPSRITNVSQKK 73

Query: 62 QRELAKAIKRARYLGLI 78
          QREL+ +IKRAR L L+
Sbjct: 74 QRELSLSIKRARNLALL 90


>gi|330813905|ref|YP_004358144.1| ribosomal protein S6 [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487000|gb|AEA81405.1| ribosomal protein S6 [Candidatus Pelagibacter sp. IMCC9063]
          Length = 93

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/73 (54%), Positives = 55/73 (75%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          L  ++ +   KSCPLSGKGAP I+YK+I+LL +++S   KI+PSRI++VS  KQR L+K 
Sbjct: 19 LFNKSTAKPNKSCPLSGKGAPEINYKNIKLLKKYVSDTAKILPSRITNVSFGKQRALSKE 78

Query: 69 IKRARYLGLIAYV 81
          IK+AR L L+ YV
Sbjct: 79 IKKARVLALMPYV 91


>gi|323142969|ref|ZP_08077677.1| ribosomal protein S18 [Succinatimonas hippei YIT 12066]
 gi|322417242|gb|EFY07868.1| ribosomal protein S18 [Succinatimonas hippei YIT 12066]
          Length = 76

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 49/68 (72%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          HRRK C  + +G   IDYKD+ LL  ++++ GKIVPSRI+  S K QR+LA AIKRARYL
Sbjct: 6  HRRKFCRFTAEGVTEIDYKDVALLKNYVTESGKIVPSRITGTSAKYQRQLATAIKRARYL 65

Query: 76 GLIAYVNL 83
           L+ Y +L
Sbjct: 66 ALLPYTDL 73


>gi|114797845|ref|YP_760859.1| 30S ribosomal protein S18 [Hyphomonas neptunium ATCC 15444]
 gi|123323135|sp|Q0C084|RS18_HYPNA RecName: Full=30S ribosomal protein S18
 gi|114738019|gb|ABI76144.1| ribosomal protein S18 [Hyphomonas neptunium ATCC 15444]
          Length = 85

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/70 (55%), Positives = 54/70 (77%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK  P +G+ A  IDYKD+++L R++S++GKIVPSRI++V+ K QR+LA+AIK
Sbjct: 13 RRPFGRRRKVDPFTGQHAQEIDYKDVKMLQRYISEKGKIVPSRITAVNLKNQRKLAQAIK 72

Query: 71 RARYLGLIAY 80
          RAR L LI +
Sbjct: 73 RARMLALIPF 82


>gi|308048250|ref|YP_003911816.1| 30S ribosomal protein S18P [Ferrimonas balearica DSM 9799]
 gi|307630440|gb|ADN74742.1| SSU ribosomal protein S18P [Ferrimonas balearica DSM 9799]
          Length = 75

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVTEIDYKDIATLKNYVTESGKIVPSRITGTSAKYQRQLARAIKRARYLA 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|119776194|ref|YP_928934.1| 30S ribosomal protein S18 [Shewanella amazonensis SB2B]
 gi|166222237|sp|A1SA58|RS18_SHEAM RecName: Full=30S ribosomal protein S18
 gi|119768694|gb|ABM01265.1| SSU ribosomal protein S18P [Shewanella amazonensis SB2B]
          Length = 75

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVAEIDYKDIATLKNYITESGKIVPSRITGTSAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|148653438|ref|YP_001280531.1| 30S ribosomal protein S18 [Psychrobacter sp. PRwf-1]
 gi|172048535|sp|A5WFZ0|RS18_PSYWF RecName: Full=30S ribosomal protein S18
 gi|148572522|gb|ABQ94581.1| SSU ribosomal protein S18P [Psychrobacter sp. PRwf-1]
 gi|332971480|gb|EGK10431.1| 50S ribosomal protein L21 [Psychrobacter sp. 1501(2011)]
          Length = 75

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 48/66 (72%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+ LL +++S  GKIVPSRI+  S+K QR+LA AIK+ARYL 
Sbjct: 7  RRKFCRFTAEGITHIDYKDVELLKQYISDNGKIVPSRITGTSNKYQRQLATAIKQARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|24375416|ref|NP_719459.1| 30S ribosomal protein S18 [Shewanella oneidensis MR-1]
 gi|113971590|ref|YP_735383.1| 30S ribosomal protein S18 [Shewanella sp. MR-4]
 gi|114046198|ref|YP_736748.1| 30S ribosomal protein S18 [Shewanella sp. MR-7]
 gi|117919155|ref|YP_868347.1| 30S ribosomal protein S18 [Shewanella sp. ANA-3]
 gi|120600212|ref|YP_964786.1| 30S ribosomal protein S18 [Shewanella sp. W3-18-1]
 gi|126175836|ref|YP_001051985.1| 30S ribosomal protein S18 [Shewanella baltica OS155]
 gi|146291860|ref|YP_001182284.1| 30S ribosomal protein S18 [Shewanella putrefaciens CN-32]
 gi|152999252|ref|YP_001364933.1| 30S ribosomal protein S18 [Shewanella baltica OS185]
 gi|160873865|ref|YP_001553181.1| 30S ribosomal protein S18 [Shewanella baltica OS195]
 gi|217971925|ref|YP_002356676.1| 30S ribosomal protein S18 [Shewanella baltica OS223]
 gi|304411184|ref|ZP_07392799.1| ribosomal protein S18 [Shewanella baltica OS183]
 gi|307306479|ref|ZP_07586222.1| ribosomal protein S18 [Shewanella baltica BA175]
 gi|59798905|sp|Q8EAH4|RS18_SHEON RecName: Full=30S ribosomal protein S18
 gi|122943538|sp|Q0HF41|RS18_SHESM RecName: Full=30S ribosomal protein S18
 gi|123030904|sp|Q0HYW4|RS18_SHESR RecName: Full=30S ribosomal protein S18
 gi|166222238|sp|A3D8Q3|RS18_SHEB5 RecName: Full=30S ribosomal protein S18
 gi|166222239|sp|A6WJ81|RS18_SHEB8 RecName: Full=30S ribosomal protein S18
 gi|166222241|sp|A4Y3F2|RS18_SHEPC RecName: Full=30S ribosomal protein S18
 gi|166222242|sp|A0KT22|RS18_SHESA RecName: Full=30S ribosomal protein S18
 gi|166222243|sp|A1RNI7|RS18_SHESW RecName: Full=30S ribosomal protein S18
 gi|189029687|sp|A9L122|RS18_SHEB9 RecName: Full=30S ribosomal protein S18
 gi|254812954|sp|B8E9N8|RS18_SHEB2 RecName: Full=30S ribosomal protein S18
 gi|24350257|gb|AAN56903.1|AE015825_2 ribosomal protein S18 [Shewanella oneidensis MR-1]
 gi|113886274|gb|ABI40326.1| SSU ribosomal protein S18P [Shewanella sp. MR-4]
 gi|113887640|gb|ABI41691.1| SSU ribosomal protein S18P [Shewanella sp. MR-7]
 gi|117611487|gb|ABK46941.1| SSU ribosomal protein S18P [Shewanella sp. ANA-3]
 gi|120560305|gb|ABM26232.1| SSU ribosomal protein S18P [Shewanella sp. W3-18-1]
 gi|125999041|gb|ABN63116.1| SSU ribosomal protein S18P [Shewanella baltica OS155]
 gi|145563550|gb|ABP74485.1| SSU ribosomal protein S18P [Shewanella putrefaciens CN-32]
 gi|151363870|gb|ABS06870.1| ribosomal protein S18 [Shewanella baltica OS185]
 gi|160859387|gb|ABX47921.1| ribosomal protein S18 [Shewanella baltica OS195]
 gi|217497060|gb|ACK45253.1| ribosomal protein S18 [Shewanella baltica OS223]
 gi|304350377|gb|EFM14780.1| ribosomal protein S18 [Shewanella baltica OS183]
 gi|306910770|gb|EFN41198.1| ribosomal protein S18 [Shewanella baltica BA175]
 gi|315266092|gb|ADT92945.1| ribosomal protein S18 [Shewanella baltica OS678]
 gi|319425094|gb|ADV53168.1| ribosomal protein S18 [Shewanella putrefaciens 200]
          Length = 75

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVAEIDYKDIVTLKNYITESGKIVPSRITGTSAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|257453409|ref|ZP_05618704.1| ribosomal protein S18 [Enhydrobacter aerosaccus SK60]
 gi|257449161|gb|EEV24109.1| ribosomal protein S18 [Enhydrobacter aerosaccus SK60]
          Length = 75

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 49/66 (74%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI +L +++++ GKIVPSRI+  S+K QR+LA AIK+ARYL 
Sbjct: 7  RRKFCRFTAEGITHIDYKDIEILKQYVTESGKIVPSRITGTSNKYQRQLAVAIKQARYLA 66

Query: 77 LIAYVN 82
          LI Y +
Sbjct: 67 LIPYTD 72


>gi|91791881|ref|YP_561532.1| 30S ribosomal protein S18 [Shewanella denitrificans OS217]
 gi|123166502|sp|Q12RW7|RS18_SHEDO RecName: Full=30S ribosomal protein S18
 gi|91713883|gb|ABE53809.1| SSU ribosomal protein S18P [Shewanella denitrificans OS217]
          Length = 75

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTSEGVAEIDYKDIVTLKNYITESGKIVPSRITGTSAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|90408976|ref|ZP_01217108.1| ribosomal protein S18 [Psychromonas sp. CNPT3]
 gi|90309924|gb|EAS38077.1| ribosomal protein S18 [Psychromonas sp. CNPT3]
          Length = 75

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 47/67 (70%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVSEIDYKDVTTLKNYITESGKIVPSRITGTCAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVNL 83
          LI Y +L
Sbjct: 67 LIPYTDL 73


>gi|71065895|ref|YP_264622.1| 30S ribosomal protein S18 [Psychrobacter arcticus 273-4]
 gi|93005859|ref|YP_580296.1| 30S ribosomal protein S18 [Psychrobacter cryohalolentis K5]
 gi|123264648|sp|Q1QBZ1|RS18_PSYCK RecName: Full=30S ribosomal protein S18
 gi|123748116|sp|Q4FS20|RS18_PSYA2 RecName: Full=30S ribosomal protein S18
 gi|71038880|gb|AAZ19188.1| SSU ribosomal protein S18P [Psychrobacter arcticus 273-4]
 gi|92393537|gb|ABE74812.1| SSU ribosomal protein S18P [Psychrobacter cryohalolentis K5]
          Length = 76

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 47/66 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+ LL +++S  GKIVPSRI+  S K QR+LA AIK+ARYL 
Sbjct: 7  RRKFCRFTAEGITHIDYKDVELLKQYISDNGKIVPSRITGTSTKYQRQLATAIKQARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|254448156|ref|ZP_05061619.1| ribosomal protein S18 [gamma proteobacterium HTCC5015]
 gi|198262282|gb|EDY86564.1| ribosomal protein S18 [gamma proteobacterium HTCC5015]
          Length = 74

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 49/66 (74%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G  +IDYKD  LL +++++ GKIVPSRI+  S K QR+LAKAIKRARY+ 
Sbjct: 7  RRKYCRFTAEGITQIDYKDTDLLKQYITETGKIVPSRITGTSAKYQRQLAKAIKRARYVA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYSD 72


>gi|127514210|ref|YP_001095407.1| ribosomal protein S18 [Shewanella loihica PV-4]
 gi|166222240|sp|A3QI50|RS18_SHELP RecName: Full=30S ribosomal protein S18
 gi|126639505|gb|ABO25148.1| SSU ribosomal protein S18P [Shewanella loihica PV-4]
          Length = 75

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 48/67 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  + K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVTEIDYKDIATLKNYITESGKIVPSRITGTNAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|90416567|ref|ZP_01224498.1| 30S ribosomal protein S18 [marine gamma proteobacterium HTCC2207]
 gi|90331766|gb|EAS46994.1| 30S ribosomal protein S18 [marine gamma proteobacterium HTCC2207]
          Length = 75

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 48/66 (72%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  S +GAP IDYKD+  L  ++S+ GKIVPSRI+    + QR+LA+AIKRARY+ 
Sbjct: 7  RRKFCRFSAEGAPEIDYKDLDTLKGYVSESGKIVPSRITGTKARYQRQLAEAIKRARYIA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|157373898|ref|YP_001472498.1| ribosomal protein S18 [Shewanella sediminis HAW-EB3]
 gi|157963398|ref|YP_001503432.1| 30S ribosomal protein S18 [Shewanella pealeana ATCC 700345]
 gi|163749305|ref|ZP_02156554.1| ribosomal protein S18 [Shewanella benthica KT99]
 gi|167625579|ref|YP_001675873.1| 30S ribosomal protein S18 [Shewanella halifaxensis HAW-EB4]
 gi|170728535|ref|YP_001762561.1| 30S ribosomal protein S18 [Shewanella woodyi ATCC 51908]
 gi|212633591|ref|YP_002310116.1| 30S ribosomal protein S18 [Shewanella piezotolerans WP3]
 gi|294139216|ref|YP_003555194.1| 30S ribosomal protein S18 [Shewanella violacea DSS12]
 gi|189029688|sp|B0TUU7|RS18_SHEHH RecName: Full=30S ribosomal protein S18
 gi|189029689|sp|A8H8L0|RS18_SHEPA RecName: Full=30S ribosomal protein S18
 gi|189029690|sp|A8FR97|RS18_SHESH RecName: Full=30S ribosomal protein S18
 gi|226735124|sp|B8CIQ3|RS18_SHEPW RecName: Full=30S ribosomal protein S18
 gi|229560073|sp|B1KHY8|RS18_SHEWM RecName: Full=30S ribosomal protein S18
 gi|157316272|gb|ABV35370.1| ribosomal protein S18 [Shewanella sediminis HAW-EB3]
 gi|157848398|gb|ABV88897.1| ribosomal protein S18 [Shewanella pealeana ATCC 700345]
 gi|161331024|gb|EDQ01950.1| ribosomal protein S18 [Shewanella benthica KT99]
 gi|167355601|gb|ABZ78214.1| ribosomal protein S18 [Shewanella halifaxensis HAW-EB4]
 gi|169813882|gb|ACA88466.1| ribosomal protein S18 [Shewanella woodyi ATCC 51908]
 gi|212555075|gb|ACJ27529.1| Ribosomal protein S18 [Shewanella piezotolerans WP3]
 gi|293325685|dbj|BAJ00416.1| ribosomal protein S18 [Shewanella violacea DSS12]
          Length = 75

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 48/67 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  + K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVTEIDYKDIVTLKNYITESGKIVPSRITGTNAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|296113491|ref|YP_003627429.1| 30S ribosomal protein S18 [Moraxella catarrhalis RH4]
 gi|295921185|gb|ADG61536.1| 30S ribosomal protein S18 [Moraxella catarrhalis RH4]
 gi|326559388|gb|EGE09813.1| 30S ribosomal protein S18 [Moraxella catarrhalis 46P47B1]
 gi|326559759|gb|EGE10169.1| 30S ribosomal protein S18 [Moraxella catarrhalis 7169]
 gi|326565023|gb|EGE15223.1| 30S ribosomal protein S18 [Moraxella catarrhalis 103P14B1]
 gi|326566025|gb|EGE16185.1| 30S ribosomal protein S18 [Moraxella catarrhalis 12P80B1]
 gi|326568519|gb|EGE18591.1| 30S ribosomal protein S18 [Moraxella catarrhalis BC1]
 gi|326572422|gb|EGE22414.1| 30S ribosomal protein S18 [Moraxella catarrhalis BC8]
 gi|326572532|gb|EGE22521.1| 30S ribosomal protein S18 [Moraxella catarrhalis CO72]
 gi|326574129|gb|EGE24077.1| 30S ribosomal protein S18 [Moraxella catarrhalis 101P30B1]
 gi|326575565|gb|EGE25489.1| 30S ribosomal protein S18 [Moraxella catarrhalis O35E]
          Length = 75

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+ LL +++S+ GKI PSRI+  S K QR+LA AIK+ARYL 
Sbjct: 7  RRKFCRFTAEGITHIDYKDVELLKQYISENGKITPSRITGTSTKYQRQLAVAIKQARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|114564510|ref|YP_752024.1| 30S ribosomal protein S18 [Shewanella frigidimarina NCIMB 400]
 gi|122298732|sp|Q07XS9|RS18_SHEFN RecName: Full=30S ribosomal protein S18
 gi|114335803|gb|ABI73185.1| SSU ribosomal protein S18P [Shewanella frigidimarina NCIMB 400]
          Length = 75

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 48/67 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  S + QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTSEGVVEIDYKDIVTLKNYITESGKIVPSRITGTSARYQRQLARAIKRARYLS 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|289209095|ref|YP_003461161.1| ribosomal protein S18 [Thioalkalivibrio sp. K90mix]
 gi|288944726|gb|ADC72425.1| ribosomal protein S18 [Thioalkalivibrio sp. K90mix]
          Length = 74

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+ LL  F+++ GKIVPSR++  S K QR+LA A+KRARYL 
Sbjct: 7  RRKYCKFTAEGIDYIDYKDLNLLKGFVTETGKIVPSRVTGTSAKYQRQLATAVKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYSD 72


>gi|288941715|ref|YP_003443955.1| 30S ribosomal protein S18 [Allochromatium vinosum DSM 180]
 gi|288897087|gb|ADC62923.1| ribosomal protein S18 [Allochromatium vinosum DSM 180]
          Length = 74

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (72%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  + +G   IDYKD+ LL  ++S+ GKIVPSRI+  S K QR+LA+AIKRARYL 
Sbjct: 7  RKRYCRFTAEGITEIDYKDLNLLKAYISESGKIVPSRITGTSAKYQRQLAQAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|254499290|ref|ZP_05111964.1| 30S ribosomal protein S18 [Legionella drancourtii LLAP12]
 gi|254351487|gb|EET10348.1| 30S ribosomal protein S18 [Legionella drancourtii LLAP12]
          Length = 75

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  S +G   IDYKDI LL  ++S+ GKIVPSRI+    + QR+LAKAIK AR++G
Sbjct: 7  RKKMCRFSAEGGNEIDYKDINLLKNYISETGKIVPSRITGTQTRFQRQLAKAIKHARFIG 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYCD 72


>gi|119947024|ref|YP_944704.1| ribosomal protein S18 [Psychromonas ingrahamii 37]
 gi|166220979|sp|A1T040|RS18_PSYIN RecName: Full=30S ribosomal protein S18
 gi|119865628|gb|ABM05105.1| SSU ribosomal protein S18P [Psychromonas ingrahamii 37]
          Length = 75

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVSEIDYKDVVTLKNYITESGKIVPSRITGTCAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|77361356|ref|YP_340931.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas haloplanktis
          TAC125]
 gi|315125714|ref|YP_004067717.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas sp. SM9913]
 gi|332535621|ref|ZP_08411387.1| 30S ribosomal protein S18 [Pseudoalteromonas haloplanktis
          ANT/505]
 gi|123588590|sp|Q3II81|RS18_PSEHT RecName: Full=30S ribosomal protein S18
 gi|76876267|emb|CAI87489.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas haloplanktis
          TAC125]
 gi|315014228|gb|ADT67566.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas sp. SM9913]
 gi|332034976|gb|EGI71498.1| 30S ribosomal protein S18 [Pseudoalteromonas haloplanktis
          ANT/505]
          Length = 75

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 47/67 (70%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C    +G  +IDYKD+  L  ++++ GKIVPSRI+  S K QR+LA AIKRARYL 
Sbjct: 7  RRKFCRFKAEGVQQIDYKDLATLRNYVTESGKIVPSRITGTSAKYQRQLATAIKRARYLA 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|88858916|ref|ZP_01133557.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas tunicata D2]
 gi|88819142|gb|EAR28956.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas tunicata D2]
          Length = 75

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 47/67 (70%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C    +G  +IDYKD+  L  ++++ GKIVPSRI+  S K QR+LA AIKRARYL 
Sbjct: 7  RRKFCRFKAEGVQKIDYKDLATLRNYVTESGKIVPSRITGTSAKYQRQLAAAIKRARYLA 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|304312012|ref|YP_003811610.1| 30S ribosomal protein S18 [gamma proteobacterium HdN1]
 gi|301797745|emb|CBL45967.1| 30S ribosomal protein S18 [gamma proteobacterium HdN1]
          Length = 75

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+ LL  ++++ GKIVPSRI+  S + QR+LA A+KRAR+L 
Sbjct: 7  RRKFCRFTAEGVQEIDYKDLELLKNYITETGKIVPSRITGTSARYQRQLATAVKRARFLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|119471281|ref|ZP_01613784.1| 30S ribosomal subunit protein S18 [Alteromonadales bacterium
          TW-7]
 gi|119445747|gb|EAW27030.1| 30S ribosomal subunit protein S18 [Alteromonadales bacterium
          TW-7]
          Length = 75

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 47/67 (70%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C    +G  +IDYKD+  L  ++++ GKIVPSRI+  S K QR+LA AIKRARYL 
Sbjct: 7  RRKFCRFKAEGVQQIDYKDLATLRNYVTESGKIVPSRITGTSAKFQRQLATAIKRARYLA 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|21242371|ref|NP_641953.1| 30S ribosomal protein S18 [Xanthomonas axonopodis pv. citri str.
          306]
 gi|78047218|ref|YP_363393.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. vesicatoria
          str. 85-10]
 gi|190575040|ref|YP_001972885.1| 30S ribosomal protein S18 [Stenotrophomonas maltophilia K279a]
 gi|254524088|ref|ZP_05136143.1| ribosomal protein S18 [Stenotrophomonas sp. SKA14]
 gi|285018509|ref|YP_003376220.1| 30s ribosomal subunit protein s18 [Xanthomonas albilineans GPE
          PC73]
 gi|325928161|ref|ZP_08189370.1| SSU ribosomal protein S18P [Xanthomonas perforans 91-118]
 gi|23822134|sp|Q8PM13|RS18_XANAC RecName: Full=30S ribosomal protein S18
 gi|123771403|sp|Q3BV20|RS18_XANC5 RecName: Full=30S ribosomal protein S18
 gi|229560069|sp|B2FKJ8|RS18_STRMK RecName: Full=30S ribosomal protein S18
 gi|21107808|gb|AAM36489.1| 30S ribosomal protein S18 [Xanthomonas axonopodis pv. citri str.
          306]
 gi|78035648|emb|CAJ23339.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. vesicatoria
          str. 85-10]
 gi|190012962|emb|CAQ46594.1| 30s ribosomal subunit protein S18 [Stenotrophomonas maltophilia
          K279a]
 gi|219721679|gb|EED40204.1| ribosomal protein S18 [Stenotrophomonas sp. SKA14]
 gi|283473727|emb|CBA16230.1| probable 30s ribosomal subunit protein s18 [Xanthomonas
          albilineans]
 gi|325541457|gb|EGD12990.1| SSU ribosomal protein S18P [Xanthomonas perforans 91-118]
          Length = 76

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L ++L++ GKIVPSR++    K QR+LA A+KRAR+L 
Sbjct: 7  RRKFCKFTAEGVKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSKYQRQLATAVKRARFLA 66

Query: 77 LIAYVN 82
          LI Y +
Sbjct: 67 LIPYTD 72


>gi|194366361|ref|YP_002028971.1| 30S ribosomal protein S18 [Stenotrophomonas maltophilia R551-3]
 gi|229560068|sp|B4SP93|RS18_STRM5 RecName: Full=30S ribosomal protein S18
 gi|194349165|gb|ACF52288.1| ribosomal protein S18 [Stenotrophomonas maltophilia R551-3]
          Length = 76

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L ++L++ GKIVPSR++    K QR+LA A+KRAR+L 
Sbjct: 7  RRKFCKFTAEGVKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSKYQRQLATAVKRARFLA 66

Query: 77 LIAYVN 82
          LI Y +
Sbjct: 67 LIPYTD 72


>gi|52841821|ref|YP_095620.1| 30S ribosomal protein S18 [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|54294365|ref|YP_126780.1| 30S ribosomal protein S18 [Legionella pneumophila str. Lens]
 gi|54297504|ref|YP_123873.1| 30S ribosomal protein S18 [Legionella pneumophila str. Paris]
 gi|148359128|ref|YP_001250335.1| 30S ribosomal protein S18 [Legionella pneumophila str. Corby]
 gi|296107176|ref|YP_003618876.1| rpsR 30S ribosomal protein S18 [Legionella pneumophila 2300/99
          Alcoy]
 gi|81679230|sp|Q5WWL9|RS18_LEGPL RecName: Full=30S ribosomal protein S18
 gi|81679473|sp|Q5X4X1|RS18_LEGPA RecName: Full=30S ribosomal protein S18
 gi|81680465|sp|Q5ZV49|RS18_LEGPH RecName: Full=30S ribosomal protein S18
 gi|166220957|sp|A5IC89|RS18_LEGPC RecName: Full=30S ribosomal protein S18
 gi|52628932|gb|AAU27673.1| 30S ribosomal protein S18 [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|53751289|emb|CAH12700.1| 30S ribosomal subunit protein S18 [Legionella pneumophila str.
          Paris]
 gi|53754197|emb|CAH15674.1| 30S ribosomal subunit protein S18 [Legionella pneumophila str.
          Lens]
 gi|148280901|gb|ABQ54989.1| 30S ribosomal protein S18 [Legionella pneumophila str. Corby]
 gi|295649077|gb|ADG24924.1| rpsR 30S ribosomal protein S18 [Legionella pneumophila 2300/99
          Alcoy]
 gi|307610291|emb|CBW99855.1| 30S ribosomal subunit protein S18 [Legionella pneumophila 130b]
          Length = 75

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 47/66 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  S +G   IDYKDI LL  ++++ GKIVPSRI+    + QR+LAKAIK AR++G
Sbjct: 7  RKKMCRFSAEGGNEIDYKDINLLKNYITETGKIVPSRITGTQTRFQRQLAKAIKHARFIG 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYCD 72


>gi|326568102|gb|EGE18186.1| 30S ribosomal protein S18 [Moraxella catarrhalis BC7]
          Length = 75

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+ LL +++S+ GKI PSRI+  S K QR+L  AIK+ARYL 
Sbjct: 7  RRKFCRFTAEGITHIDYKDVELLKQYISENGKITPSRITGTSTKYQRQLTVAIKQARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|329297941|ref|ZP_08255277.1| 30S ribosomal protein S18 [Plautia stali symbiont]
          Length = 75

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTCAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|30023496|ref|NP_835127.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 14579]
 gi|42784668|ref|NP_981915.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 10987]
 gi|47568671|ref|ZP_00239368.1| ribosomal protein S18 [Bacillus cereus G9241]
 gi|206970197|ref|ZP_03231150.1| 30S ribosomal protein S18 [Bacillus cereus AH1134]
 gi|206975889|ref|ZP_03236800.1| 30S ribosomal protein S18 [Bacillus cereus H3081.97]
 gi|217962965|ref|YP_002341543.1| 30S ribosomal protein S18 [Bacillus cereus AH187]
 gi|218232550|ref|YP_002370247.1| 30S ribosomal protein S18 [Bacillus cereus B4264]
 gi|218900613|ref|YP_002449024.1| ribosomal protein S18 [Bacillus cereus G9842]
 gi|222098949|ref|YP_002533007.1| 30S ribosomal protein s18 [Bacillus cereus Q1]
 gi|228905416|ref|ZP_04069371.1| 30S ribosomal protein S18 [Bacillus thuringiensis IBL 4222]
 gi|228911311|ref|ZP_04075115.1| 30S ribosomal protein S18 [Bacillus thuringiensis IBL 200]
 gi|228924217|ref|ZP_04087488.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          huazhongensis BGSC 4BD1]
 gi|228942621|ref|ZP_04105153.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          berliner ATCC 10792]
 gi|228955723|ref|ZP_04117718.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
 gi|228961736|ref|ZP_04123339.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          pakistani str. T13001]
 gi|228968624|ref|ZP_04129607.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar sotto
          str. T04001]
 gi|228975551|ref|ZP_04136103.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228982187|ref|ZP_04142476.1| 30S ribosomal protein S18 [Bacillus thuringiensis Bt407]
 gi|228988700|ref|ZP_04148785.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
 gi|229051141|ref|ZP_04194685.1| 30S ribosomal protein S18 [Bacillus cereus AH676]
 gi|229072937|ref|ZP_04206133.1| 30S ribosomal protein S18 [Bacillus cereus F65185]
 gi|229082681|ref|ZP_04215135.1| 30S ribosomal protein S18 [Bacillus cereus Rock4-2]
 gi|229112885|ref|ZP_04242416.1| 30S ribosomal protein S18 [Bacillus cereus Rock1-15]
 gi|229130718|ref|ZP_04259671.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-Cer4]
 gi|229142221|ref|ZP_04270745.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-ST26]
 gi|229148022|ref|ZP_04276361.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-ST24]
 gi|229153631|ref|ZP_04281807.1| 30S ribosomal protein S18 [Bacillus cereus m1550]
 gi|229159032|ref|ZP_04287088.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 4342]
 gi|229164423|ref|ZP_04292351.1| 30S ribosomal protein S18 [Bacillus cereus R309803]
 gi|229181718|ref|ZP_04309041.1| 30S ribosomal protein S18 [Bacillus cereus 172560W]
 gi|229193723|ref|ZP_04320664.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 10876]
 gi|229199602|ref|ZP_04326262.1| 30S ribosomal protein S18 [Bacillus cereus m1293]
 gi|296505900|ref|YP_003667600.1| 30S ribosomal protein S18 [Bacillus thuringiensis BMB171]
 gi|59798780|sp|Q72WV5|RS18_BACC1 RecName: Full=30S ribosomal protein S18
 gi|59798875|sp|Q814G7|RS18_BACCR RecName: Full=30S ribosomal protein S18
 gi|226735108|sp|B7IS16|RS18_BACC2 RecName: Full=30S ribosomal protein S18
 gi|226735109|sp|B7HGD2|RS18_BACC4 RecName: Full=30S ribosomal protein S18
 gi|226735110|sp|B7HZF9|RS18_BACC7 RecName: Full=30S ribosomal protein S18
 gi|254765410|sp|B9IT30|RS18_BACCQ RecName: Full=30S ribosomal protein S18
 gi|29899057|gb|AAP12328.1| SSU ribosomal protein S18P [Bacillus cereus ATCC 14579]
 gi|42740600|gb|AAS44523.1| ribosomal protein S18 [Bacillus cereus ATCC 10987]
 gi|47554659|gb|EAL13013.1| ribosomal protein S18 [Bacillus cereus G9241]
 gi|206734774|gb|EDZ51943.1| 30S ribosomal protein S18 [Bacillus cereus AH1134]
 gi|206745983|gb|EDZ57379.1| 30S ribosomal protein S18 [Bacillus cereus H3081.97]
 gi|217064909|gb|ACJ79159.1| ribosomal protein S18 [Bacillus cereus AH187]
 gi|218160507|gb|ACK60499.1| ribosomal protein S18 [Bacillus cereus B4264]
 gi|218540805|gb|ACK93199.1| ribosomal protein S18 [Bacillus cereus G9842]
 gi|221243008|gb|ACM15718.1| ribosomal protein S18 [Bacillus cereus Q1]
 gi|228583876|gb|EEK42034.1| 30S ribosomal protein S18 [Bacillus cereus m1293]
 gi|228589748|gb|EEK47626.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 10876]
 gi|228601751|gb|EEK59249.1| 30S ribosomal protein S18 [Bacillus cereus 172560W]
 gi|228619028|gb|EEK75926.1| 30S ribosomal protein S18 [Bacillus cereus R309803]
 gi|228624451|gb|EEK81222.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 4342]
 gi|228629817|gb|EEK86470.1| 30S ribosomal protein S18 [Bacillus cereus m1550]
 gi|228635447|gb|EEK91938.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-ST24]
 gi|228641239|gb|EEK97546.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-ST26]
 gi|228652735|gb|EEL08620.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-Cer4]
 gi|228670564|gb|EEL25877.1| 30S ribosomal protein S18 [Bacillus cereus Rock1-15]
 gi|228700626|gb|EEL53158.1| 30S ribosomal protein S18 [Bacillus cereus Rock4-2]
 gi|228710183|gb|EEL62161.1| 30S ribosomal protein S18 [Bacillus cereus F65185]
 gi|228722204|gb|EEL73605.1| 30S ribosomal protein S18 [Bacillus cereus AH676]
 gi|228771012|gb|EEM19493.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
 gi|228777539|gb|EEM25817.1| 30S ribosomal protein S18 [Bacillus thuringiensis Bt407]
 gi|228784161|gb|EEM32188.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228791053|gb|EEM38671.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar sotto
          str. T04001]
 gi|228797930|gb|EEM44940.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          pakistani str. T13001]
 gi|228803951|gb|EEM50575.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
 gi|228817047|gb|EEM63140.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          berliner ATCC 10792]
 gi|228835435|gb|EEM80805.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          huazhongensis BGSC 4BD1]
 gi|228848329|gb|EEM93179.1| 30S ribosomal protein S18 [Bacillus thuringiensis IBL 200]
 gi|228854236|gb|EEM98939.1| 30S ribosomal protein S18 [Bacillus thuringiensis IBL 4222]
 gi|296326952|gb|ADH09880.1| 30S ribosomal protein S18 [Bacillus thuringiensis BMB171]
 gi|324329423|gb|ADY24683.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          finitimus YBT-020]
 gi|326943270|gb|AEA19166.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          chinensis CT-43]
          Length = 77

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + RRK C  +  G  RIDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR 
Sbjct: 9  AKRRKVCFFTANGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAIKRARQ 68

Query: 75 LGLIAYVN 82
          + L+ YV 
Sbjct: 69 MALLPYVG 76


>gi|114319745|ref|YP_741428.1| 30S ribosomal protein S18 [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312361|sp|Q0AB49|RS18_ALHEH RecName: Full=30S ribosomal protein S18
 gi|114226139|gb|ABI55938.1| SSU ribosomal protein S18P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 74

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 47/66 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+  S + QR+LA+AIKRARYL 
Sbjct: 7  RRKYCRFTAEGVKEIDYKDLNTLRNYVTETGKIVPSRITGTSARYQRQLARAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|121997453|ref|YP_001002240.1| 30S ribosomal protein S18 [Halorhodospira halophila SL1]
 gi|166220954|sp|A1WUS6|RS18_HALHL RecName: Full=30S ribosomal protein S18
 gi|121588858|gb|ABM61438.1| SSU ribosomal protein S18P [Halorhodospira halophila SL1]
          Length = 74

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L  +++  GKIVPSRI+  S + QR+LA+AIKRARYL 
Sbjct: 7  RRKYCKFTAEGVKEIDYKDLNTLKNYITDTGKIVPSRITGTSARYQRQLARAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|282891669|ref|ZP_06300156.1| hypothetical protein pah_c188o044 [Parachlamydia acanthamoebae
          str. Hall's coccus]
 gi|281498459|gb|EFB40791.1| hypothetical protein pah_c188o044 [Parachlamydia acanthamoebae
          str. Hall's coccus]
          Length = 85

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 49/65 (75%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK+CP +  G   IDYKD+  L++F+++RGKI+P RI+ VS   Q+ LA+AIKRAR++ 
Sbjct: 18 KRKTCPFTAAGITEIDYKDVSTLSKFITERGKILPRRITGVSAYHQKRLAEAIKRARHIA 77

Query: 77 LIAYV 81
          L+ +V
Sbjct: 78 LLPFV 82


>gi|229014638|ref|ZP_04171752.1| 30S ribosomal protein S18 [Bacillus mycoides DSM 2048]
 gi|229020697|ref|ZP_04177424.1| 30S ribosomal protein S18 [Bacillus cereus AH1273]
 gi|229026913|ref|ZP_04183236.1| 30S ribosomal protein S18 [Bacillus cereus AH1272]
 gi|229065131|ref|ZP_04200424.1| 30S ribosomal protein S18 [Bacillus cereus AH603]
 gi|229106064|ref|ZP_04236679.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-28]
 gi|229136297|ref|ZP_04265044.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-ST196]
 gi|229176148|ref|ZP_04303640.1| 30S ribosomal protein S18 [Bacillus cereus MM3]
 gi|228607307|gb|EEK64637.1| 30S ribosomal protein S18 [Bacillus cereus MM3]
 gi|228647169|gb|EEL03257.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-ST196]
 gi|228677350|gb|EEL31612.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-28]
 gi|228716160|gb|EEL67879.1| 30S ribosomal protein S18 [Bacillus cereus AH603]
 gi|228734371|gb|EEL85042.1| 30S ribosomal protein S18 [Bacillus cereus AH1272]
 gi|228740592|gb|EEL90863.1| 30S ribosomal protein S18 [Bacillus cereus AH1273]
 gi|228746649|gb|EEL96538.1| 30S ribosomal protein S18 [Bacillus mycoides DSM 2048]
          Length = 82

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + RRK C  +  G  RIDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR 
Sbjct: 14 AKRRKVCFFTSNGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAIKRARQ 73

Query: 75 LGLIAYVN 82
          + L+ YV 
Sbjct: 74 MALLPYVG 81


>gi|30265490|ref|NP_847867.1| 30S ribosomal protein S18 [Bacillus anthracis str. Ames]
 gi|47531058|ref|YP_022407.1| 30S ribosomal protein S18 [Bacillus anthracis str. 'Ames
          Ancestor']
 gi|49188309|ref|YP_031562.1| 30S ribosomal protein S18 [Bacillus anthracis str. Sterne]
 gi|49481204|ref|YP_039462.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          konkukian str. 97-27]
 gi|52145280|ref|YP_086737.1| 30S ribosomal protein S18 [Bacillus cereus E33L]
 gi|65317453|ref|ZP_00390412.1| COG0238: Ribosomal protein S18 [Bacillus anthracis str. A2012]
 gi|118480500|ref|YP_897651.1| 30S ribosomal protein S18 [Bacillus thuringiensis str. Al Hakam]
 gi|163943152|ref|YP_001648036.1| 30S ribosomal protein S18 [Bacillus weihenstephanensis KBAB4]
 gi|165873035|ref|ZP_02217656.1| ribosomal protein S18 [Bacillus anthracis str. A0488]
 gi|167635075|ref|ZP_02393392.1| ribosomal protein S18 [Bacillus anthracis str. A0442]
 gi|167641758|ref|ZP_02400001.1| ribosomal protein S18 [Bacillus anthracis str. A0193]
 gi|170689458|ref|ZP_02880648.1| ribosomal protein S18 [Bacillus anthracis str. A0465]
 gi|170707550|ref|ZP_02898003.1| ribosomal protein S18 [Bacillus anthracis str. A0389]
 gi|177655284|ref|ZP_02936838.1| ribosomal protein S18 [Bacillus anthracis str. A0174]
 gi|190569300|ref|ZP_03022194.1| ribosomal protein S18 [Bacillus anthracis Tsiankovskii-I]
 gi|196036074|ref|ZP_03103474.1| ribosomal protein S18 [Bacillus cereus W]
 gi|196041980|ref|ZP_03109267.1| ribosomal protein S18 [Bacillus cereus NVH0597-99]
 gi|196045471|ref|ZP_03112702.1| ribosomal protein S18 [Bacillus cereus 03BB108]
 gi|218906664|ref|YP_002454498.1| ribosomal protein S18 [Bacillus cereus AH820]
 gi|225867453|ref|YP_002752831.1| 30S ribosomal protein S18 [Bacillus cereus 03BB102]
 gi|227818241|ref|YP_002818250.1| 30S ribosomal protein S18 [Bacillus anthracis str. CDC 684]
 gi|228918084|ref|ZP_04081612.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
 gi|228930478|ref|ZP_04093478.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          pondicheriensis BGSC 4BA1]
 gi|228936752|ref|ZP_04099543.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          andalousiensis BGSC 4AW1]
 gi|228949194|ref|ZP_04111462.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|228994191|ref|ZP_04154091.1| 30S ribosomal protein S18 [Bacillus pseudomycoides DSM 12442]
 gi|229000261|ref|ZP_04159830.1| 30S ribosomal protein S18 [Bacillus mycoides Rock3-17]
 gi|229007785|ref|ZP_04165371.1| 30S ribosomal protein S18 [Bacillus mycoides Rock1-4]
 gi|229035130|ref|ZP_04189076.1| 30S ribosomal protein S18 [Bacillus cereus AH1271]
 gi|229087959|ref|ZP_04220067.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-44]
 gi|229094583|ref|ZP_04225650.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-42]
 gi|229099899|ref|ZP_04230822.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-29]
 gi|229118962|ref|ZP_04248307.1| 30S ribosomal protein S18 [Bacillus cereus Rock1-3]
 gi|229124975|ref|ZP_04254149.1| 30S ribosomal protein S18 [Bacillus cereus 95/8201]
 gi|229170175|ref|ZP_04297861.1| 30S ribosomal protein S18 [Bacillus cereus AH621]
 gi|229187701|ref|ZP_04314837.1| 30S ribosomal protein S18 [Bacillus cereus BGSC 6E1]
 gi|229604103|ref|YP_002869681.1| 30S ribosomal protein S18 [Bacillus anthracis str. A0248]
 gi|254687087|ref|ZP_05150945.1| 30S ribosomal protein S18 [Bacillus anthracis str. CNEVA-9066]
 gi|254724130|ref|ZP_05185915.1| 30S ribosomal protein S18 [Bacillus anthracis str. A1055]
 gi|254735147|ref|ZP_05192857.1| 30S ribosomal protein S18 [Bacillus anthracis str. Western North
          America USA6153]
 gi|254742144|ref|ZP_05199831.1| 30S ribosomal protein S18 [Bacillus anthracis str. Kruger B]
 gi|254755946|ref|ZP_05207978.1| 30S ribosomal protein S18 [Bacillus anthracis str. Vollum]
 gi|254761374|ref|ZP_05213396.1| 30S ribosomal protein S18 [Bacillus anthracis str. Australia 94]
 gi|300118826|ref|ZP_07056546.1| 30S ribosomal protein S18 [Bacillus cereus SJ1]
 gi|301056946|ref|YP_003795157.1| 30S ribosomal protein S18 [Bacillus anthracis CI]
 gi|59798636|sp|Q630D0|RS18_BACCZ RecName: Full=30S ribosomal protein S18
 gi|59798712|sp|Q6HAG4|RS18_BACHK RecName: Full=30S ribosomal protein S18
 gi|59798878|sp|Q81JI4|RS18_BACAN RecName: Full=30S ribosomal protein S18
 gi|166220922|sp|A0RLQ1|RS18_BACAH RecName: Full=30S ribosomal protein S18
 gi|226735107|sp|B7JIJ9|RS18_BACC0 RecName: Full=30S ribosomal protein S18
 gi|229564239|sp|A9VTK8|RS18_BACWK RecName: Full=30S ribosomal protein S18
 gi|254765406|sp|C3P3E3|RS18_BACAA RecName: Full=30S ribosomal protein S18
 gi|254765407|sp|C3LGS9|RS18_BACAC RecName: Full=30S ribosomal protein S18
 gi|254765408|sp|C1ER65|RS18_BACC3 RecName: Full=30S ribosomal protein S18
 gi|30260168|gb|AAP29353.1| 30S ribosomal protein S18 [Bacillus anthracis str. Ames]
 gi|47506206|gb|AAT34882.1| ribosomal protein S18 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49182236|gb|AAT57612.1| ribosomal protein S18 [Bacillus anthracis str. Sterne]
 gi|49332760|gb|AAT63406.1| ribosomal protein S18 (30S ribosomal protein S18) [Bacillus
          thuringiensis serovar konkukian str. 97-27]
 gi|51978749|gb|AAU20299.1| ribosomal protein S18 (30S ribosomal protein S18) [Bacillus
          cereus E33L]
 gi|118419725|gb|ABK88144.1| SSU ribosomal protein S18P [Bacillus thuringiensis str. Al Hakam]
 gi|163865349|gb|ABY46408.1| ribosomal protein S18 [Bacillus weihenstephanensis KBAB4]
 gi|164711247|gb|EDR16803.1| ribosomal protein S18 [Bacillus anthracis str. A0488]
 gi|167510312|gb|EDR85715.1| ribosomal protein S18 [Bacillus anthracis str. A0193]
 gi|167529549|gb|EDR92299.1| ribosomal protein S18 [Bacillus anthracis str. A0442]
 gi|170127546|gb|EDS96420.1| ribosomal protein S18 [Bacillus anthracis str. A0389]
 gi|170666560|gb|EDT17333.1| ribosomal protein S18 [Bacillus anthracis str. A0465]
 gi|172080211|gb|EDT65303.1| ribosomal protein S18 [Bacillus anthracis str. A0174]
 gi|190559607|gb|EDV13598.1| ribosomal protein S18 [Bacillus anthracis Tsiankovskii-I]
 gi|195991241|gb|EDX55209.1| ribosomal protein S18 [Bacillus cereus W]
 gi|196023678|gb|EDX62354.1| ribosomal protein S18 [Bacillus cereus 03BB108]
 gi|196027235|gb|EDX65855.1| ribosomal protein S18 [Bacillus cereus NVH0597-99]
 gi|218539261|gb|ACK91659.1| ribosomal protein S18 [Bacillus cereus AH820]
 gi|225787551|gb|ACO27768.1| 30S ribosomal protein S18 [Bacillus cereus 03BB102]
 gi|227005264|gb|ACP15007.1| 30S ribosomal protein S18 [Bacillus anthracis str. CDC 684]
 gi|228595769|gb|EEK53453.1| 30S ribosomal protein S18 [Bacillus cereus BGSC 6E1]
 gi|228613276|gb|EEK70415.1| 30S ribosomal protein S18 [Bacillus cereus AH621]
 gi|228658476|gb|EEL14142.1| 30S ribosomal protein S18 [Bacillus cereus 95/8201]
 gi|228664487|gb|EEL19983.1| 30S ribosomal protein S18 [Bacillus cereus Rock1-3]
 gi|228683514|gb|EEL37469.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-29]
 gi|228688830|gb|EEL42661.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-42]
 gi|228695344|gb|EEL48221.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-44]
 gi|228728196|gb|EEL79226.1| 30S ribosomal protein S18 [Bacillus cereus AH1271]
 gi|228753462|gb|EEM02914.1| 30S ribosomal protein S18 [Bacillus mycoides Rock1-4]
 gi|228759593|gb|EEM08570.1| 30S ribosomal protein S18 [Bacillus mycoides Rock3-17]
 gi|228765643|gb|EEM14297.1| 30S ribosomal protein S18 [Bacillus pseudomycoides DSM 12442]
 gi|228810477|gb|EEM56830.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|228822961|gb|EEM68802.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          andalousiensis BGSC 4AW1]
 gi|228829197|gb|EEM74834.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          pondicheriensis BGSC 4BA1]
 gi|228841564|gb|EEM86680.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
 gi|229268511|gb|ACQ50148.1| 30S ribosomal protein S18 [Bacillus anthracis str. A0248]
 gi|298723794|gb|EFI64516.1| 30S ribosomal protein S18 [Bacillus cereus SJ1]
 gi|300379115|gb|ADK08019.1| 30S ribosomal protein S18 [Bacillus cereus biovar anthracis str.
          CI]
          Length = 77

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + RRK C  +  G  RIDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR 
Sbjct: 9  AKRRKVCFFTSNGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAIKRARQ 68

Query: 75 LGLIAYVN 82
          + L+ YV 
Sbjct: 69 MALLPYVG 76


>gi|119502819|ref|ZP_01624904.1| 30S ribosomal protein S18 [marine gamma proteobacterium HTCC2080]
 gi|119461165|gb|EAW42255.1| 30S ribosomal protein S18 [marine gamma proteobacterium HTCC2080]
          Length = 75

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L +++++ GKIVPSRI+    K QR+LA A+KRAR+L 
Sbjct: 7  RRKFCKFTAEGVKEIDYKDLETLKQYITETGKIVPSRITGTKAKYQRQLATAVKRARFLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|15834432|ref|NP_313205.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 str. Sakai]
 gi|16132024|ref|NP_418623.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K-12
          substr. MG1655]
 gi|16763210|ref|NP_458827.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. CT18]
 gi|24115555|ref|NP_710065.1| 30S ribosomal protein S18 [Shigella flexneri 2a str. 301]
 gi|26251099|ref|NP_757139.1| 30S ribosomal protein S18 [Escherichia coli CFT073]
 gi|29144689|ref|NP_808031.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. Ty2]
 gi|30065573|ref|NP_839744.1| 30S ribosomal protein S18 [Shigella flexneri 2a str. 2457T]
 gi|37528390|ref|NP_931735.1| 30S ribosomal protein S18 [Photorhabdus luminescens subsp.
          laumondii TTO1]
 gi|56416184|ref|YP_153259.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. ATCC 9150]
 gi|62182837|ref|YP_219254.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|74314683|ref|YP_313102.1| 30S ribosomal protein S18 [Shigella sonnei Ss046]
 gi|82546556|ref|YP_410503.1| 30S ribosomal protein S18 [Shigella boydii Sb227]
 gi|82779400|ref|YP_405749.1| 30S ribosomal protein S18 [Shigella dysenteriae Sd197]
 gi|89110922|ref|AP_004702.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K-12
          substr. W3110]
 gi|91213751|ref|YP_543737.1| 30S ribosomal protein S18 [Escherichia coli UTI89]
 gi|110644559|ref|YP_672289.1| 30S ribosomal protein S18 [Escherichia coli 536]
 gi|110808116|ref|YP_691636.1| 30S ribosomal protein S18 [Shigella flexneri 5 str. 8401]
 gi|146310038|ref|YP_001175112.1| 30S ribosomal protein S18 [Enterobacter sp. 638]
 gi|152973068|ref|YP_001338214.1| 30S ribosomal protein S18 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|156932423|ref|YP_001436339.1| 30S ribosomal protein S18 [Cronobacter sakazakii ATCC BAA-894]
 gi|157147826|ref|YP_001455145.1| 30S ribosomal protein S18 [Citrobacter koseri ATCC BAA-895]
 gi|157158640|ref|YP_001465702.1| 30S ribosomal protein S18 [Escherichia coli E24377A]
 gi|157163667|ref|YP_001460985.1| 30S ribosomal protein S18 [Escherichia coli HS]
 gi|161505105|ref|YP_001572217.1| 30S ribosomal protein S18 [Salmonella enterica subsp. arizonae
          serovar 62:z4,z23:-- str. RSK2980]
 gi|161617665|ref|YP_001591630.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Paratyphi B str. SPB7]
 gi|168263253|ref|ZP_02685226.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
 gi|168464722|ref|ZP_02698625.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|168751446|ref|ZP_02776468.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4113]
 gi|168754774|ref|ZP_02779781.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4401]
 gi|168760445|ref|ZP_02785452.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4501]
 gi|168766482|ref|ZP_02791489.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4486]
 gi|168774085|ref|ZP_02799092.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4196]
 gi|168780635|ref|ZP_02805642.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4076]
 gi|168784840|ref|ZP_02809847.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC869]
 gi|168801858|ref|ZP_02826865.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC508]
 gi|170021788|ref|YP_001726742.1| 30S ribosomal protein S18 [Escherichia coli ATCC 8739]
 gi|170083647|ref|YP_001732967.1| 30S ribosomal protein S18 [Escherichia coli str. K-12 substr.
          DH10B]
 gi|170680020|ref|YP_001746596.1| 30S ribosomal protein S18 [Escherichia coli SMS-3-5]
 gi|170766627|ref|ZP_02901080.1| ribosomal protein S18 [Escherichia albertii TW07627]
 gi|183600324|ref|ZP_02961817.1| hypothetical protein PROSTU_03885 [Providencia stuartii ATCC
          25827]
 gi|187732798|ref|YP_001882891.1| 30S ribosomal protein S18 [Shigella boydii CDC 3083-94]
 gi|188495594|ref|ZP_03002864.1| ribosomal protein S18 [Escherichia coli 53638]
 gi|188535071|ref|YP_001908868.1| 30S ribosomal protein S18 [Erwinia tasmaniensis Et1/99]
 gi|191165620|ref|ZP_03027460.1| ribosomal protein S18 [Escherichia coli B7A]
 gi|191170703|ref|ZP_03032255.1| ribosomal protein S18 [Escherichia coli F11]
 gi|193065998|ref|ZP_03047056.1| ribosomal protein S18 [Escherichia coli E22]
 gi|193070855|ref|ZP_03051787.1| ribosomal protein S18 [Escherichia coli E110019]
 gi|194426593|ref|ZP_03059147.1| ribosomal protein S18 [Escherichia coli B171]
 gi|194434584|ref|ZP_03066841.1| ribosomal protein S18 [Shigella dysenteriae 1012]
 gi|194439537|ref|ZP_03071611.1| ribosomal protein S18 [Escherichia coli 101-1]
 gi|194446807|ref|YP_002043646.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194449942|ref|YP_002048435.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|194472416|ref|ZP_03078400.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|194734283|ref|YP_002117333.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|195935992|ref|ZP_03081374.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 str. EC4024]
 gi|197249759|ref|YP_002149307.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|197261817|ref|ZP_03161891.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197287188|ref|YP_002153060.1| 30S ribosomal protein S18 [Proteus mirabilis HI4320]
 gi|197365107|ref|YP_002144744.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. AKU_12601]
 gi|198242690|ref|YP_002218274.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|200387853|ref|ZP_03214465.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|204927186|ref|ZP_03218388.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|205355148|ref|YP_002228949.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 287/91]
 gi|206579628|ref|YP_002240847.1| ribosomal protein S18 [Klebsiella pneumoniae 342]
 gi|207859538|ref|YP_002246189.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Enteritidis str. P125109]
 gi|208809011|ref|ZP_03251348.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4206]
 gi|208814274|ref|ZP_03255603.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4045]
 gi|208819004|ref|ZP_03259324.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4042]
 gi|209400527|ref|YP_002273743.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4115]
 gi|209921692|ref|YP_002295776.1| 30S ribosomal protein S18 [Escherichia coli SE11]
 gi|212709964|ref|ZP_03318092.1| hypothetical protein PROVALCAL_01015 [Providencia alcalifaciens
          DSM 30120]
 gi|213028576|ref|ZP_03343023.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. 404ty]
 gi|213161635|ref|ZP_03347345.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. E00-7866]
 gi|213419166|ref|ZP_03352232.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. E01-6750]
 gi|213428641|ref|ZP_03361391.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. E02-1180]
 gi|213582064|ref|ZP_03363890.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-0664]
 gi|213609732|ref|ZP_03369558.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-2068]
 gi|213649001|ref|ZP_03379054.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. J185]
 gi|213864943|ref|ZP_03387062.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. M223]
 gi|215489546|ref|YP_002331977.1| 30S ribosomal protein S18 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217326502|ref|ZP_03442586.1| ribosomal protein S18 [Escherichia coli O157:H7 str. TW14588]
 gi|218551472|ref|YP_002385264.1| 30S ribosomal protein S18 [Escherichia fergusonii ATCC 35469]
 gi|218556754|ref|YP_002389668.1| 30S ribosomal protein S18 [Escherichia coli IAI1]
 gi|218561361|ref|YP_002394274.1| 30S ribosomal protein S18 [Escherichia coli S88]
 gi|218692585|ref|YP_002400797.1| 30S ribosomal protein S18 [Escherichia coli ED1a]
 gi|218697953|ref|YP_002405620.1| 30S ribosomal protein S18 [Escherichia coli 55989]
 gi|218702898|ref|YP_002410527.1| 30S ribosomal protein S18 [Escherichia coli IAI39]
 gi|218707813|ref|YP_002415332.1| 30S ribosomal protein S18 [Escherichia coli UMN026]
 gi|224586232|ref|YP_002640031.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|226326632|ref|ZP_03802150.1| hypothetical protein PROPEN_00482 [Proteus penneri ATCC 35198]
 gi|227357118|ref|ZP_03841487.1| 30S ribosomal protein S18 [Proteus mirabilis ATCC 29906]
 gi|227886754|ref|ZP_04004559.1| 30S ribosomal protein S18 [Escherichia coli 83972]
 gi|237703870|ref|ZP_04534351.1| 30S ribosomal subunit protein S18 [Escherichia sp. 3_2_53FAA]
 gi|237729131|ref|ZP_04559612.1| 30S ribosomal protein S18 [Citrobacter sp. 30_2]
 gi|238755922|ref|ZP_04617250.1| 30S ribosomal protein S18 [Yersinia ruckeri ATCC 29473]
 gi|238892682|ref|YP_002917416.1| 30S ribosomal protein S18 [Klebsiella pneumoniae NTUH-K2044]
 gi|238903309|ref|YP_002929105.1| 30S ribosomal subunit protein S18 [Escherichia coli BW2952]
 gi|238910550|ref|ZP_04654387.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Tennessee str. CDC07-0191]
 gi|238918385|ref|YP_002931899.1| 30S ribosomal protein S18 [Edwardsiella ictaluri 93-146]
 gi|242238248|ref|YP_002986429.1| ribosomal protein S18 [Dickeya dadantii Ech703]
 gi|251788413|ref|YP_003003134.1| 30S ribosomal protein S18 [Dickeya zeae Ech1591]
 gi|253775173|ref|YP_003038004.1| 30S ribosomal protein S18 [Escherichia coli 'BL21-Gold(DE3)pLysS
          AG']
 gi|253991543|ref|YP_003042899.1| 30S ribosomal protein S18 [Photorhabdus asymbiotica subsp.
          asymbiotica ATCC 43949]
 gi|254037222|ref|ZP_04871299.1| ribosomal protein S18 [Escherichia sp. 1_1_43]
 gi|254164131|ref|YP_003047239.1| 30S ribosomal protein S18 [Escherichia coli B str. REL606]
 gi|254796221|ref|YP_003081058.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 str. TW14359]
 gi|256019847|ref|ZP_05433712.1| 30S ribosomal protein S18 [Shigella sp. D9]
 gi|256025137|ref|ZP_05439002.1| 30S ribosomal protein S18 [Escherichia sp. 4_1_40B]
 gi|259907191|ref|YP_002647547.1| 30S ribosomal protein S18 [Erwinia pyrifoliae Ep1/96]
 gi|260599460|ref|YP_003212031.1| 30S ribosomal protein S18 [Cronobacter turicensis z3032]
 gi|260847031|ref|YP_003224809.1| 30S ribosomal subunit protein S18 [Escherichia coli O103:H2 str.
          12009]
 gi|260858354|ref|YP_003232245.1| 30S ribosomal subunit protein S18 [Escherichia coli O26:H11 str.
          11368]
 gi|260870890|ref|YP_003237292.1| 30S ribosomal subunit protein S18 [Escherichia coli O111:H- str.
          11128]
 gi|261225322|ref|ZP_05939603.1| 30S ribosomal subunit protein S18 [Escherichia coli O157:H7 str.
          FRIK2000]
 gi|261255426|ref|ZP_05947959.1| 30S ribosomal subunit protein S18 [Escherichia coli O157:H7 str.
          FRIK966]
 gi|261345205|ref|ZP_05972849.1| ribosomal protein S18 [Providencia rustigianii DSM 4541]
 gi|262045370|ref|ZP_06018394.1| 50S ribosomal protein L21 [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|268592870|ref|ZP_06127091.1| ribosomal protein S18 [Providencia rettgeri DSM 1131]
 gi|269137725|ref|YP_003294425.1| 30S ribosomal protein S18 [Edwardsiella tarda EIB202]
 gi|271501889|ref|YP_003334915.1| 30S ribosomal protein S18 [Dickeya dadantii Ech586]
 gi|283786876|ref|YP_003366741.1| 30S ribosomal subunit protein S18 [Citrobacter rodentium ICC168]
 gi|283834822|ref|ZP_06354563.1| ribosomal protein S18 [Citrobacter youngae ATCC 29220]
 gi|288937503|ref|YP_003441562.1| ribosomal protein S18 [Klebsiella variicola At-22]
 gi|289811466|ref|ZP_06542095.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. AG3]
 gi|289829953|ref|ZP_06547404.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-3139]
 gi|290512241|ref|ZP_06551608.1| 30S ribosomal protein S18 [Klebsiella sp. 1_1_55]
 gi|291285614|ref|YP_003502432.1| 30S ribosomal protein S18 [Escherichia coli O55:H7 str. CB9615]
 gi|291619075|ref|YP_003521817.1| RpsR [Pantoea ananatis LMG 20103]
 gi|292489606|ref|YP_003532496.1| 30S ribosomal protein S18 [Erwinia amylovora CFBP1430]
 gi|292898173|ref|YP_003537542.1| 30s ribosomal protein S18 [Erwinia amylovora ATCC 49946]
 gi|293393197|ref|ZP_06637512.1| 50S ribosomal protein L21 [Serratia odorifera DSM 4582]
 gi|293402827|ref|ZP_06646924.1| 30S ribosomal protein S18 [Escherichia coli FVEC1412]
 gi|293407927|ref|ZP_06651767.1| 30S ribosomal protein S18 [Escherichia coli B354]
 gi|293417705|ref|ZP_06660327.1| 30S ribosomal protein S18 [Escherichia coli B185]
 gi|293476510|ref|ZP_06664918.1| 30S ribosomal protein S18 [Escherichia coli B088]
 gi|294634472|ref|ZP_06713007.1| ribosomal protein S18 [Edwardsiella tarda ATCC 23685]
 gi|296100965|ref|YP_003611111.1| ribosomal protein S18 [Enterobacter cloacae subsp. cloacae ATCC
          13047]
 gi|298378356|ref|ZP_06988240.1| 30S ribosomal protein S18 [Escherichia coli FVEC1302]
 gi|300816496|ref|ZP_07096717.1| ribosomal protein S18 [Escherichia coli MS 107-1]
 gi|300821296|ref|ZP_07101444.1| ribosomal protein S18 [Escherichia coli MS 119-7]
 gi|300899740|ref|ZP_07117965.1| ribosomal protein S18 [Escherichia coli MS 198-1]
 gi|300906032|ref|ZP_07123756.1| ribosomal protein S18 [Escherichia coli MS 84-1]
 gi|300918336|ref|ZP_07134937.1| ribosomal protein S18 [Escherichia coli MS 115-1]
 gi|300922390|ref|ZP_07138510.1| ribosomal protein S18 [Escherichia coli MS 182-1]
 gi|300928018|ref|ZP_07143571.1| ribosomal protein S18 [Escherichia coli MS 187-1]
 gi|300940689|ref|ZP_07155250.1| ribosomal protein S18 [Escherichia coli MS 21-1]
 gi|300949169|ref|ZP_07163211.1| ribosomal protein S18 [Escherichia coli MS 116-1]
 gi|300955265|ref|ZP_07167658.1| ribosomal protein S18 [Escherichia coli MS 175-1]
 gi|300987233|ref|ZP_07178062.1| ribosomal protein S18 [Escherichia coli MS 45-1]
 gi|300988551|ref|ZP_07178747.1| ribosomal protein S18 [Escherichia coli MS 200-1]
 gi|301024523|ref|ZP_07188198.1| ribosomal protein S18 [Escherichia coli MS 69-1]
 gi|301028025|ref|ZP_07191309.1| ribosomal protein S18 [Escherichia coli MS 196-1]
 gi|301045965|ref|ZP_07193148.1| ribosomal protein S18 [Escherichia coli MS 185-1]
 gi|301302619|ref|ZP_07208749.1| ribosomal protein S18 [Escherichia coli MS 124-1]
 gi|301325967|ref|ZP_07219388.1| ribosomal protein S18 [Escherichia coli MS 78-1]
 gi|301646650|ref|ZP_07246516.1| ribosomal protein S18 [Escherichia coli MS 146-1]
 gi|306815583|ref|ZP_07449732.1| 30S ribosomal protein S18 [Escherichia coli NC101]
 gi|307132412|ref|YP_003884428.1| 30S ribosomal subunit protein S18 [Dickeya dadantii 3937]
 gi|307140899|ref|ZP_07500255.1| 30S ribosomal protein S18 [Escherichia coli H736]
 gi|307314849|ref|ZP_07594441.1| ribosomal protein S18 [Escherichia coli W]
 gi|309787731|ref|ZP_07682342.1| ribosomal protein S18 [Shigella dysenteriae 1617]
 gi|309797014|ref|ZP_07691414.1| ribosomal protein S18 [Escherichia coli MS 145-7]
 gi|312965875|ref|ZP_07780101.1| ribosomal protein S18 [Escherichia coli 2362-75]
 gi|312973990|ref|ZP_07788161.1| ribosomal protein S18 [Escherichia coli 1827-70]
 gi|317049740|ref|YP_004117388.1| 30S ribosomal protein S18 [Pantoea sp. At-9b]
 gi|317493585|ref|ZP_07952006.1| ribosomal protein S18 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|320539666|ref|ZP_08039330.1| 30S ribosomal subunit protein S18 [Serratia symbiotica str.
          Tucson]
 gi|330003415|ref|ZP_08304613.1| ribosomal protein S18 [Klebsiella sp. MS 92-3]
 gi|331644954|ref|ZP_08346071.1| ribosomal protein S18 [Escherichia coli H736]
 gi|331650327|ref|ZP_08351399.1| ribosomal protein S18 [Escherichia coli M605]
 gi|331656030|ref|ZP_08357018.1| ribosomal protein S18 [Escherichia coli M718]
 gi|331660777|ref|ZP_08361709.1| ribosomal protein S18 [Escherichia coli TA206]
 gi|331665866|ref|ZP_08366760.1| ribosomal protein S18 [Escherichia coli TA143]
 gi|331671111|ref|ZP_08371944.1| ribosomal protein S18 [Escherichia coli TA271]
 gi|331671353|ref|ZP_08372151.1| ribosomal protein S18 [Escherichia coli TA280]
 gi|331680332|ref|ZP_08380991.1| ribosomal protein S18 [Escherichia coli H591]
 gi|331681220|ref|ZP_08381857.1| ribosomal protein S18 [Escherichia coli H299]
 gi|332280987|ref|ZP_08393400.1| ribosomal protein S18 [Shigella sp. D9]
 gi|67472372|sp|P0A7T7|RS18_ECOLI RecName: Full=30S ribosomal protein S18
 gi|67472373|sp|P0A7T8|RS18_ECOL6 RecName: Full=30S ribosomal protein S18
 gi|67472374|sp|P0A7T9|RS18_ECO57 RecName: Full=30S ribosomal protein S18
 gi|67472375|sp|P0A7U0|RS18_PHOLL RecName: Full=30S ribosomal protein S18
 gi|67472376|sp|P0A7U1|RS18_SALTI RecName: Full=30S ribosomal protein S18
 gi|67472377|sp|P0A7U2|RS18_SHIFL RecName: Full=30S ribosomal protein S18
 gi|75505387|sp|Q57GI9|RS18_SALCH RecName: Full=30S ribosomal protein S18
 gi|81677980|sp|Q5PJ56|RS18_SALPA RecName: Full=30S ribosomal protein S18
 gi|123047658|sp|Q0SX84|RS18_SHIF8 RecName: Full=30S ribosomal protein S18
 gi|123084302|sp|Q1R358|RS18_ECOUT RecName: Full=30S ribosomal protein S18
 gi|123343273|sp|Q0T9J1|RS18_ECOL5 RecName: Full=30S ribosomal protein S18
 gi|123728279|sp|Q31TD3|RS18_SHIBS RecName: Full=30S ribosomal protein S18
 gi|123728458|sp|Q328J7|RS18_SHIDS RecName: Full=30S ribosomal protein S18
 gi|123759489|sp|Q3YUE5|RS18_SHISS RecName: Full=30S ribosomal protein S18
 gi|166220942|sp|A8AMJ6|RS18_CITK8 RecName: Full=30S ribosomal protein S18
 gi|166220951|sp|A7MM78|RS18_ENTS8 RecName: Full=30S ribosomal protein S18
 gi|166220955|sp|A6THB3|RS18_KLEP7 RecName: Full=30S ribosomal protein S18
 gi|167011188|sp|A7ZV73|RS18_ECO24 RecName: Full=30S ribosomal protein S18
 gi|167011189|sp|A8A7U8|RS18_ECOHS RecName: Full=30S ribosomal protein S18
 gi|167011190|sp|A4W5T1|RS18_ENT38 RecName: Full=30S ribosomal protein S18
 gi|189029651|sp|A9N520|RS18_SALPB RecName: Full=30S ribosomal protein S18
 gi|189029677|sp|B1IT04|RS18_ECOLC RecName: Full=30S ribosomal protein S18
 gi|189029686|sp|A9MFK9|RS18_SALAR RecName: Full=30S ribosomal protein S18
 gi|226735113|sp|B7MLK7|RS18_ECO45 RecName: Full=30S ribosomal protein S18
 gi|226735114|sp|B7NTQ7|RS18_ECO7I RecName: Full=30S ribosomal protein S18
 gi|226735115|sp|B7M9G4|RS18_ECO8A RecName: Full=30S ribosomal protein S18
 gi|226735116|sp|B7NGD6|RS18_ECOLU RecName: Full=30S ribosomal protein S18
 gi|226735117|sp|B1LQM1|RS18_ECOSM RecName: Full=30S ribosomal protein S18
 gi|226735119|sp|B7LLY4|RS18_ESCF3 RecName: Full=30S ribosomal protein S18
 gi|229559983|sp|B6I2A8|RS18_ECOSE RecName: Full=30S ribosomal protein S18
 gi|229559984|sp|B2VCV9|RS18_ERWT9 RecName: Full=30S ribosomal protein S18
 gi|229559986|sp|B5Z2K7|RS18_ECO5E RecName: Full=30S ribosomal protein S18
 gi|229559987|sp|B1XDV2|RS18_ECODH RecName: Full=30S ribosomal protein S18
 gi|229560040|sp|B5Y306|RS18_KLEP3 RecName: Full=30S ribosomal protein S18
 gi|229560053|sp|B4F277|RS18_PROMH RecName: Full=30S ribosomal protein S18
 gi|229560058|sp|B5F3B9|RS18_SALA4 RecName: Full=30S ribosomal protein S18
 gi|229560059|sp|B5FSA3|RS18_SALDC RecName: Full=30S ribosomal protein S18
 gi|229560060|sp|B5R0S0|RS18_SALEP RecName: Full=30S ribosomal protein S18
 gi|229560061|sp|B5R9F0|RS18_SALG2 RecName: Full=30S ribosomal protein S18
 gi|229560062|sp|B4TFD7|RS18_SALHS RecName: Full=30S ribosomal protein S18
 gi|229560063|sp|B4T3F3|RS18_SALNS RecName: Full=30S ribosomal protein S18
 gi|229560064|sp|B5BKL1|RS18_SALPK RecName: Full=30S ribosomal protein S18
 gi|229560065|sp|B4TT35|RS18_SALSV RecName: Full=30S ribosomal protein S18
 gi|229560074|sp|B2TY75|RS18_SHIB3 RecName: Full=30S ribosomal protein S18
 gi|254765429|sp|B7UQL1|RS18_ECO27 RecName: Full=30S ribosomal protein S18
 gi|254765430|sp|B7LCR3|RS18_ECO55 RecName: Full=30S ribosomal protein S18
 gi|254765431|sp|B7MST2|RS18_ECO81 RecName: Full=30S ribosomal protein S18
 gi|254812953|sp|C0Q6G0|RS18_SALPC RecName: Full=30S ribosomal protein S18
 gi|259494808|sp|C4ZR79|RS18_ECOBW RecName: Full=30S ribosomal protein S18
 gi|259494809|sp|C5BF78|RS18_EDWI9 RecName: Full=30S ribosomal protein S18
 gi|25294828|pir||AI1052 30s ribosomal chain protein S18 [imported] - Salmonella enterica
          subsp. enterica serovar Typhi (strain CT18)
 gi|116666565|pdb|1VS5|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|116666617|pdb|1VS7|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|257097339|pdb|3I1M|R Chain R, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097391|pdb|3I1O|R Chain R, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097443|pdb|3I1Q|R Chain R, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097497|pdb|3I1S|R Chain R, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097551|pdb|3I1Z|R Chain R, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097606|pdb|3I21|R Chain R, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|290560324|pdb|3KC4|R Chain R, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
          Ribosomal Subnit. The 50s Ribosomal Subunit Can Be
          Found In Pdb Entry 3kcr
 gi|308198704|pdb|3OR9|R Chain R, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 30s Subunit Of The
          First 70s Ribosome.
 gi|308198725|pdb|3ORA|R Chain R, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 30s Subunit Of The
          Second 70s Ribosome.
 gi|326634296|pdb|3IZV|V Chain V, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Small Subunit Of A Ribosome Programmed With A
          Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
          Ef-Tu
 gi|326634321|pdb|3IZW|V Chain V, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding.This Entry Contains The
          Small Subunit Of A Ribosome Programmed With A Cognate
          Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
 gi|26111531|gb|AAN83713.1|AE016771_224 30S ribosomal protein S18 [Escherichia coli CFT073]
 gi|42847|emb|CAA27654.1| unnamed protein product [Escherichia coli]
 gi|537043|gb|AAA97098.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K-12
          substr. MG1655]
 gi|1790646|gb|AAC77159.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K-12
          substr. MG1655]
 gi|13364655|dbj|BAB38601.1| 30S ribosomal subunit protein S18 [Escherichia coli O157:H7 str.
          Sakai]
 gi|16505518|emb|CAD06870.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Typhi]
 gi|24054886|gb|AAN45772.1| 30S ribosomal subunit protein S18 [Shigella flexneri 2a str. 301]
 gi|29140328|gb|AAO71891.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Typhi str. Ty2]
 gi|30043837|gb|AAP19556.1| 30S ribosomal subunit protein S18 [Shigella flexneri 2a str.
          2457T]
 gi|36787828|emb|CAE16943.1| 30S ribosomal protein S18 [Photorhabdus luminescens subsp.
          laumondii TTO1]
 gi|56130441|gb|AAV79947.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|62130470|gb|AAX68173.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|73858160|gb|AAZ90867.1| 30S ribosomal subunit protein S18 [Shigella sonnei Ss046]
 gi|81243548|gb|ABB64258.1| 30S ribosomal subunit protein S18 [Shigella dysenteriae Sd197]
 gi|81247967|gb|ABB68675.1| 30S ribosomal subunit protein S18 [Shigella boydii Sb227]
 gi|85676953|dbj|BAE78203.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K12
          substr. W3110]
 gi|91075325|gb|ABE10206.1| 30S ribosomal subunit protein S18 [Escherichia coli UTI89]
 gi|110346151|gb|ABG72388.1| 30S ribosomal protein S18 [Escherichia coli 536]
 gi|110617664|gb|ABF06331.1| 30S ribosomal subunit protein S18 [Shigella flexneri 5 str. 8401]
 gi|145316914|gb|ABP59061.1| SSU ribosomal protein S18P [Enterobacter sp. 638]
 gi|150957917|gb|ABR79947.1| 30S ribosomal protein S18 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|156530677|gb|ABU75503.1| hypothetical protein ESA_00202 [Cronobacter sakazakii ATCC
          BAA-894]
 gi|157069347|gb|ABV08602.1| ribosomal protein S18 [Escherichia coli HS]
 gi|157080670|gb|ABV20378.1| ribosomal protein S18 [Escherichia coli E24377A]
 gi|157085031|gb|ABV14709.1| hypothetical protein CKO_03630 [Citrobacter koseri ATCC BAA-895]
 gi|160866452|gb|ABX23075.1| hypothetical protein SARI_03239 [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:--]
 gi|161367029|gb|ABX70797.1| hypothetical protein SPAB_05528 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|169756716|gb|ACA79415.1| ribosomal protein S18 [Escherichia coli ATCC 8739]
 gi|169891482|gb|ACB05189.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K-12
          substr. DH10B]
 gi|170124065|gb|EDS92996.1| ribosomal protein S18 [Escherichia albertii TW07627]
 gi|170517738|gb|ACB15916.1| ribosomal protein S18 [Escherichia coli SMS-3-5]
 gi|187429790|gb|ACD09064.1| ribosomal protein S18 [Shigella boydii CDC 3083-94]
 gi|187770314|gb|EDU34158.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4196]
 gi|188014502|gb|EDU52624.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4113]
 gi|188020113|gb|EDU58153.1| hypothetical protein PROSTU_03885 [Providencia stuartii ATCC
          25827]
 gi|188030113|emb|CAO97999.1| 30S ribosomal protein S18 [Erwinia tasmaniensis Et1/99]
 gi|188490793|gb|EDU65896.1| ribosomal protein S18 [Escherichia coli 53638]
 gi|189001716|gb|EDU70702.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4076]
 gi|189357840|gb|EDU76259.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4401]
 gi|189364286|gb|EDU82705.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4486]
 gi|189368871|gb|EDU87287.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4501]
 gi|189374715|gb|EDU93131.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC869]
 gi|189376068|gb|EDU94484.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC508]
 gi|190904315|gb|EDV64024.1| ribosomal protein S18 [Escherichia coli B7A]
 gi|190908927|gb|EDV68514.1| ribosomal protein S18 [Escherichia coli F11]
 gi|192926321|gb|EDV80957.1| ribosomal protein S18 [Escherichia coli E22]
 gi|192955801|gb|EDV86272.1| ribosomal protein S18 [Escherichia coli E110019]
 gi|194405470|gb|ACF65692.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194408246|gb|ACF68465.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|194415332|gb|EDX31600.1| ribosomal protein S18 [Escherichia coli B171]
 gi|194417169|gb|EDX33281.1| ribosomal protein S18 [Shigella dysenteriae 1012]
 gi|194421536|gb|EDX37549.1| ribosomal protein S18 [Escherichia coli 101-1]
 gi|194458780|gb|EDX47619.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|194684675|emb|CAR46619.1| 30S ribosomal protein S18 [Proteus mirabilis HI4320]
 gi|194709785|gb|ACF89006.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|195632565|gb|EDX51019.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|197096584|emb|CAR62196.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|197213462|gb|ACH50859.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|197240072|gb|EDY22692.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197937206|gb|ACH74539.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|199604951|gb|EDZ03496.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|204323851|gb|EDZ09046.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|205274929|emb|CAR39998.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|205347928|gb|EDZ34559.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
 gi|206568686|gb|ACI10462.1| ribosomal protein S18 [Klebsiella pneumoniae 342]
 gi|206711341|emb|CAR35719.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|208728812|gb|EDZ78413.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4206]
 gi|208735551|gb|EDZ84238.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4045]
 gi|208739127|gb|EDZ86809.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4042]
 gi|209161927|gb|ACI39360.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4115]
 gi|209749988|gb|ACI73301.1| 30S ribosomal subunit protein S18 [Escherichia coli]
 gi|209749990|gb|ACI73302.1| 30S ribosomal subunit protein S18 [Escherichia coli]
 gi|209749992|gb|ACI73303.1| 30S ribosomal subunit protein S18 [Escherichia coli]
 gi|209749994|gb|ACI73304.1| 30S ribosomal subunit protein S18 [Escherichia coli]
 gi|209749996|gb|ACI73305.1| 30S ribosomal subunit protein S18 [Escherichia coli]
 gi|209914951|dbj|BAG80025.1| 30S ribosomal protein S18 [Escherichia coli SE11]
 gi|211638421|emb|CAR67043.1| 30s ribosomal subunit protein s18 [Photorhabdus asymbiotica
          subsp. asymbiotica ATCC 43949]
 gi|212687373|gb|EEB46901.1| hypothetical protein PROVALCAL_01015 [Providencia alcalifaciens
          DSM 30120]
 gi|215267618|emb|CAS12073.1| 30S ribosomal subunit protein S18 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217322723|gb|EEC31147.1| ribosomal protein S18 [Escherichia coli O157:H7 str. TW14588]
 gi|218354685|emb|CAV01702.1| 30S ribosomal subunit protein S18 [Escherichia coli 55989]
 gi|218359014|emb|CAQ91674.1| 30S ribosomal subunit protein S18 [Escherichia fergusonii ATCC
          35469]
 gi|218363523|emb|CAR01177.1| 30S ribosomal subunit protein S18 [Escherichia coli IAI1]
 gi|218368130|emb|CAR05937.1| 30S ribosomal subunit protein S18 [Escherichia coli S88]
 gi|218372884|emb|CAR20764.1| 30S ribosomal subunit protein S18 [Escherichia coli IAI39]
 gi|218430149|emb|CAR11007.1| 30S ribosomal subunit protein S18 [Escherichia coli ED1a]
 gi|218434910|emb|CAR15848.1| 30S ribosomal subunit protein S18 [Escherichia coli UMN026]
 gi|222035972|emb|CAP78717.1| 30S ribosomal protein S18 [Escherichia coli LF82]
 gi|224470760|gb|ACN48590.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|224962813|emb|CAX54271.1| 30S ribosomal protein S18 [Erwinia pyrifoliae Ep1/96]
 gi|225204853|gb|EEG87207.1| hypothetical protein PROPEN_00482 [Proteus penneri ATCC 35198]
 gi|226840328|gb|EEH72330.1| ribosomal protein S18 [Escherichia sp. 1_1_43]
 gi|226901782|gb|EEH88041.1| 30S ribosomal subunit protein S18 [Escherichia sp. 3_2_53FAA]
 gi|226908860|gb|EEH94778.1| 30S ribosomal protein S18 [Citrobacter sp. 30_2]
 gi|227162650|gb|EEI47617.1| 30S ribosomal protein S18 [Proteus mirabilis ATCC 29906]
 gi|227836327|gb|EEJ46793.1| 30S ribosomal protein S18 [Escherichia coli 83972]
 gi|238544998|dbj|BAH61349.1| 30S ribosomal protein S18 [Klebsiella pneumoniae subsp.
          pneumoniae NTUH-K2044]
 gi|238705881|gb|EEP98270.1| 30S ribosomal protein S18 [Yersinia ruckeri ATCC 29473]
 gi|238859792|gb|ACR61790.1| 30S ribosomal subunit protein S18 [Escherichia coli BW2952]
 gi|238867953|gb|ACR67664.1| ribosomal protein S18, putative [Edwardsiella ictaluri 93-146]
 gi|242130305|gb|ACS84607.1| ribosomal protein S18 [Dickeya dadantii Ech703]
 gi|242379723|emb|CAQ34548.1| 30S ribosomal subunit protein S18, subunit of 30S ribosomal
          subunit and ribosome [Escherichia coli BL21(DE3)]
 gi|247537034|gb|ACT05655.1| ribosomal protein S18 [Dickeya zeae Ech1591]
 gi|253326217|gb|ACT30819.1| ribosomal protein S18 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253782993|emb|CAQ86158.1| 30s ribosomal subunit protein s18 [Photorhabdus asymbiotica]
 gi|253976032|gb|ACT41703.1| 30S ribosomal protein S18 [Escherichia coli B str. REL606]
 gi|253980188|gb|ACT45858.1| 30S ribosomal protein S18 [Escherichia coli BL21(DE3)]
 gi|254595621|gb|ACT74982.1| 30S ribosomal subunit protein S18 [Escherichia coli O157:H7 str.
          TW14359]
 gi|257757003|dbj|BAI28505.1| 30S ribosomal subunit protein S18 [Escherichia coli O26:H11 str.
          11368]
 gi|257762178|dbj|BAI33675.1| 30S ribosomal subunit protein S18 [Escherichia coli O103:H2 str.
          12009]
 gi|257767246|dbj|BAI38741.1| 30S ribosomal subunit protein S18 [Escherichia coli O111:H- str.
          11128]
 gi|259037288|gb|EEW38535.1| 50S ribosomal protein L21 [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|260218637|emb|CBA33945.1| 30S ribosomal protein S18 [Cronobacter turicensis z3032]
 gi|260450971|gb|ACX41393.1| ribosomal protein S18 [Escherichia coli DH1]
 gi|261249483|emb|CBG27348.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. D23580]
 gi|267983385|gb|ACY83214.1| 30S ribosomal protein S18 [Edwardsiella tarda EIB202]
 gi|267996727|gb|ACY91612.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 14028S]
 gi|270345444|gb|ACZ78209.1| ribosomal protein S18 [Dickeya dadantii Ech586]
 gi|281181298|dbj|BAI57628.1| 30S ribosomal protein S18 [Escherichia coli SE15]
 gi|281603664|gb|ADA76648.1| 30S ribosomal protein S18 [Shigella flexneri 2002017]
 gi|282566898|gb|EFB72433.1| ribosomal protein S18 [Providencia rustigianii DSM 4541]
 gi|282950330|emb|CBG89977.1| 30S ribosomal subunit protein S18 [Citrobacter rodentium ICC168]
 gi|283477000|emb|CAY72892.1| 30S ribosomal protein S18 [Erwinia pyrifoliae DSM 12163]
 gi|284006637|emb|CBA71898.1| 30S ribosomal protein S18 [Arsenophonus nasoniae]
 gi|284924382|emb|CBG37504.1| 30S ribosomal subunit protein S18 [Escherichia coli 042]
 gi|288892212|gb|ADC60530.1| ribosomal protein S18 [Klebsiella variicola At-22]
 gi|289775236|gb|EFD83237.1| 30S ribosomal protein S18 [Klebsiella sp. 1_1_55]
 gi|290765487|gb|ADD59448.1| 30S ribosomal protein S18 [Escherichia coli O55:H7 str. CB9615]
 gi|291069070|gb|EFE07179.1| ribosomal protein S18 [Citrobacter youngae ATCC 29220]
 gi|291091986|gb|EFE24547.1| ribosomal protein S18 [Edwardsiella tarda ATCC 23685]
 gi|291154105|gb|ADD78689.1| RpsR [Pantoea ananatis LMG 20103]
 gi|291198021|emb|CBJ45124.1| 30s ribosomal subunit protein S18 [Erwinia amylovora ATCC 49946]
 gi|291311659|gb|EFE52112.1| ribosomal protein S18 [Providencia rettgeri DSM 1131]
 gi|291320963|gb|EFE60405.1| 30S ribosomal protein S18 [Escherichia coli B088]
 gi|291424343|gb|EFE97557.1| 50S ribosomal protein L21 [Serratia odorifera DSM 4582]
 gi|291429742|gb|EFF02756.1| 30S ribosomal protein S18 [Escherichia coli FVEC1412]
 gi|291430423|gb|EFF03421.1| 30S ribosomal protein S18 [Escherichia coli B185]
 gi|291472178|gb|EFF14660.1| 30S ribosomal protein S18 [Escherichia coli B354]
 gi|291555043|emb|CBA23114.1| 30S ribosomal protein S18 [Erwinia amylovora CFBP1430]
 gi|294492280|gb|ADE91036.1| ribosomal protein S18 [Escherichia coli IHE3034]
 gi|295055424|gb|ADF60162.1| ribosomal protein S18 [Enterobacter cloacae subsp. cloacae ATCC
          13047]
 gi|295098349|emb|CBK87439.1| ribosomal protein S18 [Enterobacter cloacae subsp. cloacae NCTC
          9394]
 gi|298280690|gb|EFI22191.1| 30S ribosomal protein S18 [Escherichia coli FVEC1302]
 gi|299878935|gb|EFI87146.1| ribosomal protein S18 [Escherichia coli MS 196-1]
 gi|300302008|gb|EFJ58393.1| ribosomal protein S18 [Escherichia coli MS 185-1]
 gi|300305897|gb|EFJ60417.1| ribosomal protein S18 [Escherichia coli MS 200-1]
 gi|300317842|gb|EFJ67626.1| ribosomal protein S18 [Escherichia coli MS 175-1]
 gi|300356712|gb|EFJ72582.1| ribosomal protein S18 [Escherichia coli MS 198-1]
 gi|300396522|gb|EFJ80060.1| ribosomal protein S18 [Escherichia coli MS 69-1]
 gi|300402199|gb|EFJ85737.1| ribosomal protein S18 [Escherichia coli MS 84-1]
 gi|300407710|gb|EFJ91248.1| ribosomal protein S18 [Escherichia coli MS 45-1]
 gi|300414468|gb|EFJ97778.1| ribosomal protein S18 [Escherichia coli MS 115-1]
 gi|300421209|gb|EFK04520.1| ribosomal protein S18 [Escherichia coli MS 182-1]
 gi|300451417|gb|EFK15037.1| ribosomal protein S18 [Escherichia coli MS 116-1]
 gi|300454577|gb|EFK18070.1| ribosomal protein S18 [Escherichia coli MS 21-1]
 gi|300463969|gb|EFK27462.1| ribosomal protein S18 [Escherichia coli MS 187-1]
 gi|300526185|gb|EFK47254.1| ribosomal protein S18 [Escherichia coli MS 119-7]
 gi|300530726|gb|EFK51788.1| ribosomal protein S18 [Escherichia coli MS 107-1]
 gi|300842144|gb|EFK69904.1| ribosomal protein S18 [Escherichia coli MS 124-1]
 gi|300847320|gb|EFK75080.1| ribosomal protein S18 [Escherichia coli MS 78-1]
 gi|301075197|gb|EFK90003.1| ribosomal protein S18 [Escherichia coli MS 146-1]
 gi|301160880|emb|CBW20412.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. SL1344]
 gi|304557782|gb|ADM40446.1| SSU ribosomal protein S18p [Edwardsiella tarda FL6-60]
 gi|305851245|gb|EFM51700.1| 30S ribosomal protein S18 [Escherichia coli NC101]
 gi|306529941|gb|ADM99871.1| 30S ribosomal subunit protein S18 [Dickeya dadantii 3937]
 gi|306905652|gb|EFN36181.1| ribosomal protein S18 [Escherichia coli W]
 gi|307556369|gb|ADN49144.1| 30S ribosomal protein S18 [Escherichia coli ABU 83972]
 gi|307629274|gb|ADN73578.1| 30S ribosomal protein S18 [Escherichia coli UM146]
 gi|308119427|gb|EFO56689.1| ribosomal protein S18 [Escherichia coli MS 145-7]
 gi|308924481|gb|EFP69977.1| ribosomal protein S18 [Shigella dysenteriae 1617]
 gi|309704706|emb|CBJ04057.1| 30S ribosomal subunit protein S18 [Escherichia coli ETEC H10407]
 gi|310331524|gb|EFP98780.1| ribosomal protein S18 [Escherichia coli 1827-70]
 gi|310765318|gb|ADP10268.1| 30S ribosomal protein S18 [Erwinia sp. Ejp617]
 gi|312173783|emb|CBX82037.1| 30S ribosomal protein S18 [Erwinia amylovora ATCC BAA-2158]
 gi|312289118|gb|EFR17012.1| ribosomal protein S18 [Escherichia coli 2362-75]
 gi|312915490|dbj|BAJ39464.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. T000240]
 gi|312948852|gb|ADR29679.1| 30S ribosomal subunit protein S18 [Escherichia coli O83:H1 str.
          NRG 857C]
 gi|313646322|gb|EFS10784.1| ribosomal protein S18 [Shigella flexneri 2a str. 2457T]
 gi|315063516|gb|ADT77843.1| 30S ribosomal subunit protein S18 [Escherichia coli W]
 gi|315138756|dbj|BAJ45915.1| ribosomal protein S18 [Escherichia coli DH1]
 gi|315255547|gb|EFU35515.1| ribosomal protein S18 [Escherichia coli MS 85-1]
 gi|315288483|gb|EFU47881.1| ribosomal protein S18 [Escherichia coli MS 110-3]
 gi|315293516|gb|EFU52868.1| ribosomal protein S18 [Escherichia coli MS 153-1]
 gi|315299082|gb|EFU58336.1| ribosomal protein S18 [Escherichia coli MS 16-3]
 gi|315617610|gb|EFU98216.1| ribosomal protein S18 [Escherichia coli 3431]
 gi|316918528|gb|EFV39866.1| ribosomal protein S18 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316951357|gb|ADU70832.1| ribosomal protein S18 [Pantoea sp. At-9b]
 gi|320030278|gb|EFW12293.1| 30S ribosomal subunit protein S18 [Serratia symbiotica str.
          Tucson]
 gi|320088819|emb|CBY98577.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. 2007-60-3289-1]
 gi|320176373|gb|EFW51428.1| SSU ribosomal protein S18p [Shigella dysenteriae CDC 74-1112]
 gi|320177567|gb|EFW52557.1| SSU ribosomal protein S18p [Shigella boydii ATCC 9905]
 gi|320187349|gb|EFW62043.1| SSU ribosomal protein S18p [Shigella flexneri CDC 796-83]
 gi|320190669|gb|EFW65319.1| SSU ribosomal protein S18p [Escherichia coli O157:H7 str. EC1212]
 gi|320193685|gb|EFW68320.1| SSU ribosomal protein S18p [Escherichia coli WV_060327]
 gi|320200670|gb|EFW75256.1| SSU ribosomal protein S18p [Escherichia coli EC4100B]
 gi|320638960|gb|EFX08606.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 str. G5101]
 gi|320644329|gb|EFX13394.1| 30S ribosomal protein S18 [Escherichia coli O157:H- str. 493-89]
 gi|320649647|gb|EFX18171.1| 30S ribosomal protein S18 [Escherichia coli O157:H- str. H 2687]
 gi|320655043|gb|EFX23004.1| 30S ribosomal protein S18 [Escherichia coli O55:H7 str. 3256-97
          TW 07815]
 gi|320660550|gb|EFX28011.1| 30S ribosomal protein S18 [Escherichia coli O55:H7 str. USDA
          5905]
 gi|320665819|gb|EFX32856.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 str. LSU-61]
 gi|321222643|gb|EFX47715.1| SSU ribosomal protein S18p [Salmonella enterica subsp. enterica
          serovar Typhimurium str. TN061786]
 gi|322615555|gb|EFY12475.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 315996572]
 gi|322618615|gb|EFY15504.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-1]
 gi|322621972|gb|EFY18822.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-3]
 gi|322627696|gb|EFY24487.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-4]
 gi|322631003|gb|EFY27767.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 515920-1]
 gi|322637778|gb|EFY34479.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 515920-2]
 gi|322642340|gb|EFY38945.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 531954]
 gi|322643989|gb|EFY40537.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. NC_MB110209-0054]
 gi|322650936|gb|EFY47321.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. OH_2009072675]
 gi|322653579|gb|EFY49907.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. CASC_09SCPH15965]
 gi|322659764|gb|EFY56007.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 19N]
 gi|322662025|gb|EFY58241.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 81038-01]
 gi|322666226|gb|EFY62404.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MD_MDA09249507]
 gi|322672646|gb|EFY68757.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 414877]
 gi|322676076|gb|EFY72147.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 366867]
 gi|322680560|gb|EFY76598.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 413180]
 gi|322684546|gb|EFY80550.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 446600]
 gi|322717339|gb|EFZ08910.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. A50]
 gi|323132730|gb|ADX20160.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 4/74]
 gi|323155981|gb|EFZ42143.1| ribosomal protein S18 [Escherichia coli EPECa14]
 gi|323161993|gb|EFZ47865.1| ribosomal protein S18 [Escherichia coli E128010]
 gi|323166685|gb|EFZ52443.1| ribosomal protein S18 [Shigella sonnei 53G]
 gi|323171640|gb|EFZ57286.1| ribosomal protein S18 [Escherichia coli LT-68]
 gi|323176040|gb|EFZ61632.1| ribosomal protein S18 [Escherichia coli 1180]
 gi|323182307|gb|EFZ67717.1| ribosomal protein S18 [Escherichia coli 1357]
 gi|323189920|gb|EFZ75198.1| ribosomal protein S18 [Escherichia coli RN587/1]
 gi|323192861|gb|EFZ78087.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 609458-1]
 gi|323197263|gb|EFZ82403.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 556150-1]
 gi|323201620|gb|EFZ86684.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 609460]
 gi|323206134|gb|EFZ91096.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 507440-20]
 gi|323213142|gb|EFZ97944.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 556152]
 gi|323215516|gb|EGA00260.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB101509-0077]
 gi|323219501|gb|EGA03986.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB102109-0047]
 gi|323227804|gb|EGA11958.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB110209-0055]
 gi|323228974|gb|EGA13103.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB111609-0052]
 gi|323236414|gb|EGA20490.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 2009083312]
 gi|323238681|gb|EGA22733.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 2009085258]
 gi|323241868|gb|EGA25897.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 315731156]
 gi|323247983|gb|EGA31920.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2009159199]
 gi|323254686|gb|EGA38497.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008282]
 gi|323258255|gb|EGA41932.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008283]
 gi|323263599|gb|EGA47120.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008284]
 gi|323265805|gb|EGA49301.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008285]
 gi|323270249|gb|EGA53697.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008287]
 gi|323380405|gb|ADX52673.1| ribosomal protein S18 [Escherichia coli KO11]
 gi|323935327|gb|EGB31675.1| ribosomal protein S18 [Escherichia coli E1520]
 gi|323940121|gb|EGB36315.1| ribosomal protein S18 [Escherichia coli E482]
 gi|323946051|gb|EGB42088.1| ribosomal protein S18 [Escherichia coli H120]
 gi|323950729|gb|EGB46607.1| ribosomal protein S18 [Escherichia coli H252]
 gi|323955489|gb|EGB51253.1| ribosomal protein S18 [Escherichia coli H263]
 gi|323960246|gb|EGB55887.1| ribosomal protein S18 [Escherichia coli H489]
 gi|323965589|gb|EGB61043.1| ribosomal protein S18 [Escherichia coli M863]
 gi|323970543|gb|EGB65802.1| ribosomal protein S18 [Escherichia coli TA007]
 gi|323975456|gb|EGB70557.1| ribosomal protein S18 [Escherichia coli TW10509]
 gi|324005266|gb|EGB74485.1| ribosomal protein S18 [Escherichia coli MS 57-2]
 gi|324013801|gb|EGB83020.1| ribosomal protein S18 [Escherichia coli MS 60-1]
 gi|324019380|gb|EGB88599.1| ribosomal protein S18 [Escherichia coli MS 117-3]
 gi|324112201|gb|EGC06179.1| ribosomal protein S18 [Escherichia fergusonii B253]
 gi|324118768|gb|EGC12660.1| ribosomal protein S18 [Escherichia coli E1167]
 gi|325499736|gb|EGC97595.1| 30S ribosomal protein S18 [Escherichia fergusonii ECD227]
 gi|326345469|gb|EGD69212.1| SSU ribosomal protein S18p [Escherichia coli O157:H7 str. 1125]
 gi|326346674|gb|EGD70408.1| SSU ribosomal protein S18p [Escherichia coli O157:H7 str. 1044]
 gi|326626080|gb|EGE32425.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Dublin str. 3246]
 gi|326630306|gb|EGE36649.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 9]
 gi|327250142|gb|EGE61861.1| ribosomal protein S18 [Escherichia coli STEC_7v]
 gi|327395407|dbj|BAK12829.1| 30S ribosomal protein S18 RpsR [Pantoea ananatis AJ13355]
 gi|328536975|gb|EGF63268.1| ribosomal protein S18 [Klebsiella sp. MS 92-3]
 gi|330908543|gb|EGH37062.1| SSU ribosomal protein S18p [Escherichia coli AA86]
 gi|331035929|gb|EGI08167.1| ribosomal protein S18 [Escherichia coli H736]
 gi|331040721|gb|EGI12879.1| ribosomal protein S18 [Escherichia coli M605]
 gi|331046384|gb|EGI18474.1| ribosomal protein S18 [Escherichia coli M718]
 gi|331051819|gb|EGI23858.1| ribosomal protein S18 [Escherichia coli TA206]
 gi|331056917|gb|EGI28911.1| ribosomal protein S18 [Escherichia coli TA143]
 gi|331061700|gb|EGI33626.1| ribosomal protein S18 [Escherichia coli TA271]
 gi|331071198|gb|EGI42555.1| ribosomal protein S18 [Escherichia coli TA280]
 gi|331071795|gb|EGI43131.1| ribosomal protein S18 [Escherichia coli H591]
 gi|331081441|gb|EGI52602.1| ribosomal protein S18 [Escherichia coli H299]
 gi|332083203|gb|EGI88434.1| ribosomal protein S18 [Shigella boydii 5216-82]
 gi|332083716|gb|EGI88934.1| ribosomal protein S18 [Shigella dysenteriae 155-74]
 gi|332087075|gb|EGI92209.1| ribosomal protein S18 [Shigella boydii 3594-74]
 gi|332103339|gb|EGJ06685.1| ribosomal protein S18 [Shigella sp. D9]
 gi|332346283|gb|AEE59617.1| ribosomal protein S18 RpsR [Escherichia coli UMNK88]
 gi|332749078|gb|EGJ79501.1| ribosomal protein S18 [Shigella flexneri K-671]
 gi|332749345|gb|EGJ79766.1| ribosomal protein S18 [Shigella flexneri 4343-70]
 gi|332761898|gb|EGJ92172.1| ribosomal protein S18 [Shigella flexneri 2747-71]
 gi|332763253|gb|EGJ93496.1| ribosomal protein S18 [Shigella flexneri 2930-71]
 gi|332991204|gb|AEF10187.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. UK-1]
 gi|333007702|gb|EGK27179.1| ribosomal protein S18 [Shigella flexneri VA-6]
 gi|333009033|gb|EGK28489.1| ribosomal protein S18 [Shigella flexneri K-218]
 gi|333011183|gb|EGK30597.1| ribosomal protein S18 [Shigella flexneri K-272]
 gi|333012623|gb|EGK32003.1| ribosomal protein S18 [Shigella flexneri K-227]
 gi|333022347|gb|EGK41585.1| ribosomal protein S18 [Shigella flexneri K-304]
          Length = 75

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|319789282|ref|YP_004150915.1| ribosomal protein S18 [Thermovibrio ammonificans HB-1]
 gi|317113784|gb|ADU96274.1| ribosomal protein S18 [Thermovibrio ammonificans HB-1]
          Length = 80

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          L +R    RRK C    +   RIDYK++ LL  F+S+RG+I+P RIS V  K QR+LA+A
Sbjct: 5  LPQRRFVRRRKYCKFCAEKIERIDYKNVELLKSFISERGRIIPRRISGVCSKHQRQLARA 64

Query: 69 IKRARYLGLIAYVNL 83
          +KRAR+L L+ +V +
Sbjct: 65 VKRARHLALLPFVKM 79


>gi|57239413|ref|YP_180549.1| 30S ribosomal protein S18 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58579385|ref|YP_197597.1| 30S ribosomal protein S18 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58617440|ref|YP_196639.1| 30S ribosomal protein S18 [Ehrlichia ruminantium str. Gardel]
 gi|75507479|sp|Q5FG28|RS18_EHRRG RecName: Full=30S ribosomal protein S18
 gi|81672777|sp|Q5HAJ5|RS18_EHRRW RecName: Full=30S ribosomal protein S18
 gi|57161492|emb|CAH58418.1| 30S ribosomal protein S18 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58417052|emb|CAI28165.1| 30S ribosomal protein S18 [Ehrlichia ruminantium str. Gardel]
 gi|58418011|emb|CAI27215.1| 30S ribosomal protein S18 [Ehrlichia ruminantium str.
          Welgevonden]
          Length = 95

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/77 (50%), Positives = 52/77 (67%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          +P   L+R    R K+CPL       IDYK+  LL++F S+ G+I+PSRI+SVS +KQR 
Sbjct: 19 SPLAYLKRPYFRRSKACPLEQCANEDIDYKNKALLSKFTSEYGRILPSRITSVSSRKQRL 78

Query: 65 LAKAIKRARYLGLIAYV 81
          L+ AIKRARYL L+ Y 
Sbjct: 79 LSTAIKRARYLALLPYC 95


>gi|304413760|ref|ZP_07395204.1| 30S ribosomal subunit protein S18 [Candidatus Regiella
          insecticola LSR1]
 gi|304283851|gb|EFL92245.1| 30S ribosomal subunit protein S18 [Candidatus Regiella
          insecticola LSR1]
          Length = 75

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGTLEIDYKDIVTLKNYITESGKIVPSRITGTCAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|116667427|pdb|2GY9|R Chain R, Structure Of The 30s Subunit Of A Pre-Translocational E.
          Coli Ribosome Obtained By Fitting Atomic Models For Rna
          And Protein Components Into Cryo-Em Map Emd-1056
 gi|116667479|pdb|2GYB|R Chain R, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli
          Ribosome Complex Obtained By Fitting Atomic Models For
          Rna And Protein Components Into Cryo-Em Map Emd-1143
          Length = 69

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 1  RRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLS 60

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 61 LLPYTD 66


>gi|33357895|pdb|1P6G|R Chain R, Real Space Refined Coordinates Of The 30s Subunit Fitted
          Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
          State Of E. Coli 70s Ribosome
 gi|33357972|pdb|1P87|R Chain R, Real Space Refined Coordinates Of The 30s Subunit Fitted
          Into The Low Resolution Cryo-Em Map Of The
          Initiation-Like State Of E. Coli 70s Ribosome
 gi|83754056|pdb|2AVY|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 30s Subunit Of One 70s Ribosome. The
          Entire Crystal Structure Contains Two 70s Ribosomes And
          Is Described In Remark 400.
 gi|83754112|pdb|2AW7|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 30s Subunit Of The Second 70s Ribosome.
          The Entire Crystal Structure Contains Two 70s Ribosomes
          And Is Described In Remark 400.
 gi|118138070|pdb|2I2P|R Chain R, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|118138141|pdb|2I2U|R Chain R, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|157836038|pdb|2QOU|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 30s Subunit Of The First 70s
          Ribosome, With Spectinomycin Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|157836085|pdb|2QOW|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 30s Subunit Of The Second 70s
          Ribosome, With Spectinomycin Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|157836142|pdb|2QOY|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 30s Subunit Of The
          First 70s Ribosome, With Spectinomycin And Neomycin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|157836189|pdb|2QP0|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 30s Subunit Of The
          Second 70s Ribosome, With Spectinomycin And Neomycin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|158429715|pdb|2QAL|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 30s Subunit Of The First 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429767|pdb|2QAN|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 30s Subunit Of The Second 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429825|pdb|2QB9|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 30s Subunit Of The First 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429877|pdb|2QBB|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 30s Subunit Of The Second 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429929|pdb|2QBD|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 30s Subunit Of The
          First 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429981|pdb|2QBF|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 30s Subunit Of The
          Second 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158430035|pdb|2QBH|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The First 70s Ribosome, With Gentamicin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes And Is Described In Remark 400.
 gi|158430088|pdb|2QBJ|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The Second 70s Ribosome, With Gentamicin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes And Is Described In Remark 400.
 gi|158431388|pdb|2Z4K|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The First 70s Ribosome, With Paromomycin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes And Is Described In Remark 400.
 gi|158431441|pdb|2Z4M|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The Second 70s Ribosome, With
          Paromomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|168988805|pdb|2VHO|R Chain R, Structure Of Pdf Binding Helix In Complex With The
          Ribosome (Part 3 Of 4)
 gi|168988826|pdb|2VHP|R Chain R, Structure Of Pdf Binding Helix In Complex With The
          Ribosome (Part 4 Of 4)
 gi|197107295|pdb|3DF1|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 30s Subunit Of The First 70s
          Ribosome, With Hygromycin B Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|197107347|pdb|3DF3|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 30s Subunit Of The Second 70s
          Ribosome, With Hygromycin B Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|329666009|pdb|3J00|R Chain R, Structure Of The Ribosome-Secye Complex In The Membrane
          Environment
          Length = 74

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 6  RRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLS 65

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 66 LLPYTD 71


>gi|21231018|ref|NP_636935.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|58582038|ref|YP_201054.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae
          KACC10331]
 gi|66768977|ref|YP_243739.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|84623950|ref|YP_451322.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|166711573|ref|ZP_02242780.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzicola
          BLS256]
 gi|188576349|ref|YP_001913278.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188992091|ref|YP_001904101.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris
          str. B100]
 gi|289663137|ref|ZP_06484718.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. vasculorum
          NCPPB702]
 gi|289669573|ref|ZP_06490648.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. musacearum
          NCPPB4381]
 gi|325915473|ref|ZP_08177787.1| SSU ribosomal protein S18P [Xanthomonas vesicatoria ATCC 35937]
 gi|325917961|ref|ZP_08180130.1| SSU ribosomal protein S18P [Xanthomonas vesicatoria ATCC 35937]
 gi|325922527|ref|ZP_08184288.1| SSU ribosomal protein S18P [Xanthomonas gardneri ATCC 19865]
 gi|23822129|sp|Q8PAC1|RS18_XANCP RecName: Full=30S ribosomal protein S18
 gi|75508188|sp|Q5H052|RS18_XANOR RecName: Full=30S ribosomal protein S18
 gi|81305059|sp|Q4UTA4|RS18_XANC8 RecName: Full=30S ribosomal protein S18
 gi|123739106|sp|Q2P329|RS18_XANOM RecName: Full=30S ribosomal protein S18
 gi|229560081|sp|B0RUY8|RS18_XANCB RecName: Full=30S ribosomal protein S18
 gi|229560082|sp|B2SIV1|RS18_XANOP RecName: Full=30S ribosomal protein S18
 gi|21112642|gb|AAM40859.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|58426632|gb|AAW75669.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae
          KACC10331]
 gi|66574309|gb|AAY49719.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|84367890|dbj|BAE69048.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|167733851|emb|CAP52057.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris]
 gi|188520801|gb|ACD58746.1| ribosomal protein S18 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|325535818|gb|EGD07645.1| SSU ribosomal protein S18P [Xanthomonas vesicatoria ATCC 35937]
 gi|325538355|gb|EGD10037.1| SSU ribosomal protein S18P [Xanthomonas vesicatoria ATCC 35937]
 gi|325546992|gb|EGD18085.1| SSU ribosomal protein S18P [Xanthomonas gardneri ATCC 19865]
          Length = 76

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L ++L++ GKIVPSR++    K QR+LA A+KR+R+L 
Sbjct: 7  RRKFCKFTAEGVKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSKYQRQLATAVKRSRFLA 66

Query: 77 LIAYVN 82
          LI Y +
Sbjct: 67 LIPYTD 72


>gi|330720458|gb|EGG98765.1| SSU ribosomal protein S18p [gamma proteobacterium IMCC2047]
          Length = 75

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G  +IDYKD+  L  F+++ GKIVPSRI+    + QR+LA AIKRARYL 
Sbjct: 7  RRKYCRFTAEGVDQIDYKDLDTLKGFVTETGKIVPSRITGTKARYQRQLATAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|290473411|ref|YP_003466277.1| 30S ribosomal subunit protein S18 [Xenorhabdus bovienii SS-2004]
 gi|289172710|emb|CBJ79481.1| 30S ribosomal subunit protein S18 [Xenorhabdus bovienii SS-2004]
          Length = 75

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVQEIDYKDIVTLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|117618475|ref|YP_855253.1| 30S ribosomal protein S18 [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|330831137|ref|YP_004394089.1| 30S ribosomal protein S18 [Aeromonas veronii B565]
 gi|166220920|sp|A0KG68|RS18_AERHH RecName: Full=30S ribosomal protein S18
 gi|117559882|gb|ABK36830.1| ribosomal protein S18 [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|328806273|gb|AEB51472.1| 30S ribosomal protein S18 [Aeromonas veronii B565]
          Length = 76

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAENVTEIDYKDIVTLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLA 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|15617154|ref|NP_240367.1| 30S ribosomal protein S18 [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
 gi|219681905|ref|YP_002468291.1| 30S ribosomal protein S18 [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|219682460|ref|YP_002468844.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Tuc7
          (Acyrthosiphon pisum)]
 gi|257471611|ref|ZP_05635610.1| 30S ribosomal protein S18 [Buchnera aphidicola str. LSR1
          (Acyrthosiphon pisum)]
 gi|11387089|sp|P57626|RS18_BUCAI RecName: Full=30S ribosomal protein S18
 gi|254765415|sp|B8D8C7|RS18_BUCA5 RecName: Full=30S ribosomal protein S18
 gi|254765416|sp|B8D884|RS18_BUCAT RecName: Full=30S ribosomal protein S18
 gi|25294830|pir||E84995 30S ribosomal protein S18 [imported] - Buchnera sp. (strain APS)
 gi|10039219|dbj|BAB13253.1| 30S ribosomal protein S18 [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
 gi|219622193|gb|ACL30349.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Tuc7
          (Acyrthosiphon pisum)]
 gi|219624748|gb|ACL30903.1| 30S ribosomal protein S18 [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|311086283|gb|ADP66365.1| 30S ribosomal protein S18 [Buchnera aphidicola str. LL01
          (Acyrthosiphon pisum)]
 gi|311086859|gb|ADP66940.1| 30S ribosomal protein S18 [Buchnera aphidicola str. TLW03
          (Acyrthosiphon pisum)]
 gi|311087447|gb|ADP67527.1| 30S ribosomal protein S18 [Buchnera aphidicola str. JF99
          (Acyrthosiphon pisum)]
 gi|311087935|gb|ADP68014.1| 30S ribosomal protein S18 [Buchnera aphidicola str. JF98
          (Acyrthosiphon pisum)]
          Length = 75

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 47/66 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI +L  ++++ GKIVPSRI+    K QR+L++AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVQEIDYKDIAVLKNYITESGKIVPSRITGTRAKYQRQLSRAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|254481140|ref|ZP_05094386.1| ribosomal protein S18 [marine gamma proteobacterium HTCC2148]
 gi|214038935|gb|EEB79596.1| ribosomal protein S18 [marine gamma proteobacterium HTCC2148]
          Length = 75

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L  ++S+ GKIVPSRI+    K QR+LA A+KRAR+L 
Sbjct: 7  RRKFCKFTAEGVKEIDYKDLETLKAYVSETGKIVPSRITGTKAKYQRQLATAVKRARFLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|54778771|gb|AAV39605.1| ribosomal protein S18 [synthetic construct]
          Length = 102

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 31 RRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLS 90

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 91 LLPYTD 96


>gi|50122532|ref|YP_051699.1| 30S ribosomal protein S18 [Pectobacterium atrosepticum SCRI1043]
 gi|227112366|ref|ZP_03826022.1| 30S ribosomal protein S18 [Pectobacterium carotovorum subsp.
          brasiliensis PBR1692]
 gi|253689795|ref|YP_003018985.1| ribosomal protein S18 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|261822827|ref|YP_003260933.1| 30S ribosomal protein S18 [Pectobacterium wasabiae WPP163]
 gi|59798691|sp|Q6D137|RS18_ERWCT RecName: Full=30S ribosomal protein S18
 gi|259494815|sp|C6DE13|RS18_PECCP RecName: Full=30S ribosomal protein S18
 gi|49613058|emb|CAG76509.1| 30S ribosomal protein S18 [Pectobacterium atrosepticum SCRI1043]
 gi|251756373|gb|ACT14449.1| ribosomal protein S18 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|261606840|gb|ACX89326.1| ribosomal protein S18 [Pectobacterium wasabiae WPP163]
          Length = 75

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|270160072|ref|ZP_06188728.1| ribosomal protein S18 [Legionella longbeachae D-4968]
 gi|289165147|ref|YP_003455285.1| 30S ribosomal subunit protein S18 [Legionella longbeachae NSW150]
 gi|269988411|gb|EEZ94666.1| ribosomal protein S18 [Legionella longbeachae D-4968]
 gi|288858320|emb|CBJ12188.1| 30S ribosomal subunit protein S18 [Legionella longbeachae NSW150]
          Length = 75

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 47/66 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  S +G   IDYKDI LL  ++S+ GKIVPSRI+    + QR+LA+AI +AR+LG
Sbjct: 7  RKKMCRFSAEGGNEIDYKDINLLKNYISETGKIVPSRITGTHTRFQRQLARAIMQARFLG 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYCD 72


>gi|73667308|ref|YP_303324.1| 30S ribosomal protein S18 [Ehrlichia canis str. Jake]
 gi|123773361|sp|Q3YRC9|RS18_EHRCJ RecName: Full=30S ribosomal protein S18
 gi|72394449|gb|AAZ68726.1| SSU ribosomal protein S18P [Ehrlichia canis str. Jake]
          Length = 95

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 52/77 (67%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          +P   L+R    R K+CPL       IDYK+  LL++F S+ G+I+PSRI+SVS +KQR 
Sbjct: 19 SPLAYLKRPYFKRSKACPLEQCPNEDIDYKNKTLLSKFTSEYGRILPSRITSVSSRKQRL 78

Query: 65 LAKAIKRARYLGLIAYV 81
          L+ A+KRARYL L+ Y 
Sbjct: 79 LSTAVKRARYLALLPYC 95


>gi|256821795|ref|YP_003145758.1| 30S ribosomal protein S18 [Kangiella koreensis DSM 16069]
 gi|256795334|gb|ACV25990.1| ribosomal protein S18 [Kangiella koreensis DSM 16069]
          Length = 75

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  S +G   IDYKD   L  ++++ GKIVPSRI+  S K QR+LA A+KRAR+L 
Sbjct: 7  RRKFCRFSAEGVVEIDYKDTATLKNYITETGKIVPSRITGTSAKYQRQLASAVKRARFLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|145297777|ref|YP_001140618.1| 30S ribosomal protein S18 [Aeromonas salmonicida subsp.
          salmonicida A449]
 gi|166220921|sp|A4SIZ8|RS18_AERS4 RecName: Full=30S ribosomal protein S18
 gi|142850549|gb|ABO88870.1| ribosomal protein S18 [Aeromonas salmonicida subsp. salmonicida
          A449]
          Length = 76

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAENVTEIDYKDIVTLKNYVTESGKIVPSRITGTRAKYQRQLARAIKRARYLA 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|238897794|ref|YP_002923473.1| 30S ribosomal subunit protein S18 [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
 gi|259494812|sp|C4K432|RS18_HAMD5 RecName: Full=30S ribosomal protein S18
 gi|229465551|gb|ACQ67325.1| 30S ribosomal subunit protein S18 [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
          Length = 85

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 47/66 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G  +IDYKDI +L  ++++ GKIVPSRI+    K QR+LA+AIK ARYL 
Sbjct: 7  RRKFCRFTAEGVKQIDYKDIIMLKNYITESGKIVPSRITGTCSKYQRQLAQAIKVARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|220934100|ref|YP_002512999.1| ribosomal protein S18 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254812963|sp|B8GNS3|RS18_THISH RecName: Full=30S ribosomal protein S18
 gi|219995410|gb|ACL72012.1| ribosomal protein S18 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 74

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+  S + QR+LA A+KRARYL 
Sbjct: 7  RRKYCRFTAEGVEFIDYKDLNTLKNYITETGKIVPSRITGTSARYQRQLATAVKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYCD 72


>gi|85058325|ref|YP_454027.1| 30S ribosomal protein S18 [Sodalis glossinidius str. 'morsitans']
 gi|123766478|sp|Q2NW53|RS18_SODGM RecName: Full=30S ribosomal protein S18
 gi|256032361|pdb|3E1A|K Chain K, Structure Of The 30s Subunit And The Trnas Of E. Coli
          Ribosome In Pre-Accommodation State
 gi|256032418|pdb|3E1C|K Chain K, Structure Of The 30s Subunit And The Trnas Of E. Coli
          Ribosome In Post-Accommodation State
 gi|84778845|dbj|BAE73622.1| 30S ribosomal protein S18 [Sodalis glossinidius str. 'morsitans']
          Length = 75

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTTEGVVEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|226226611|ref|YP_002760717.1| 30S ribosomal protein S18 [Gemmatimonas aurantiaca T-27]
 gi|226089802|dbj|BAH38247.1| 30S ribosomal protein S18 [Gemmatimonas aurantiaca T-27]
          Length = 73

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 48/65 (73%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K CP++  G   +DYKD RLL RF++  GKI+PSR+S V  + QR+L+KA+K+ARYL L
Sbjct: 5  KKPCPITEAGIRYVDYKDDRLLARFITDYGKILPSRLSGVDARHQRQLSKAVKKARYLAL 64

Query: 78 IAYVN 82
          + YV 
Sbjct: 65 LPYVK 69


>gi|319787275|ref|YP_004146750.1| ribosomal protein S18 [Pseudoxanthomonas suwonensis 11-1]
 gi|317465787|gb|ADV27519.1| ribosomal protein S18 [Pseudoxanthomonas suwonensis 11-1]
          Length = 76

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L ++L++ GKIVPSR++    + QR+L+ AIKRAR+L 
Sbjct: 7  RRKFCKFTAEGVKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSRYQRQLSTAIKRARFLA 66

Query: 77 LIAYVN 82
          LI Y +
Sbjct: 67 LIPYTD 72


>gi|15839149|ref|NP_299837.1| 30S ribosomal protein S18 [Xylella fastidiosa 9a5c]
 gi|11387104|sp|Q9PAF8|RS18_XYLFA RecName: Full=30S ribosomal protein S18
 gi|9107772|gb|AAF85357.1|AE004063_6 30S ribosomal protein S18 [Xylella fastidiosa 9a5c]
          Length = 76

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L ++L++ GKIVPSR++    K QR+L  A+KRAR+L 
Sbjct: 7  RRKFCKFTAEGIKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSKYQRQLTTAVKRARFLA 66

Query: 77 LIAYVN 82
          LI Y +
Sbjct: 67 LIPYTD 72


>gi|15804791|ref|NP_290832.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 EDL933]
 gi|12519193|gb|AAG59398.1|AE005652_15 30S ribosomal subunit protein S18 [Escherichia coli O157:H7 str.
          EDL933]
          Length = 75

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDY+DI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVQEIDYEDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|91775681|ref|YP_545437.1| 30S ribosomal protein S18 [Methylobacillus flagellatus KT]
 gi|123078871|sp|Q1H1P1|RS18_METFK RecName: Full=30S ribosomal protein S18
 gi|91709668|gb|ABE49596.1| SSU ribosomal protein S18P [Methylobacillus flagellatus KT]
          Length = 75

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 50/73 (68%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R++  RR+ C  S +G  ++DYKD+ LL  F+++ GKI+P+RI+    K QR+L  A+
Sbjct: 1  MARDMFKRRRYCRFSAEGIKQVDYKDVDLLKDFINENGKIIPARITGTKAKYQRQLTTAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|167948932|ref|ZP_02536006.1| 30S ribosomal protein S18 [Endoriftia persephone
          'Hot96_1+Hot96_2']
          Length = 74

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  + +G   IDYKD+ LL  ++S+ GKIVPSRI+    K QR+LA AIKRARYL 
Sbjct: 7  RKKYCRFTAEGITDIDYKDLNLLKAYVSESGKIVPSRITGTKAKYQRQLATAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYSD 72


>gi|198284526|ref|YP_002220847.1| 30S ribosomal protein S18 [Acidithiobacillus ferrooxidans ATCC
          53993]
 gi|218666634|ref|YP_002427193.1| ribosomal protein S18 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198249047|gb|ACH84640.1| ribosomal protein S18 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218518847|gb|ACK79433.1| ribosomal protein S18 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 92

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (66%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
          N + RRK C    +G   IDYKD++ L  ++ + GKIVPSRI+  S+  QR+L  AIKRA
Sbjct: 22 NFTRRRKFCRFRAEGVKEIDYKDLKTLQAYVGETGKIVPSRITGTSNLYQRQLTTAIKRA 81

Query: 73 RYLGLIAYV 81
          R+L L+ YV
Sbjct: 82 RFLALLPYV 90


>gi|116515284|ref|YP_802913.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Cc (Cinara
          cedri)]
 gi|122285320|sp|Q056X9|RS18_BUCCC RecName: Full=30S ribosomal protein S18
 gi|116257138|gb|ABJ90820.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Cc (Cinara
          cedri)]
          Length = 75

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G  +IDYKDI +L  ++++ GKIVPSRI+    K QR+L++AIK AR+LG
Sbjct: 7  RRKFCRFTAEGIKKIDYKDIMILKNYITENGKIVPSRITGTKAKYQRQLSRAIKIARFLG 66

Query: 77 LIAYVN 82
           I Y +
Sbjct: 67 FIPYTD 72


>gi|288554587|ref|YP_003426522.1| 30S ribosomal protein S18 [Bacillus pseudofirmus OF4]
 gi|288545747|gb|ADC49630.1| 30S ribosomal protein S18 [Bacillus pseudofirmus OF4]
          Length = 77

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (64%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR    RRK C  +     +IDYKD  LL RF+S+RGKI+P R++  S K QR+L  A
Sbjct: 1  MARRGRPKRRKVCFFTVNKITKIDYKDTDLLKRFISERGKILPRRVTGTSAKYQRQLTTA 60

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ YVN
Sbjct: 61 IKRARQIALLPYVN 74


>gi|94677019|ref|YP_589000.1| ribosomal protein S18 [Baumannia cicadellinicola str. Hc
          (Homalodisca coagulata)]
 gi|122988100|sp|Q1LSR4|RS18_BAUCH RecName: Full=30S ribosomal protein S18
 gi|94220169|gb|ABF14328.1| ribosomal protein S18 [Baumannia cicadellinicola str. Hc
          (Homalodisca coagulata)]
          Length = 75

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEDVIEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 67 LLPYTDL 73


>gi|240948272|ref|ZP_04752658.1| 30S ribosomal protein S18 [Actinobacillus minor NM305]
 gi|257465547|ref|ZP_05629918.1| 30S ribosomal protein S18 [Actinobacillus minor 202]
 gi|240297311|gb|EER47852.1| 30S ribosomal protein S18 [Actinobacillus minor NM305]
 gi|257451207|gb|EEV25250.1| 30S ribosomal protein S18 [Actinobacillus minor 202]
          Length = 75

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI  L  ++S+ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAENVVEIDYKDIATLKNYISENGKIVPSRITGTRAKYQRQLARAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|21672804|ref|NP_660871.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
 gi|25009169|sp|Q8K919|RS18_BUCAP RecName: Full=30S ribosomal protein S18
 gi|21623454|gb|AAM68082.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
          Length = 75

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI +L  ++++ GKIVPSRI+    K QR+L++AIK+ARYL 
Sbjct: 7  RRKFCRFTAEGIQEIDYKDIAMLKNYITENGKIVPSRITGTRAKFQRQLSRAIKKARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|307822879|ref|ZP_07653110.1| ribosomal protein S18 [Methylobacter tundripaludum SV96]
 gi|307736483|gb|EFO07329.1| ribosomal protein S18 [Methylobacter tundripaludum SV96]
          Length = 75

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 52/73 (71%), Gaps = 1/73 (1%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + RN+  R+K C  S +G  +IDYKD+ LL+ ++++ GKIVPSRI+  S K QR+L  AI
Sbjct: 1  MARNI-RRKKFCRFSAEGGTQIDYKDLDLLSDYITETGKIVPSRITGTSAKYQRQLGVAI 59

Query: 70 KRARYLGLIAYVN 82
          KRAR++ L+ + +
Sbjct: 60 KRARFIALLPFCD 72


>gi|68171814|ref|ZP_00545152.1| Ribosomal protein S18 [Ehrlichia chaffeensis str. Sapulpa]
 gi|88657819|ref|YP_507130.1| 30S ribosomal protein S18 [Ehrlichia chaffeensis str. Arkansas]
 gi|123722798|sp|Q2GHF3|RS18_EHRCR RecName: Full=30S ribosomal protein S18
 gi|67998763|gb|EAM85477.1| Ribosomal protein S18 [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599276|gb|ABD44745.1| putative ribosomal protein S18 [Ehrlichia chaffeensis str.
          Arkansas]
          Length = 95

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 52/77 (67%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          +P   L+R    R K+CPL       IDYK+  LL++F S+ G+I+PSRI+SVS +KQR 
Sbjct: 19 SPLAYLKRPYFKRSKACPLEQCPNEDIDYKNKGLLSKFTSEYGRILPSRITSVSSRKQRL 78

Query: 65 LAKAIKRARYLGLIAYV 81
          L+ A+KRARYL L+ Y 
Sbjct: 79 LSTAVKRARYLALLPYC 95


>gi|258546023|ref|ZP_05706257.1| 50S ribosomal protein L21 [Cardiobacterium hominis ATCC 15826]
 gi|258518752|gb|EEV87611.1| 50S ribosomal protein L21 [Cardiobacterium hominis ATCC 15826]
          Length = 70

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR+SC  + +G   IDYKD+  L  FL++ GKIVP+RI+  +   QR+LA AIKRAR+L 
Sbjct: 3  RRRSCRFTAEGVKEIDYKDLETLKAFLTETGKIVPARITGTNAFYQRQLATAIKRARFLA 62

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 63 LLPYSD 68


>gi|16272489|ref|NP_438703.1| 30S ribosomal protein S18 [Haemophilus influenzae Rd KW20]
 gi|32033888|ref|ZP_00134159.1| COG0238: Ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|33152179|ref|NP_873532.1| 30S ribosomal protein S18 [Haemophilus ducreyi 35000HP]
 gi|68249142|ref|YP_248254.1| 30S ribosomal protein S18 [Haemophilus influenzae 86-028NP]
 gi|145628926|ref|ZP_01784726.1| 30S ribosomal protein S18 [Haemophilus influenzae 22.1-21]
 gi|145630274|ref|ZP_01786055.1| 30S ribosomal protein S18 [Haemophilus influenzae R3021]
 gi|145633503|ref|ZP_01789232.1| 30S ribosomal protein S18 [Haemophilus influenzae 3655]
 gi|145635374|ref|ZP_01791076.1| 30S ribosomal protein S18 [Haemophilus influenzae PittAA]
 gi|145637414|ref|ZP_01793073.1| 30S ribosomal protein S18 [Haemophilus influenzae PittHH]
 gi|145638545|ref|ZP_01794154.1| 30S ribosomal protein S18 [Haemophilus influenzae PittII]
 gi|145640518|ref|ZP_01796102.1| 30S ribosomal protein S18 [Haemophilus influenzae R3021]
 gi|148825181|ref|YP_001289934.1| 30S ribosomal protein S18 [Haemophilus influenzae PittEE]
 gi|148827736|ref|YP_001292489.1| 30S ribosomal protein S18 [Haemophilus influenzae PittGG]
 gi|165976597|ref|YP_001652190.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|167855349|ref|ZP_02478116.1| 30S ribosomal protein S18 [Haemophilus parasuis 29755]
 gi|190150497|ref|YP_001969022.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|219871260|ref|YP_002475635.1| 30S ribosomal protein S18 [Haemophilus parasuis SH0165]
 gi|229844296|ref|ZP_04464436.1| 30S ribosomal protein S18 [Haemophilus influenzae 6P18H1]
 gi|229846628|ref|ZP_04466736.1| 30S ribosomal protein S18 [Haemophilus influenzae 7P49H1]
 gi|254361769|ref|ZP_04977904.1| ribosomal protein S18 [Mannheimia haemolytica PHL213]
 gi|260580992|ref|ZP_05848815.1| ribosomal protein S18 [Haemophilus influenzae RdAW]
 gi|260582751|ref|ZP_05850538.1| ribosomal protein S18 [Haemophilus influenzae NT127]
 gi|261494029|ref|ZP_05990532.1| 30S ribosomal protein S18 [Mannheimia haemolytica serotype A2
          str. BOVINE]
 gi|261496211|ref|ZP_05992617.1| 30S ribosomal protein S18 [Mannheimia haemolytica serotype A2
          str. OVINE]
 gi|303250080|ref|ZP_07336282.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|303253253|ref|ZP_07339402.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|307246085|ref|ZP_07528167.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|307250425|ref|ZP_07532372.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 4 str. M62]
 gi|307252810|ref|ZP_07534700.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|307257225|ref|ZP_07538996.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 10 str. D13039]
 gi|307259503|ref|ZP_07541228.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 11 str. 56153]
 gi|319775534|ref|YP_004138022.1| 30S ribosomal protein S18 [Haemophilus influenzae F3047]
 gi|319897938|ref|YP_004136135.1| 30S ribosomal protein s18 [Haemophilus influenzae F3031]
 gi|322515404|ref|ZP_08068396.1| 50S ribosomal protein L21 [Actinobacillus ureae ATCC 25976]
 gi|329122423|ref|ZP_08251010.1| 50S ribosomal protein L21 [Haemophilus aegyptius ATCC 11116]
 gi|54039411|sp|P66458|RS18_HAEDU RecName: Full=30S ribosomal protein S18
 gi|54042146|sp|P66457|RS18_HAEIN RecName: Full=30S ribosomal protein S18
 gi|81336451|sp|Q4QN03|RS18_HAEI8 RecName: Full=30S ribosomal protein S18
 gi|166220952|sp|A5U9V0|RS18_HAEIE RecName: Full=30S ribosomal protein S18
 gi|166220953|sp|A5UH50|RS18_HAEIG RecName: Full=30S ribosomal protein S18
 gi|229470504|sp|B3GY57|RS18_ACTP7 RecName: Full=30S ribosomal protein S18
 gi|229470509|sp|B0BQB1|RS18_ACTPJ RecName: Full=30S ribosomal protein S18
 gi|254812943|sp|B8F5T5|RS18_HAEPS RecName: Full=30S ribosomal protein S18
 gi|1573530|gb|AAC22203.1| ribosomal protein S18 (rpS18) [Haemophilus influenzae Rd KW20]
 gi|33148401|gb|AAP95921.1| 30S ribosomal protein S18 [Haemophilus ducreyi 35000HP]
 gi|68057341|gb|AAX87594.1| 30S ribosomal protein S18 [Haemophilus influenzae 86-028NP]
 gi|144979396|gb|EDJ89082.1| 30S ribosomal protein S18 [Haemophilus influenzae 22.1-21]
 gi|144984009|gb|EDJ91446.1| 30S ribosomal protein S18 [Haemophilus influenzae R3021]
 gi|144985872|gb|EDJ92480.1| 30S ribosomal protein S18 [Haemophilus influenzae 3655]
 gi|145267380|gb|EDK07382.1| 30S ribosomal protein S18 [Haemophilus influenzae PittAA]
 gi|145269360|gb|EDK09304.1| 30S ribosomal protein S18 [Haemophilus influenzae PittHH]
 gi|145272140|gb|EDK12048.1| 30S ribosomal protein S18 [Haemophilus influenzae PittII]
 gi|145275104|gb|EDK14966.1| 30S ribosomal protein S18 [Haemophilus influenzae 22.4-21]
 gi|148715341|gb|ABQ97551.1| 30S ribosomal protein S18 [Haemophilus influenzae PittEE]
 gi|148718978|gb|ABR00106.1| 30S ribosomal protein S18 [Haemophilus influenzae PittGG]
 gi|153093304|gb|EDN74300.1| ribosomal protein S18 [Mannheimia haemolytica PHL213]
 gi|165876698|gb|ABY69746.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|167853497|gb|EDS24744.1| 30S ribosomal protein S18 [Haemophilus parasuis 29755]
 gi|189915628|gb|ACE61880.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|219691464|gb|ACL32687.1| 30S ribosomal protein S18 [Haemophilus parasuis SH0165]
 gi|229810721|gb|EEP46439.1| 30S ribosomal protein S18 [Haemophilus influenzae 7P49H1]
 gi|229812545|gb|EEP48234.1| 30S ribosomal protein S18 [Haemophilus influenzae 6P18H1]
 gi|260092351|gb|EEW76291.1| ribosomal protein S18 [Haemophilus influenzae RdAW]
 gi|260094201|gb|EEW78102.1| ribosomal protein S18 [Haemophilus influenzae NT127]
 gi|261308163|gb|EEY09460.1| 30S ribosomal protein S18 [Mannheimia haemolytica serotype A2
          str. OVINE]
 gi|261310195|gb|EEY11395.1| 30S ribosomal protein S18 [Mannheimia haemolytica serotype A2
          str. BOVINE]
 gi|301169260|emb|CBW28857.1| 30S ribosomal subunit protein S18 [Haemophilus influenzae 10810]
 gi|302647935|gb|EFL78142.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|302651143|gb|EFL81297.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306853020|gb|EFM85243.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|306857554|gb|EFM89663.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 4 str. M62]
 gi|306859709|gb|EFM91732.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306864267|gb|EFM96179.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 10 str. D13039]
 gi|306866439|gb|EFM98302.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 11 str. 56153]
 gi|309750049|gb|ADO80033.1| 30S ribosomal subunit protein S18 [Haemophilus influenzae R2866]
 gi|309972304|gb|ADO95505.1| 30S ribosomal subunit protein S18 [Haemophilus influenzae R2846]
 gi|317433444|emb|CBY81827.1| 30S ribosomal protein S18 [Haemophilus influenzae F3031]
 gi|317450125|emb|CBY86339.1| 30S ribosomal protein S18 [Haemophilus influenzae F3047]
 gi|322118559|gb|EFX90791.1| 50S ribosomal protein L21 [Actinobacillus ureae ATCC 25976]
 gi|327473705|gb|EGF19124.1| 50S ribosomal protein L21 [Haemophilus aegyptius ATCC 11116]
          Length = 75

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI  L  ++S+ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAENVVEIDYKDIATLKNYISESGKIVPSRITGTRAKYQRQLARAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|56965862|ref|YP_177596.1| 30S ribosomal protein S18 [Bacillus clausii KSM-K16]
 gi|59798604|sp|Q5WAH5|RS18_BACSK RecName: Full=30S ribosomal protein S18
 gi|56912108|dbj|BAD66636.1| 30S ribosomal protein S18 [Bacillus clausii KSM-K16]
          Length = 77

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (64%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR    RRK C  +      IDYKD+ LL RF+S+RGKI+P R++  S K QR+L  A
Sbjct: 1  MARRGRPKRRKVCFFTANKITHIDYKDVDLLKRFISERGKILPRRVTGTSAKYQRKLTVA 60

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ YVN
Sbjct: 61 IKRARQVALLPYVN 74


>gi|152977671|ref|YP_001377188.1| 30S ribosomal protein S18 [Bacillus cereus subsp. cytotoxis NVH
          391-98]
 gi|189029666|sp|A7GVN5|RS18_BACCN RecName: Full=30S ribosomal protein S18
 gi|152026423|gb|ABS24193.1| ribosomal protein S18 [Bacillus cytotoxicus NVH 391-98]
          Length = 77

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (67%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + RRK C  +  G   IDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR 
Sbjct: 9  AKRRKVCFFTANGITHIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAIKRARQ 68

Query: 75 LGLIAYVN 82
          + L+ YV 
Sbjct: 69 MALLPYVG 76


>gi|197294287|ref|YP_001798828.1| 30S ribosomal protein S18 [Candidatus Phytoplasma australiense]
 gi|171853614|emb|CAM11485.1| 30S ribosomal protein S18 [Candidatus Phytoplasma australiense]
          Length = 78

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 53/77 (68%), Gaps = 4/77 (5%)

Query: 10 LRRNVSH----RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          +++N  H    RRK C  +     +ID+KDI LL +F+++RGKI+  RI++ S K QR+L
Sbjct: 1  MKKNKRHVFKKRRKVCYFTENKFSKIDFKDIELLKKFITERGKIISRRITNTSAKWQRQL 60

Query: 66 AKAIKRARYLGLIAYVN 82
          A AIKRAR++ LI+++ 
Sbjct: 61 AVAIKRARHMALISFIQ 77


>gi|262279563|ref|ZP_06057348.1| 30S ribosomal protein S18 [Acinetobacter calcoaceticus RUH2202]
 gi|262259914|gb|EEY78647.1| 30S ribosomal protein S18 [Acinetobacter calcoaceticus RUH2202]
          Length = 75

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI  L +++++ GKIVPSRI+    + QR+LA AIK+ARYL 
Sbjct: 7  RRKFCRFTAENVVYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQARYLS 66

Query: 77 LIAYVN 82
          LIAY +
Sbjct: 67 LIAYTD 72


>gi|88810600|ref|ZP_01125857.1| 30S ribosomal protein S18 [Nitrococcus mobilis Nb-231]
 gi|88792230|gb|EAR23340.1| 30S ribosomal protein S18 [Nitrococcus mobilis Nb-231]
          Length = 74

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+LA AIKRARYL 
Sbjct: 7  RRKYCRFTAEGVREIDYKDLNTLKSYVTETGKIVPSRITGTRAKYQRQLASAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|118594784|ref|ZP_01552131.1| 30S ribosomal protein S18 [Methylophilales bacterium HTCC2181]
 gi|118440562|gb|EAV47189.1| 30S ribosomal protein S18 [Methylophilales bacterium HTCC2181]
          Length = 75

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R +  RR+ C  S +G   +DYKDI LL  F+++ GK++P+RI+    K QR+L  A+
Sbjct: 1  MAREMYKRRRYCRFSAEGIKEVDYKDIDLLKDFITENGKLIPARITGTKSKYQRQLGTAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|22124560|ref|NP_667983.1| 30S ribosomal protein S18 [Yersinia pestis KIM 10]
 gi|45440398|ref|NP_991937.1| 30S ribosomal protein S18 [Yersinia pestis biovar Microtus str.
          91001]
 gi|51594792|ref|YP_068983.1| 30S ribosomal protein S18 [Yersinia pseudotuberculosis IP 32953]
 gi|108806085|ref|YP_650001.1| 30S ribosomal protein S18 [Yersinia pestis Antiqua]
 gi|108813441|ref|YP_649208.1| 30S ribosomal protein S18 [Yersinia pestis Nepal516]
 gi|123440775|ref|YP_001004767.1| 30S ribosomal protein S18 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|145600833|ref|YP_001164909.1| 30S ribosomal protein S18 [Yersinia pestis Pestoides F]
 gi|153949310|ref|YP_001402591.1| 30S ribosomal protein S18 [Yersinia pseudotuberculosis IP 31758]
 gi|153997314|ref|ZP_02022414.1| 30S ribosomal protein S18 [Yersinia pestis CA88-4125]
 gi|157368695|ref|YP_001476684.1| 30S ribosomal protein S18 [Serratia proteamaculans 568]
 gi|162420420|ref|YP_001605262.1| 30S ribosomal protein S18 [Yersinia pestis Angola]
 gi|165928152|ref|ZP_02223984.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165937415|ref|ZP_02225978.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str.
          IP275]
 gi|166011310|ref|ZP_02232208.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166213997|ref|ZP_02240032.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|167401213|ref|ZP_02306713.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167420501|ref|ZP_02312254.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167423736|ref|ZP_02315489.1| ribosomal protein S18 [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|170025997|ref|YP_001722502.1| 30S ribosomal protein S18 [Yersinia pseudotuberculosis YPIII]
 gi|186893801|ref|YP_001870913.1| 30S ribosomal protein S18 [Yersinia pseudotuberculosis PB1/+]
 gi|218930551|ref|YP_002348426.1| 30S ribosomal protein S18 [Yersinia pestis CO92]
 gi|229836651|ref|ZP_04456817.1| 30S ribosomal subunit protein S18 [Yersinia pestis Pestoides A]
 gi|229839191|ref|ZP_04459350.1| 30S ribosomal subunit protein S18 [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229899755|ref|ZP_04514896.1| 30S ribosomal subunit protein S18 [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229903917|ref|ZP_04519030.1| 30S ribosomal subunit protein S18 [Yersinia pestis Nepal516]
 gi|238750086|ref|ZP_04611589.1| 30S ribosomal protein S18 [Yersinia rohdei ATCC 43380]
 gi|238787555|ref|ZP_04631353.1| 30S ribosomal protein S18 [Yersinia frederiksenii ATCC 33641]
 gi|238792979|ref|ZP_04636608.1| 30S ribosomal protein S18 [Yersinia intermedia ATCC 29909]
 gi|261342859|ref|ZP_05970717.1| ribosomal protein S18 [Enterobacter cancerogenus ATCC 35316]
 gi|270265016|ref|ZP_06193279.1| 30S ribosomal protein S18 [Serratia odorifera 4Rx13]
 gi|270489093|ref|ZP_06206167.1| ribosomal protein S18 [Yersinia pestis KIM D27]
 gi|304396940|ref|ZP_07378820.1| ribosomal protein S18 [Pantoea sp. aB]
 gi|308188253|ref|YP_003932384.1| 30S ribosomal protein S18 [Pantoea vagans C9-1]
 gi|311281252|ref|YP_003943483.1| ribosomal protein S18 [Enterobacter cloacae SCF1]
 gi|322831171|ref|YP_004211198.1| ribosomal protein S18 [Rahnella sp. Y9602]
 gi|332160037|ref|YP_004296614.1| 30S ribosomal protein S18 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|20978696|sp|Q8ZB83|RS18_YERPE RecName: Full=30S ribosomal protein S18
 gi|59798666|sp|Q66FA0|RS18_YERPS RecName: Full=30S ribosomal protein S18
 gi|122979828|sp|Q1CBW6|RS18_YERPA RecName: Full=30S ribosomal protein S18
 gi|123246216|sp|Q1CEH2|RS18_YERPN RecName: Full=30S ribosomal protein S18
 gi|166222257|sp|A1JIT0|RS18_YERE8 RecName: Full=30S ribosomal protein S18
 gi|166222258|sp|A4TRM4|RS18_YERPP RecName: Full=30S ribosomal protein S18
 gi|167011194|sp|A8G8W6|RS18_SERP5 RecName: Full=30S ribosomal protein S18
 gi|167011195|sp|A7FMW3|RS18_YERP3 RecName: Full=30S ribosomal protein S18
 gi|229560085|sp|B2K2L5|RS18_YERPB RecName: Full=30S ribosomal protein S18
 gi|229560086|sp|A9QYL4|RS18_YERPG RecName: Full=30S ribosomal protein S18
 gi|229560087|sp|B1JMM2|RS18_YERPY RecName: Full=30S ribosomal protein S18
 gi|21957360|gb|AAM84234.1|AE013667_7 30S ribosomal subunit protein S18 [Yersinia pestis KIM 10]
 gi|45435255|gb|AAS60814.1| 30S ribosomal protein S18 [Yersinia pestis biovar Microtus str.
          91001]
 gi|51588074|emb|CAH19680.1| 30S ribosomal protein S18 [Yersinia pseudotuberculosis IP 32953]
 gi|108777089|gb|ABG19608.1| SSU ribosomal protein S18P [Yersinia pestis Nepal516]
 gi|108777998|gb|ABG12056.1| SSU ribosomal protein S18P [Yersinia pestis Antiqua]
 gi|115349162|emb|CAL22125.1| 30S ribosomal protein S18 [Yersinia pestis CO92]
 gi|122087736|emb|CAL10521.1| 30S ribosomal protein S18 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|145212529|gb|ABP41936.1| 30S ribosomal protein S18 [Yersinia pestis Pestoides F]
 gi|149288951|gb|EDM39031.1| 30S ribosomal protein S18 [Yersinia pestis CA88-4125]
 gi|152960805|gb|ABS48266.1| ribosomal protein S18 [Yersinia pseudotuberculosis IP 31758]
 gi|157320459|gb|ABV39556.1| ribosomal protein S18 [Serratia proteamaculans 568]
 gi|162353235|gb|ABX87183.1| ribosomal protein S18 [Yersinia pestis Angola]
 gi|165914520|gb|EDR33134.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str.
          IP275]
 gi|165919839|gb|EDR37140.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165989694|gb|EDR41995.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166204792|gb|EDR49272.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|166961307|gb|EDR57328.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167049238|gb|EDR60646.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167057906|gb|EDR67652.1| ribosomal protein S18 [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|169752531|gb|ACA70049.1| ribosomal protein S18 [Yersinia pseudotuberculosis YPIII]
 gi|186696827|gb|ACC87456.1| ribosomal protein S18 [Yersinia pseudotuberculosis PB1/+]
 gi|229679687|gb|EEO75790.1| 30S ribosomal subunit protein S18 [Yersinia pestis Nepal516]
 gi|229687247|gb|EEO79322.1| 30S ribosomal subunit protein S18 [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229695557|gb|EEO85604.1| 30S ribosomal subunit protein S18 [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229706335|gb|EEO92343.1| 30S ribosomal subunit protein S18 [Yersinia pestis Pestoides A]
 gi|238711630|gb|EEQ03845.1| 30S ribosomal protein S18 [Yersinia rohdei ATCC 43380]
 gi|238724342|gb|EEQ15984.1| 30S ribosomal protein S18 [Yersinia frederiksenii ATCC 33641]
 gi|238727579|gb|EEQ19104.1| 30S ribosomal protein S18 [Yersinia intermedia ATCC 29909]
 gi|270040950|gb|EFA14051.1| 30S ribosomal protein S18 [Serratia odorifera 4Rx13]
 gi|270337597|gb|EFA48374.1| ribosomal protein S18 [Yersinia pestis KIM D27]
 gi|288314902|gb|EFC53840.1| ribosomal protein S18 [Enterobacter cancerogenus ATCC 35316]
 gi|304355736|gb|EFM20103.1| ribosomal protein S18 [Pantoea sp. aB]
 gi|308058763|gb|ADO10935.1| 30S ribosomal protein S18 [Pantoea vagans C9-1]
 gi|308750447|gb|ADO50199.1| ribosomal protein S18 [Enterobacter cloacae SCF1]
 gi|318607403|emb|CBY28901.1| SSU ribosomal protein S18p [Yersinia enterocolitica subsp.
          palearctica Y11]
 gi|320013741|gb|ADV97312.1| 30S ribosomal subunit protein S18 [Yersinia pestis biovar
          Medievalis str. Harbin 35]
 gi|321166372|gb|ADW72071.1| ribosomal protein S18 [Rahnella sp. Y9602]
 gi|325664267|gb|ADZ40911.1| 30S ribosomal protein S18 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|330862079|emb|CBX72245.1| 30S ribosomal protein S18 [Yersinia enterocolitica W22703]
          Length = 75

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+ IKRARYL 
Sbjct: 7  RRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARCIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|292493500|ref|YP_003528939.1| ribosomal protein S18 [Nitrosococcus halophilus Nc4]
 gi|291582095|gb|ADE16552.1| ribosomal protein S18 [Nitrosococcus halophilus Nc4]
          Length = 74

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+L++A+KRARYL 
Sbjct: 7  RRKFCRFTAEGVKEIDYKDLATLKEYITETGKIVPSRITGTKAKYQRQLSRAVKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYCD 72


>gi|218514153|ref|ZP_03510993.1| 30S ribosomal protein S18 [Rhizobium etli 8C-3]
          Length = 55

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 1/56 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISS 56
          M+E +  P+ RR    RRK+CP SG  APRIDYKD+RLL R++S+RGKIVPSRI++
Sbjct: 1  MSEASSAPV-RRPFHRRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITA 55


>gi|52424526|ref|YP_087663.1| 30S ribosomal protein S18 [Mannheimia succiniciproducens MBEL55E]
 gi|113461579|ref|YP_719648.1| 30S ribosomal protein S18 [Haemophilus somnus 129PT]
 gi|152978437|ref|YP_001344066.1| 30S ribosomal protein S18 [Actinobacillus succinogenes 130Z]
 gi|170718759|ref|YP_001783944.1| 30S ribosomal protein S18 [Haemophilus somnus 2336]
 gi|332289560|ref|YP_004420412.1| 30S ribosomal protein S18 [Gallibacterium anatis UMN179]
 gi|59798655|sp|Q65VD2|RS18_MANSM RecName: Full=30S ribosomal protein S18
 gi|123132188|sp|Q0I4E7|RS18_HAES1 RecName: Full=30S ribosomal protein S18
 gi|171704224|sp|A6VMD4|RS18_ACTSZ RecName: Full=30S ribosomal protein S18
 gi|189029679|sp|B0US45|RS18_HAES2 RecName: Full=30S ribosomal protein S18
 gi|52306578|gb|AAU37078.1| RpsR protein [Mannheimia succiniciproducens MBEL55E]
 gi|112823622|gb|ABI25711.1| SSU ribosomal protein S18P [Haemophilus somnus 129PT]
 gi|150840160|gb|ABR74131.1| ribosomal protein S18 [Actinobacillus succinogenes 130Z]
 gi|168826888|gb|ACA32259.1| ribosomal protein S18 [Haemophilus somnus 2336]
 gi|330432456|gb|AEC17515.1| 30S ribosomal protein S18 [Gallibacterium anatis UMN179]
          Length = 75

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAENVVEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|238757533|ref|ZP_04618718.1| 30S ribosomal protein S18 [Yersinia aldovae ATCC 35236]
 gi|238764708|ref|ZP_04625652.1| 30S ribosomal protein S18 [Yersinia kristensenii ATCC 33638]
 gi|300715053|ref|YP_003739856.1| 30S ribosomal protein S18 [Erwinia billingiae Eb661]
 gi|238697104|gb|EEP89877.1| 30S ribosomal protein S18 [Yersinia kristensenii ATCC 33638]
 gi|238704295|gb|EEP96827.1| 30S ribosomal protein S18 [Yersinia aldovae ATCC 35236]
 gi|299060889|emb|CAX57996.1| 30S ribosomal protein S18 [Erwinia billingiae Eb661]
          Length = 75

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+ IKRARYL 
Sbjct: 7  RRKFCRFTAEGVVEIDYKDIATLKNYVTESGKIVPSRITGTRAKYQRQLARCIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|325295181|ref|YP_004281695.1| 30S ribosomal protein S18 [Desulfurobacterium thermolithotrophum
          DSM 11699]
 gi|325065629|gb|ADY73636.1| 30S ribosomal protein S18 [Desulfurobacterium thermolithotrophum
          DSM 11699]
          Length = 80

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 51/75 (68%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          L +R    RRK C    +   +IDYK++ LL  F+S+RG+I+P RIS V  K QR+LA+A
Sbjct: 5  LPQRRFVRRRKYCKFCAEKIEKIDYKNVELLKPFISERGRIIPRRISGVCSKHQRQLARA 64

Query: 69 IKRARYLGLIAYVNL 83
          +KRAR+L L+ +V +
Sbjct: 65 VKRARHLALLPFVKI 79


>gi|300721500|ref|YP_003710775.1| 30S ribosomal subunit protein S18 [Xenorhabdus nematophila ATCC
          19061]
 gi|297627992|emb|CBJ88541.1| 30S ribosomal subunit protein S18 [Xenorhabdus nematophila ATCC
          19061]
          Length = 75

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRAR+L 
Sbjct: 7  RRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARHLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|238783557|ref|ZP_04627579.1| 30S ribosomal protein S18 [Yersinia bercovieri ATCC 43970]
 gi|238715612|gb|EEQ07602.1| 30S ribosomal protein S18 [Yersinia bercovieri ATCC 43970]
          Length = 75

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+ IKRARYL 
Sbjct: 7  RRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRITGTRAKFQRQLARCIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|78485707|ref|YP_391632.1| ribosomal protein S18 [Thiomicrospira crunogena XCL-2]
 gi|123741575|sp|Q31FW5|RS18_THICR RecName: Full=30S ribosomal protein S18
 gi|78363993|gb|ABB41958.1| SSU ribosomal protein S18P [Thiomicrospira crunogena XCL-2]
          Length = 75

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  + +G   IDYKD+  L  ++++ GKIVPSRI+  S K QR+L+ AIKRARYL 
Sbjct: 7  RKKFCRFTVEGVKEIDYKDLDTLKSYITETGKIVPSRITGTSAKYQRQLSTAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|56708146|ref|YP_170042.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|110670617|ref|YP_667174.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|118497542|ref|YP_898592.1| 30S ribosomal protein S18 [Francisella tularensis subsp. novicida
          U112]
 gi|134301959|ref|YP_001121928.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis WY96-3418]
 gi|187931624|ref|YP_001891608.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          mediasiatica FSC147]
 gi|224457242|ref|ZP_03665715.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|254370630|ref|ZP_04986635.1| hypothetical protein [Francisella tularensis subsp. tularensis
          FSC033]
 gi|254372903|ref|ZP_04988392.1| 30S ribosomal protein S18 [Francisella tularensis subsp. novicida
          GA99-3549]
 gi|254374357|ref|ZP_04989839.1| hypothetical protein FTDG_00524 [Francisella novicida GA99-3548]
 gi|254874949|ref|ZP_05247659.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|81677050|sp|Q5NG00|RS18_FRATT RecName: Full=30S ribosomal protein S18
 gi|122970929|sp|Q14HF2|RS18_FRAT1 RecName: Full=30S ribosomal protein S18
 gi|205558096|sp|A0Q6H3|RS18_FRATN RecName: Full=30S ribosomal protein S18
 gi|205558144|sp|A4IY06|RS18_FRATW RecName: Full=30S ribosomal protein S18
 gi|56604638|emb|CAG45694.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|110320950|emb|CAL09077.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|118423448|gb|ABK89838.1| 30S ribosomal protein S18 [Francisella novicida U112]
 gi|134049736|gb|ABO46807.1| ribosomal protein S18 [Francisella tularensis subsp. tularensis
          WY96-3418]
 gi|151568873|gb|EDN34527.1| hypothetical protein FTBG_00419 [Francisella tularensis subsp.
          tularensis FSC033]
 gi|151570630|gb|EDN36284.1| 30S ribosomal protein S18 [Francisella novicida GA99-3549]
 gi|151572077|gb|EDN37731.1| hypothetical protein FTDG_00524 [Francisella novicida GA99-3548]
 gi|187712533|gb|ACD30830.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          mediasiatica FSC147]
 gi|254840948|gb|EET19384.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|282159352|gb|ADA78743.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis NE061598]
 gi|332184104|gb|AEE26358.1| SSU ribosomal protein S18p [Francisella cf. novicida 3523]
 gi|332678241|gb|AEE87370.1| SSU ribosomal protein S18p [Francisella cf. novicida Fx1]
          Length = 72

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L  ++++ GKIVPSR++  S K QR+LA AIKRAR+L 
Sbjct: 3  RRKVCRFTVEGVKEIDYKDVNKLKAYITETGKIVPSRVTGTSAKYQRQLATAIKRARFLA 62

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 63 LLPYCD 68


>gi|251793280|ref|YP_003008008.1| 30S ribosomal protein S18 [Aggregatibacter aphrophilus NJ8700]
 gi|261867098|ref|YP_003255020.1| 30S ribosomal protein S18 [Aggregatibacter actinomycetemcomitans
          D11S-1]
 gi|293390733|ref|ZP_06635067.1| ribosomal protein S18 [Aggregatibacter actinomycetemcomitans
          D7S-1]
 gi|315633585|ref|ZP_07888875.1| 50S ribosomal protein L21 [Aggregatibacter segnis ATCC 33393]
 gi|247534675|gb|ACS97921.1| ribosomal protein S18 [Aggregatibacter aphrophilus NJ8700]
 gi|261412430|gb|ACX81801.1| ribosomal protein S18 [Aggregatibacter actinomycetemcomitans
          D11S-1]
 gi|290951267|gb|EFE01386.1| ribosomal protein S18 [Aggregatibacter actinomycetemcomitans
          D7S-1]
 gi|315477627|gb|EFU68369.1| 50S ribosomal protein L21 [Aggregatibacter segnis ATCC 33393]
          Length = 76

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI  L  ++S+ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAENVVEIDYKDIATLKNYISESGKIVPSRITGTRAKYQRQLARAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYSD 72


>gi|16767639|ref|NP_463254.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|20978699|sp|Q8ZK81|RS18_SALTY RecName: Full=30S ribosomal protein S18
 gi|16422955|gb|AAL23213.1| 30S ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. LT2]
          Length = 75

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+L +AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLRRAIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|269959107|ref|YP_003328896.1| 30S ribosomal protein S18 [Anaplasma centrale str. Israel]
 gi|269848938|gb|ACZ49582.1| 30S ribosomal protein S18 [Anaplasma centrale str. Israel]
          Length = 96

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 56/80 (70%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          A  +P   L+R    + +SCPL+      IDYK+  LL++F+S+ G+I+PSRI+SVS KK
Sbjct: 17 AAHSPLVYLKRPYFRKSRSCPLAQCPDEDIDYKNRALLSKFVSEYGRILPSRITSVSSKK 76

Query: 62 QRELAKAIKRARYLGLIAYV 81
          Q+ LA+A+KRAR+L L+ Y 
Sbjct: 77 QKLLARAVKRARFLALLPYC 96


>gi|253999141|ref|YP_003051204.1| 30S ribosomal protein S18 [Methylovorus sp. SIP3-4]
 gi|313201242|ref|YP_004039900.1| 30S ribosomal protein S18 [Methylovorus sp. MP688]
 gi|253985820|gb|ACT50677.1| ribosomal protein S18 [Methylovorus sp. SIP3-4]
 gi|312440558|gb|ADQ84664.1| ribosomal protein S18 [Methylovorus sp. MP688]
          Length = 75

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 48/71 (67%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R++  RR+ C  S +G   +DYKD+ LL  F+++ GKI+P+RI+    + QR+L  A+KR
Sbjct: 3  RDMFKRRRYCRFSAEGIKEVDYKDVDLLKDFINENGKIIPARITGTKARYQRQLTTAVKR 62

Query: 72 ARYLGLIAYVN 82
          AR+L L+ Y +
Sbjct: 63 ARFLALLPYTD 73


>gi|325579200|ref|ZP_08149156.1| 50S ribosomal protein L21 [Haemophilus parainfluenzae ATCC 33392]
 gi|301155579|emb|CBW15047.1| 30S ribosomal subunit protein S18 [Haemophilus parainfluenzae
          T3T1]
 gi|325159435|gb|EGC71569.1| 50S ribosomal protein L21 [Haemophilus parainfluenzae ATCC 33392]
          Length = 76

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI  L  ++S+ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAENVVEIDYKDIATLKNYISESGKIVPSRITGTRAKYQRQLARAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYSD 72


>gi|15603043|ref|NP_246115.1| 30S ribosomal protein S18 [Pasteurella multocida subsp. multocida
          str. Pm70]
 gi|260912756|ref|ZP_05919242.1| 50S ribosomal protein L21 [Pasteurella dagmatis ATCC 43325]
 gi|13431845|sp|P57916|RS18_PASMU RecName: Full=30S ribosomal protein S18
 gi|12721529|gb|AAK03262.1| RpS18 [Pasteurella multocida subsp. multocida str. Pm70]
 gi|260633134|gb|EEX51299.1| 50S ribosomal protein L21 [Pasteurella dagmatis ATCC 43325]
          Length = 75

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKD+  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAENVVEIDYKDVATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|242243301|ref|ZP_04797746.1| 30S ribosomal protein S18 [Staphylococcus epidermidis W23144]
 gi|251811311|ref|ZP_04825784.1| 30S ribosomal protein S18 [Staphylococcus epidermidis
          BCM-HMP0060]
 gi|293367634|ref|ZP_06614286.1| 30S ribosomal protein S18 [Staphylococcus epidermidis
          M23864:W2(grey)]
 gi|242233250|gb|EES35562.1| 30S ribosomal protein S18 [Staphylococcus epidermidis W23144]
 gi|251805178|gb|EES57835.1| 30S ribosomal protein S18 [Staphylococcus epidermidis
          BCM-HMP0060]
 gi|291318204|gb|EFE58598.1| 30S ribosomal protein S18 [Staphylococcus epidermidis
          M23864:W2(grey)]
          Length = 88

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 21 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 80

Query: 78 IAYV 81
          + YV
Sbjct: 81 LPYV 84


>gi|254369338|ref|ZP_04985350.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica FSC022]
 gi|157122288|gb|EDO66428.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica FSC022]
          Length = 72

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L  ++++ GKIVPSR++  S K QR+LA AIKRAR+L 
Sbjct: 3  RRKVCRFTVEGVKEIDYKDVNKLKAYITETGKIVPSRVTGTSAKYQRQLATAIKRARFLA 62

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 63 LLPYYD 68


>gi|82703070|ref|YP_412636.1| 30S ribosomal protein S18 [Nitrosospira multiformis ATCC 25196]
 gi|123768178|sp|Q2Y7M7|RS18_NITMU RecName: Full=30S ribosomal protein S18
 gi|82411135|gb|ABB75244.1| SSU ribosomal protein S18P [Nitrosospira multiformis ATCC 25196]
          Length = 94

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  RRK C  + +G   +DYKDI LL  F+++ GKI+P+RI+    + QR+L+ A++R
Sbjct: 22 RPLFKRRKFCRFTAEGIKTVDYKDIELLKDFINENGKIIPARITGTKSRYQRQLSTAVER 81

Query: 72 ARYLGLIAYVNL 83
          AR+L L+ Y +L
Sbjct: 82 ARFLALLPYTDL 93


>gi|15618861|ref|NP_225147.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae CWL029]
 gi|15836485|ref|NP_301009.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae J138]
 gi|16752078|ref|NP_445444.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae AR39]
 gi|33242320|ref|NP_877261.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae TW-183]
 gi|6707742|sp|Q9Z6V4|RS18_CHLPN RecName: Full=30S ribosomal protein S18
 gi|4377277|gb|AAD19090.1| S18 Ribosomal Protein [Chlamydophila pneumoniae CWL029]
 gi|7189819|gb|AAF38692.1| ribosomal protein S18 [Chlamydophila pneumoniae AR39]
 gi|8979326|dbj|BAA99160.1| S18 ribosomal protein [Chlamydophila pneumoniae J138]
 gi|33236831|gb|AAP98918.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae TW-183]
 gi|269302744|gb|ACZ32844.1| ribosomal protein S18 [Chlamydophila pneumoniae LPCoLN]
          Length = 82

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 49/73 (67%), Gaps = 4/73 (5%)

Query: 13 NVSHRRK----SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          N  HRRK     CP    G   IDYKD+  L +F+++RGK++P RI+ VS + Q  L++A
Sbjct: 7  NNEHRRKRFNKKCPFVSAGWKTIDYKDVETLKKFITERGKVLPRRITGVSSRFQGVLSQA 66

Query: 69 IKRARYLGLIAYV 81
          IKRAR+LGL+ +V
Sbjct: 67 IKRARHLGLLPFV 79


>gi|289551779|ref|YP_003472683.1| SSU ribosomal protein S18p [Staphylococcus lugdunensis HKU09-01]
 gi|315660049|ref|ZP_07912907.1| 30S ribosomal protein S18 [Staphylococcus lugdunensis M23590]
 gi|289181310|gb|ADC88555.1| SSU ribosomal protein S18p [Staphylococcus lugdunensis HKU09-01]
 gi|315494950|gb|EFU83287.1| 30S ribosomal protein S18 [Staphylococcus lugdunensis M23590]
          Length = 80

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|239828694|ref|YP_002951318.1| 30S ribosomal protein S18 [Geobacillus sp. WCH70]
 gi|295402141|ref|ZP_06812100.1| ribosomal protein S18 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312112738|ref|YP_003991054.1| ribosomal protein S18 [Geobacillus sp. Y4.1MC1]
 gi|259494811|sp|C5D9X4|RS18_GEOSW RecName: Full=30S ribosomal protein S18
 gi|239808987|gb|ACS26052.1| ribosomal protein S18 [Geobacillus sp. WCH70]
 gi|294975824|gb|EFG51443.1| ribosomal protein S18 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311217839|gb|ADP76443.1| ribosomal protein S18 [Geobacillus sp. Y4.1MC1]
          Length = 78

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 46/67 (68%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + RRK C  +  G   IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR 
Sbjct: 9  AKRRKVCYFTANGITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQ 68

Query: 75 LGLIAYV 81
          + L+ YV
Sbjct: 69 MALLPYV 75


>gi|27469288|ref|NP_765925.1| 30S ribosomal protein S18 [Staphylococcus epidermidis ATCC 12228]
 gi|57865985|ref|YP_187646.1| 30S ribosomal protein S18 [Staphylococcus epidermidis RP62A]
 gi|223043454|ref|ZP_03613500.1| ribosomal protein S18 [Staphylococcus capitis SK14]
 gi|242372656|ref|ZP_04818230.1| 30S ribosomal protein S18 [Staphylococcus epidermidis M23864:W1]
 gi|282874664|ref|ZP_06283546.1| ribosomal protein S18 [Staphylococcus epidermidis SK135]
 gi|314935023|ref|ZP_07842382.1| ribosomal protein S18 [Staphylococcus caprae C87]
 gi|38258566|sp|Q8CQP6|RS18_STAES RecName: Full=30S ribosomal protein S18
 gi|71153728|sp|Q5HRZ3|RS18_STAEQ RecName: Full=30S ribosomal protein S18
 gi|27316838|gb|AAO06013.1|AE016752_46 30S ribosomal protein S18 [Staphylococcus epidermidis ATCC 12228]
 gi|57636643|gb|AAW53431.1| ribosomal protein S18 [Staphylococcus epidermidis RP62A]
 gi|222443243|gb|EEE49342.1| ribosomal protein S18 [Staphylococcus capitis SK14]
 gi|242349573|gb|EES41174.1| 30S ribosomal protein S18 [Staphylococcus epidermidis M23864:W1]
 gi|281296588|gb|EFA89100.1| ribosomal protein S18 [Staphylococcus epidermidis SK135]
 gi|313652953|gb|EFS16716.1| ribosomal protein S18 [Staphylococcus caprae C87]
 gi|319399801|gb|EFV88049.1| ribosomal protein S18 [Staphylococcus epidermidis FRI909]
 gi|329723856|gb|EGG60383.1| ribosomal protein S18 [Staphylococcus epidermidis VCU144]
 gi|329734384|gb|EGG70698.1| ribosomal protein S18 [Staphylococcus epidermidis VCU028]
 gi|329736079|gb|EGG72352.1| ribosomal protein S18 [Staphylococcus epidermidis VCU045]
          Length = 80

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|88606855|ref|YP_504776.1| 30S ribosomal protein S18 [Anaplasma phagocytophilum HZ]
 gi|123736454|sp|Q2GLH5|RS18_ANAPZ RecName: Full=30S ribosomal protein S18
 gi|88597918|gb|ABD43388.1| ribosomal protein S18 [Anaplasma phagocytophilum HZ]
          Length = 96

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P   L+R    + +SCPL+      IDYK+  LL++F+S+ G+I+PSRI+SVS +KQ+ L
Sbjct: 21 PLVYLKRPYFRKSRSCPLAQCPDEDIDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLL 80

Query: 66 AKAIKRARYLGLIAYV 81
          A+AIKRARYL L+ Y 
Sbjct: 81 ARAIKRARYLALLPYC 96


>gi|70727625|ref|YP_254541.1| 30S ribosomal protein S18 [Staphylococcus haemolyticus JCSC1435]
 gi|228474191|ref|ZP_04058928.1| ribosomal protein S18 [Staphylococcus hominis SK119]
 gi|314935171|ref|ZP_07842524.1| ribosomal protein S18 [Staphylococcus hominis subsp. hominis C80]
 gi|123762271|sp|Q4L342|RS18_STAHJ RecName: Full=30S ribosomal protein S18
 gi|68448351|dbj|BAE05935.1| 30S ribosomal protein S18 [Staphylococcus haemolyticus JCSC1435]
 gi|228271886|gb|EEK13223.1| ribosomal protein S18 [Staphylococcus hominis SK119]
 gi|313656506|gb|EFS20245.1| ribosomal protein S18 [Staphylococcus hominis subsp. hominis C80]
          Length = 80

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|46447225|ref|YP_008590.1| ribosomal protein S18 [Candidatus Protochlamydia amoebophila
          UWE25]
 gi|59798733|sp|Q6MAT4|RS18_PARUW RecName: Full=30S ribosomal protein S18
 gi|46400866|emb|CAF24315.1| probable ribosomal protein S18 [Candidatus Protochlamydia
          amoebophila UWE25]
          Length = 86

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S +RK CP +  G   IDYKDI  L +F+++RGKI+P RI+ VS   Q++L  AIKRAR+
Sbjct: 17 SKKRKRCPFTAAGIREIDYKDIDTLTKFITERGKILPRRITGVSAYHQKKLTAAIKRARH 76

Query: 75 LGLIAYV 81
          + L+ +V
Sbjct: 77 VALLPFV 83


>gi|192362397|ref|YP_001983436.1| 30S ribosomal protein S18 [Cellvibrio japonicus Ueda107]
 gi|229559974|sp|B3PCS1|RS18_CELJU RecName: Full=30S ribosomal protein S18
 gi|190688562|gb|ACE86240.1| ribosomal protein S18 [Cellvibrio japonicus Ueda107]
          Length = 75

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  RIDYKDI  L  ++++ GKIVPSRI+    K QR+LA AIKRARYL LI Y +
Sbjct: 14 TAEGTKRIDYKDIETLKAYITETGKIVPSRITGTKAKYQRQLATAIKRARYLALIPYTD 72


>gi|222474849|ref|YP_002563264.1| small subunit ribosomal protein S18 (rpsR) [Anaplasma marginale
           str. Florida]
 gi|254994706|ref|ZP_05276896.1| 30S ribosomal protein S18 [Anaplasma marginale str. Mississippi]
 gi|255002819|ref|ZP_05277783.1| 30S ribosomal protein S18 [Anaplasma marginale str. Puerto Rico]
 gi|255003952|ref|ZP_05278753.1| 30S ribosomal protein S18 [Anaplasma marginale str. Virginia]
 gi|222418985|gb|ACM49008.1| small subunit ribosomal protein S18 (rpsR) [Anaplasma marginale
           str. Florida]
          Length = 100

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 55/77 (71%)

Query: 5   APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
           +P   L+R    + +SCPL+      IDYK+  LL++F+S+ G+I+PSRI+SVS +KQ+ 
Sbjct: 24  SPLVYLKRPYFRKSRSCPLAQCPDEDIDYKNRALLSKFVSEYGRILPSRITSVSSRKQKL 83

Query: 65  LAKAIKRARYLGLIAYV 81
           LA+A+KRAR+L L+ Y 
Sbjct: 84  LARAVKRARFLALLPYC 100


>gi|238650507|ref|YP_002916359.1| 30S ribosomal protein S18 [Rickettsia peacockii str. Rustic]
 gi|259494818|sp|C4K160|RS18_RICPU RecName: Full=30S ribosomal protein S18
 gi|238624605|gb|ACR47311.1| 30S ribosomal protein S18 [Rickettsia peacockii str. Rustic]
          Length = 95

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (73%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK AR L 
Sbjct: 27 RRKGCPLSVSNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILA 86

Query: 77 LIAYV 81
          L+ +V
Sbjct: 87 LLPFV 91


>gi|167627911|ref|YP_001678411.1| 30S ribosomal protein S18 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|241668463|ref|ZP_04756041.1| 30S ribosomal protein S18 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|254876997|ref|ZP_05249707.1| 30S ribosomal protein S18 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|205557713|sp|B0U080|RS18_FRAP2 RecName: Full=30S ribosomal protein S18
 gi|167597912|gb|ABZ87910.1| 30S ribosomal protein S18 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|254843018|gb|EET21432.1| 30S ribosomal protein S18 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
          Length = 72

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  +  G   IDYKD+  L  ++++ GKIVPSR++  S K QR+LA AIKRAR+L 
Sbjct: 3  RRKVCRFTVDGVKEIDYKDVNKLKAYITETGKIVPSRVTGTSAKYQRQLATAIKRARFLA 62

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 63 LLPYCD 68


>gi|91204936|ref|YP_537291.1| 30S ribosomal protein S18 [Rickettsia bellii RML369-C]
 gi|157827736|ref|YP_001496800.1| 30S ribosomal protein S18 [Rickettsia bellii OSU 85-389]
 gi|123084595|sp|Q1RKB2|RS18_RICBR RecName: Full=30S ribosomal protein S18
 gi|166220983|sp|A8GY13|RS18_RICB8 RecName: Full=30S ribosomal protein S18
 gi|91068480|gb|ABE04202.1| 30S ribosomal protein S18 [Rickettsia bellii RML369-C]
 gi|157803040|gb|ABV79763.1| 30S ribosomal protein S18 [Rickettsia bellii OSU 85-389]
          Length = 94

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (73%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK AR L 
Sbjct: 26 RRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILA 85

Query: 77 LIAYV 81
          L+ +V
Sbjct: 86 LLPFV 90


>gi|115314809|ref|YP_763532.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica OSU18]
 gi|122325175|sp|Q0BLY9|RS18_FRATO RecName: Full=30S ribosomal protein S18
 gi|115129708|gb|ABI82895.1| ribosomal protein S18 [Francisella tularensis subsp. holarctica
          OSU18]
          Length = 72

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L  ++++ GKIVPSR++  S K QR+LA AIKRAR+L 
Sbjct: 3  RRKVCRFTVEGVKEIDYKDVNKLKAYINETGKIVPSRVTGTSAKYQRQLATAIKRARFLA 62

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 63 LLPYCD 68


>gi|15605536|ref|NP_220322.1| 30S ribosomal protein S18 [Chlamydia trachomatis D/UW-3/CX]
 gi|76789545|ref|YP_328631.1| 30S ribosomal protein S18 [Chlamydia trachomatis A/HAR-13]
 gi|166154144|ref|YP_001654262.1| 30S ribosomal protein S18 [Chlamydia trachomatis 434/Bu]
 gi|166155019|ref|YP_001653274.1| 30S ribosomal protein S18 [Chlamydia trachomatis
          L2b/UCH-1/proctitis]
 gi|237803233|ref|YP_002888427.1| 30S ribosomal protein S18 [Chlamydia trachomatis B/Jali20/OT]
 gi|237805154|ref|YP_002889308.1| 30S ribosomal protein S18 [Chlamydia trachomatis B/TZ1A828/OT]
 gi|255311638|ref|ZP_05354208.1| 30S ribosomal protein S18 [Chlamydia trachomatis 6276]
 gi|255317939|ref|ZP_05359185.1| 30S ribosomal protein S18 [Chlamydia trachomatis 6276s]
 gi|255349202|ref|ZP_05381209.1| 30S ribosomal protein S18 [Chlamydia trachomatis 70]
 gi|255503739|ref|ZP_05382129.1| 30S ribosomal protein S18 [Chlamydia trachomatis 70s]
 gi|255507420|ref|ZP_05383059.1| 30S ribosomal protein S18 [Chlamydia trachomatis D(s)2923]
 gi|301335384|ref|ZP_07223628.1| 30S ribosomal protein S18 [Chlamydia trachomatis L2tet1]
 gi|6831541|sp|O84808|RS18_CHLTR RecName: Full=30S ribosomal protein S18
 gi|123606576|sp|Q3KKN9|RS18_CHLTA RecName: Full=30S ribosomal protein S18
 gi|229559975|sp|B0B929|RS18_CHLT2 RecName: Full=30S ribosomal protein S18
 gi|229559976|sp|B0BAQ8|RS18_CHLTB RecName: Full=30S ribosomal protein S18
 gi|3329268|gb|AAC68397.1| S18 Ribosomal Protein [Chlamydia trachomatis D/UW-3/CX]
 gi|76168075|gb|AAX51083.1| SSU ribosomal protein S18P [Chlamydia trachomatis A/HAR-13]
 gi|165930132|emb|CAP03616.1| SSU ribosomal protein S18 [Chlamydia trachomatis 434/Bu]
 gi|165931007|emb|CAP06570.1| SSU ribosomal protein S18 [Chlamydia trachomatis
          L2b/UCH-1/proctitis]
 gi|231273454|emb|CAX10369.1| SSU ribosomal protein S18 [Chlamydia trachomatis B/TZ1A828/OT]
 gi|231274467|emb|CAX11262.1| SSU ribosomal protein S18 [Chlamydia trachomatis B/Jali20/OT]
 gi|289525847|emb|CBJ15328.1| SSU ribosomal protein S18 [Chlamydia trachomatis Sweden2]
 gi|296435429|gb|ADH17607.1| 30S ribosomal protein S18 [Chlamydia trachomatis E/150]
 gi|296436353|gb|ADH18527.1| 30S ribosomal protein S18 [Chlamydia trachomatis G/9768]
 gi|296437284|gb|ADH19454.1| 30S ribosomal protein S18 [Chlamydia trachomatis G/11222]
 gi|296438212|gb|ADH20373.1| 30S ribosomal protein S18 [Chlamydia trachomatis G/11074]
 gi|296439146|gb|ADH21299.1| 30S ribosomal protein S18 [Chlamydia trachomatis E/11023]
 gi|297140713|gb|ADH97471.1| 30S ribosomal protein S18 [Chlamydia trachomatis G/9301]
 gi|297748930|gb|ADI51476.1| SSU ribosomal protein S18P [Chlamydia trachomatis D-EC]
 gi|297749810|gb|ADI52488.1| SSU ribosomal protein S18P [Chlamydia trachomatis D-LC]
          Length = 81

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 48/72 (66%), Gaps = 4/72 (5%)

Query: 15 SHRRK----SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
           HRRK     CP    G   IDYKD+  L RF+++RGKI+P RI+ VS + Q  LA+A+K
Sbjct: 8  EHRRKRFAKKCPFVSAGWKTIDYKDVTTLKRFITERGKILPRRITGVSSRFQALLAQAVK 67

Query: 71 RARYLGLIAYVN 82
          RAR++GL+ +V 
Sbjct: 68 RARHVGLLPFVG 79


>gi|239637255|ref|ZP_04678243.1| ribosomal protein S18 [Staphylococcus warneri L37603]
 gi|239597211|gb|EEQ79720.1| ribosomal protein S18 [Staphylococcus warneri L37603]
 gi|330685075|gb|EGG96742.1| ribosomal protein S18 [Staphylococcus epidermidis VCU121]
          Length = 80

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTAAIKRARHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|157825190|ref|YP_001492910.1| 30S ribosomal protein S18 [Rickettsia akari str. Hartford]
 gi|166220982|sp|A8GLX7|RS18_RICAH RecName: Full=30S ribosomal protein S18
 gi|157799148|gb|ABV74402.1| 30S ribosomal protein S18 [Rickettsia akari str. Hartford]
          Length = 95

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (73%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK AR L 
Sbjct: 27 RRKGCPLSVHNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILA 86

Query: 77 LIAYV 81
          L+ +V
Sbjct: 87 LLPFV 91


>gi|15603919|ref|NP_220434.1| 30S ribosomal protein S18 [Rickettsia prowazekii str. Madrid E]
 gi|6226086|sp|Q9ZEA5|RS18_RICPR RecName: Full=30S ribosomal protein S18
 gi|3860610|emb|CAA14511.1| 30S RIBOSOMAL PROTEIN S18 (rpsR) [Rickettsia prowazekii]
 gi|292571636|gb|ADE29551.1| 30S ribosomal protein S18 [Rickettsia prowazekii Rp22]
          Length = 95

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (73%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK AR L 
Sbjct: 27 RRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILA 86

Query: 77 LIAYV 81
          L+ +V
Sbjct: 87 LLPFV 91


>gi|229586275|ref|YP_002844776.1| 30S ribosomal protein S18 [Rickettsia africae ESF-5]
 gi|259494817|sp|C3PM73|RS18_RICAE RecName: Full=30S ribosomal protein S18
 gi|228021325|gb|ACP53033.1| 30S ribosomal protein S18 [Rickettsia africae ESF-5]
          Length = 95

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (73%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK AR L 
Sbjct: 27 RRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILA 86

Query: 77 LIAYV 81
          L+ +V
Sbjct: 87 LLPFV 91


>gi|27904981|ref|NP_778107.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Bp (Baizongia
          pistaciae)]
 gi|29611842|sp|P59502|RS18_BUCBP RecName: Full=30S ribosomal protein S18
 gi|27904379|gb|AAO27212.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Bp (Baizongia
          pistaciae)]
          Length = 75

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKD+ +L  ++++ GKIVPSRI+  S + QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTVEKIKEIDYKDLSMLKNYITESGKIVPSRITGTSARYQRQLARAIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|157803227|ref|YP_001491776.1| 30S ribosomal protein S18 [Rickettsia canadensis str. McKiel]
 gi|166220984|sp|A8EXA8|RS18_RICCK RecName: Full=30S ribosomal protein S18
 gi|157784490|gb|ABV72991.1| 30S ribosomal protein S18 [Rickettsia canadensis str. McKiel]
          Length = 95

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (73%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK AR L 
Sbjct: 27 RRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILA 86

Query: 77 LIAYV 81
          L+ +V
Sbjct: 87 LLPFV 91


>gi|51473301|ref|YP_067058.1| 30S ribosomal protein S18 [Rickettsia typhi str. Wilmington]
 gi|59798674|sp|Q68XR6|RS18_RICTY RecName: Full=30S ribosomal protein S18
 gi|51459613|gb|AAU03576.1| 30S ribosomal protein S18 [Rickettsia typhi str. Wilmington]
          Length = 95

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (73%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK AR L 
Sbjct: 27 RRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILA 86

Query: 77 LIAYV 81
          L+ +V
Sbjct: 87 LLPFV 91


>gi|15891988|ref|NP_359702.1| 30S ribosomal protein S18 [Rickettsia conorii str. Malish 7]
 gi|34580977|ref|ZP_00142457.1| 30S ribosomal protein S18 [Rickettsia sibirica 246]
 gi|157827936|ref|YP_001494178.1| 30S ribosomal protein S18 [Rickettsia rickettsii str. 'Sheila
          Smith']
 gi|165932624|ref|YP_001649413.1| 30S ribosomal protein S18 [Rickettsia rickettsii str. Iowa]
 gi|20140122|sp|Q92JK2|RS18_RICCN RecName: Full=30S ribosomal protein S18
 gi|166220985|sp|A8GQJ5|RS18_RICRS RecName: Full=30S ribosomal protein S18
 gi|189029685|sp|B0BVY1|RS18_RICRO RecName: Full=30S ribosomal protein S18
 gi|15619102|gb|AAL02603.1| 30S ribosomal protein S18 [Rickettsia conorii str. Malish 7]
 gi|28262362|gb|EAA25866.1| 30S ribosomal protein S18 [Rickettsia sibirica 246]
 gi|157800417|gb|ABV75670.1| 30S ribosomal protein S18 [Rickettsia rickettsii str. 'Sheila
          Smith']
 gi|165907711|gb|ABY72007.1| SSU ribosomal protein S18P [Rickettsia rickettsii str. Iowa]
          Length = 95

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (73%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK AR L 
Sbjct: 27 RRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILA 86

Query: 77 LIAYV 81
          L+ +V
Sbjct: 87 LLPFV 91


>gi|224475522|ref|YP_002633128.1| 30S ribosomal protein S18 [Staphylococcus carnosus subsp.
          carnosus TM300]
 gi|254812955|sp|B9DIC0|RS18_STACT RecName: Full=30S ribosomal protein S18
 gi|222420129|emb|CAL26943.1| 30S ribosomal protein S18 [Staphylococcus carnosus subsp.
          carnosus TM300]
          Length = 80

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTDLLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|67458534|ref|YP_246158.1| 30S ribosomal protein S18 [Rickettsia felis URRWXCal2]
 gi|75536999|sp|Q4UN65|RS18_RICFE RecName: Full=30S ribosomal protein S18
 gi|67004067|gb|AAY60993.1| 30S ribosomal protein S18 [Rickettsia felis URRWXCal2]
          Length = 95

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (73%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK AR L 
Sbjct: 27 RRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILA 86

Query: 77 LIAYV 81
          L+ +V
Sbjct: 87 LLPFV 91


>gi|13358116|ref|NP_078390.1| ribosomal protein S18 [Ureaplasma parvum serovar 3 str. ATCC
          700970]
 gi|167971294|ref|ZP_02553571.1| ribosomal protein S18 [Ureaplasma parvum serovar 6 str. ATCC
          27818]
 gi|168281884|ref|ZP_02689551.1| ribosomal protein S18 [Ureaplasma parvum serovar 14 str. ATCC
          33697]
 gi|168308033|ref|ZP_02690708.1| ribosomal protein S18 [Ureaplasma parvum serovar 1 str. ATCC
          27813]
 gi|170762263|ref|YP_001752636.1| 30S ribosomal protein S18 [Ureaplasma parvum serovar 3 str. ATCC
          27815]
 gi|11387108|sp|Q9PPT8|RS18_UREPA RecName: Full=30S ribosomal protein S18
 gi|189029695|sp|B1AJJ2|RS18_UREP2 RecName: Full=30S ribosomal protein S18
 gi|11357040|pir||A82875 ribosomal protein S18 UU552 [imported] - Ureaplasma urealyticum
 gi|6899558|gb|AAF30965.1|AE002154_1 ribosomal protein S18 [Ureaplasma parvum serovar 3 str. ATCC
          700970]
 gi|168827840|gb|ACA33102.1| ribosomal protein S18 [Ureaplasma parvum serovar 3 str. ATCC
          27815]
 gi|171902461|gb|EDT48750.1| ribosomal protein S18 [Ureaplasma parvum serovar 1 str. ATCC
          27813]
 gi|182675876|gb|EDT87781.1| ribosomal protein S18 [Ureaplasma parvum serovar 14 str. ATCC
          33697]
 gi|186700896|gb|EDU19178.1| ribosomal protein S18 [Ureaplasma parvum serovar 6 str. ATCC
          27818]
          Length = 79

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 46/70 (65%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          RN   R+K C LS KG   +DYKD+ LL RF++   KI   R++  S + QR +A AIKR
Sbjct: 8  RNRKPRKKVCILSAKGIEHVDYKDVELLQRFINNNNKIASRRVTGASARMQRRIANAIKR 67

Query: 72 ARYLGLIAYV 81
          AR++GL+ YV
Sbjct: 68 ARFVGLLPYV 77


>gi|302879168|ref|YP_003847732.1| 30S ribosomal protein S18 [Gallionella capsiferriformans ES-2]
 gi|302581957|gb|ADL55968.1| ribosomal protein S18 [Gallionella capsiferriformans ES-2]
          Length = 91

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 49/73 (67%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          R N+  RRK C  + +    +DYKD+ +L  F+S+ GK++P+RI+    + QR+L+ A+K
Sbjct: 18 RNNLFKRRKFCRFTVEKIAEVDYKDVNILKEFISENGKLIPARITGTKTRYQRQLSTAVK 77

Query: 71 RARYLGLIAYVNL 83
          RAR+L L+ Y +L
Sbjct: 78 RARFLALLPYTDL 90


>gi|239946941|ref|ZP_04698694.1| ribosomal protein S18 [Rickettsia endosymbiont of Ixodes
          scapularis]
 gi|239921217|gb|EER21241.1| ribosomal protein S18 [Rickettsia endosymbiont of Ixodes
          scapularis]
          Length = 95

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (73%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK AR L 
Sbjct: 27 RRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIKIARILA 86

Query: 77 LIAYV 81
          L+ +V
Sbjct: 87 LLPFV 91


>gi|224542221|ref|ZP_03682760.1| hypothetical protein CATMIT_01396 [Catenibacterium mitsuokai DSM
          15897]
 gi|224524856|gb|EEF93961.1| hypothetical protein CATMIT_01396 [Catenibacterium mitsuokai DSM
          15897]
          Length = 76

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           RR    RRK C  +      IDYKD+ LL RF+S  GKI+P R++  S K QR+LA+AI
Sbjct: 3  FRRQRMGRRKVCYFTKNKIDYIDYKDVELLKRFISANGKIIPRRVTGTSAKYQRKLARAI 62

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ YV 
Sbjct: 63 KRARQMALLPYVG 75


>gi|89256364|ref|YP_513726.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica LVS]
 gi|167010709|ref|ZP_02275640.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica FSC200]
 gi|169656607|ref|YP_001428514.2| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica FTNF002-00]
 gi|254367700|ref|ZP_04983721.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica 257]
 gi|290954057|ref|ZP_06558678.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|295312550|ref|ZP_06803310.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|122999744|sp|Q2A3H6|RS18_FRATH RecName: Full=30S ribosomal protein S18
 gi|205562308|sp|A7NC55|RS18_FRATF RecName: Full=30S ribosomal protein S18
 gi|89144195|emb|CAJ79464.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica LVS]
 gi|134253511|gb|EBA52605.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica 257]
 gi|164551675|gb|ABU61558.2| ribosomal protein S18 [Francisella tularensis subsp. holarctica
          FTNF002-00]
          Length = 72

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L  ++++ GKIVPSR++  S K QR+LA AIKRAR+L 
Sbjct: 3  RRKVCRFTIEGVKEIDYKDVNKLKAYINETGKIVPSRVTGTSAKYQRQLATAIKRARFLA 62

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 63 LLPYCD 68


>gi|167973255|ref|ZP_02555532.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 5 str. ATCC
          27817]
 gi|167974085|ref|ZP_02556362.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 11 str.
          ATCC 33695]
 gi|167975519|ref|ZP_02557796.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 12 str.
          ATCC 33696]
 gi|167988271|ref|ZP_02569942.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 7 str. ATCC
          27819]
 gi|168362598|ref|ZP_02695777.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 13 str.
          ATCC 33698]
 gi|195867992|ref|ZP_03079988.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 9 str. ATCC
          33175]
 gi|198273409|ref|ZP_03205945.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 4 str. ATCC
          27816]
 gi|209554606|ref|YP_002284999.1| 30S ribosomal protein S18 [Ureaplasma urealyticum serovar 10 str.
          ATCC 33699]
 gi|225550837|ref|ZP_03771786.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 2 str. ATCC
          27814]
 gi|225551101|ref|ZP_03772047.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 8 str. ATCC
          27618]
 gi|229560079|sp|B5ZC59|RS18_UREU1 RecName: Full=30S ribosomal protein S18
 gi|171903293|gb|EDT49582.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 13 str.
          ATCC 33698]
 gi|184209001|gb|EDU06044.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 5 str. ATCC
          27817]
 gi|188019112|gb|EDU57152.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 7 str. ATCC
          27819]
 gi|188998109|gb|EDU67206.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 11 str.
          ATCC 33695]
 gi|195659849|gb|EDX53229.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 12 str.
          ATCC 33696]
 gi|195660326|gb|EDX53587.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 9 str. ATCC
          33175]
 gi|198249929|gb|EDY74709.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 4 str. ATCC
          27816]
 gi|209542107|gb|ACI60336.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 10 str.
          ATCC 33699]
 gi|225378916|gb|EEH01281.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 8 str. ATCC
          27618]
 gi|225379991|gb|EEH02353.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 2 str. ATCC
          27814]
          Length = 79

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 46/70 (65%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          RN   R+K C LS KG   +DYKD+ LL RF++   KI   R++  S + QR +A AIKR
Sbjct: 8  RNRKPRKKVCILSAKGIEHVDYKDVELLQRFINNNNKIASRRVTGASARMQRRIANAIKR 67

Query: 72 ARYLGLIAYV 81
          AR++GL+ YV
Sbjct: 68 ARFVGLLPYV 77


>gi|75763190|ref|ZP_00742955.1| SSU ribosomal protein S18P [Bacillus thuringiensis serovar
          israelensis ATCC 35646]
 gi|74489322|gb|EAO52773.1| SSU ribosomal protein S18P [Bacillus thuringiensis serovar
          israelensis ATCC 35646]
          Length = 64

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G  RIDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR + L+ Y
Sbjct: 2  CFFTANGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPY 61

Query: 81 VN 82
          V 
Sbjct: 62 VG 63


>gi|297621053|ref|YP_003709190.1| 30S ribosomal protein S18 [Waddlia chondrophila WSU 86-1044]
 gi|297376354|gb|ADI38184.1| 30S ribosomal protein S18 [Waddlia chondrophila WSU 86-1044]
          Length = 88

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 47/65 (72%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K CP +  G   IDYK+I  L++F+++RGKI+P RI+ VS   QR L+ AIKRAR++ 
Sbjct: 22 RKKRCPFTTAGVKEIDYKNIEQLSKFITERGKILPRRITGVSAHHQRMLSTAIKRARHMA 81

Query: 77 LIAYV 81
          L+ +V
Sbjct: 82 LLPFV 86


>gi|88800242|ref|ZP_01115809.1| ribosomal protein S18 [Reinekea sp. MED297]
 gi|88776957|gb|EAR08165.1| ribosomal protein S18 [Reinekea sp. MED297]
          Length = 75

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 43/59 (72%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+ LL  ++++ GKIVPSRI+  S K QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGITEIDYKDVDLLKGYITETGKIVPSRITGTSAKYQRQLATAIKRARYLALLPYTD 72


>gi|15616610|ref|NP_244916.1| 30S ribosomal protein S18 [Bacillus halodurans C-125]
 gi|11387101|sp|Q9K5P0|RS18_BACHD RecName: Full=30S ribosomal protein S18
 gi|10176673|dbj|BAB07767.1| 30S ribosomal protein S18 [Bacillus halodurans C-125]
          Length = 77

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (64%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR    RRK C  +     +IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  A
Sbjct: 1  MARRGRPKRRKVCYFTVNKIEKIDYKDVDLLKKFVSERGKILPRRVTGTSAKYQRQLTTA 60

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ YV 
Sbjct: 61 IKRARQIALLPYVT 74


>gi|71278137|ref|YP_267175.1| 30S ribosomal protein S18 [Colwellia psychrerythraea 34H]
 gi|123774971|sp|Q489T9|RS18_COLP3 RecName: Full=30S ribosomal protein S18
 gi|71143877|gb|AAZ24350.1| ribosomal protein S18 [Colwellia psychrerythraea 34H]
          Length = 75

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          + +GA  IDYKDI  L  ++++ GKIVPSRI+  + K QR+L +AIKRARYL L+ Y +L
Sbjct: 14 TAEGATSIDYKDIATLKNYITESGKIVPSRITGTAAKYQRQLTRAIKRARYLSLLPYTDL 73


>gi|50085516|ref|YP_047026.1| 30S ribosomal protein S18 [Acinetobacter sp. ADP1]
 gi|255319499|ref|ZP_05360713.1| ribosomal protein S18 [Acinetobacter radioresistens SK82]
 gi|262378477|ref|ZP_06071634.1| ribosomal protein S18 [Acinetobacter radioresistens SH164]
 gi|59798698|sp|Q6F9Q9|RS18_ACIAD RecName: Full=30S ribosomal protein S18
 gi|49531492|emb|CAG69204.1| 30S ribosomal protein S18 [Acinetobacter sp. ADP1]
 gi|255303439|gb|EET82642.1| ribosomal protein S18 [Acinetobacter radioresistens SK82]
 gi|262299762|gb|EEY87674.1| ribosomal protein S18 [Acinetobacter radioresistens SH164]
          Length = 75

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI  L +++++ GKIVPSRI+    + QR+LA AIK+ARYL 
Sbjct: 7  RRKFCRFTAENVAYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQARYLA 66

Query: 77 LIAYVN 82
          LI Y +
Sbjct: 67 LIPYTD 72


>gi|255020465|ref|ZP_05292530.1| SSU ribosomal protein S18p [Acidithiobacillus caldus ATCC 51756]
 gi|254970075|gb|EET27572.1| SSU ribosomal protein S18p [Acidithiobacillus caldus ATCC 51756]
          Length = 92

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (66%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C    +G   IDYKD++ L  F+ + GKIVPSRI+  S   QR+LA AIKRAR+L L+
Sbjct: 28 KFCRFKAEGVKEIDYKDLKTLQAFIGETGKIVPSRITGTSTLYQRQLATAIKRARFLALL 87

Query: 79 AYV 81
           YV
Sbjct: 88 PYV 90


>gi|15834805|ref|NP_296564.1| 30S ribosomal protein S18 [Chlamydia muridarum Nigg]
 gi|270284971|ref|ZP_06194365.1| 30S ribosomal protein S18 [Chlamydia muridarum Nigg]
 gi|270288995|ref|ZP_06195297.1| 30S ribosomal protein S18 [Chlamydia muridarum Weiss]
 gi|301336368|ref|ZP_07224570.1| 30S ribosomal protein S18 [Chlamydia muridarum MopnTet14]
 gi|7404461|sp|P24286|RS18_CHLMU RecName: Full=30S ribosomal protein S18
 gi|7190222|gb|AAF39059.1| ribosomal protein S18 [Chlamydia muridarum Nigg]
          Length = 81

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 48/72 (66%), Gaps = 4/72 (5%)

Query: 15 SHRRK----SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
           HRRK     CP    G   IDYKD+  L RF+++RGKI+P RI+ VS + Q  LA+A+K
Sbjct: 8  EHRRKRFAKKCPFVSAGWKTIDYKDVVTLKRFITERGKILPRRITGVSSRFQALLAQAVK 67

Query: 71 RARYLGLIAYVN 82
          RAR++GL+ +V 
Sbjct: 68 RARHVGLLPFVG 79


>gi|117925749|ref|YP_866366.1| 30S ribosomal protein S18P [Magnetococcus sp. MC-1]
 gi|205558242|sp|A0LAG7|RS18_MAGSM RecName: Full=30S ribosomal protein S18
 gi|117609505|gb|ABK44960.1| SSU ribosomal protein S18P [Magnetococcus sp. MC-1]
          Length = 106

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%)

Query: 11  RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
           RR    RRK CP       +IDYKD ++L+R++++RGK+VPSRI+ V    QR+L+ AIK
Sbjct: 34  RRPFFRRRKVCPFCADKGLKIDYKDPKMLSRYITERGKMVPSRITGVCAPHQRKLSVAIK 93

Query: 71  RARYLGLIAYV 81
           RAR + L+ ++
Sbjct: 94  RARNIALLPFI 104


>gi|262369755|ref|ZP_06063083.1| 30S ribosomal protein S18 [Acinetobacter johnsonii SH046]
 gi|262375305|ref|ZP_06068538.1| ribosomal protein S18 [Acinetobacter lwoffii SH145]
 gi|262309559|gb|EEY90689.1| ribosomal protein S18 [Acinetobacter lwoffii SH145]
 gi|262315823|gb|EEY96862.1| 30S ribosomal protein S18 [Acinetobacter johnsonii SH046]
          Length = 75

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI  L +++++ GKIVPSRI+    + QR+LA AIK+ARYL 
Sbjct: 7  RRKFCRFTAENVTYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQARYLS 66

Query: 77 LIAYVN 82
          LI Y +
Sbjct: 67 LIPYTD 72


>gi|15923357|ref|NP_370891.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Mu50]
 gi|15926068|ref|NP_373601.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          N315]
 gi|21282072|ref|NP_645160.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MW2]
 gi|49482597|ref|YP_039821.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MRSA252]
 gi|49485247|ref|YP_042468.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MSSA476]
 gi|57652627|ref|YP_185330.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          COL]
 gi|82750079|ref|YP_415820.1| 30S ribosomal protein S18 [Staphylococcus aureus RF122]
 gi|87160951|ref|YP_493082.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          USA300_FPR3757]
 gi|88194149|ref|YP_498939.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          NCTC 8325]
 gi|148266854|ref|YP_001245797.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          JH9]
 gi|150392900|ref|YP_001315575.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          JH1]
 gi|151220571|ref|YP_001331393.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          str. Newman]
 gi|156978695|ref|YP_001440954.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Mu3]
 gi|161508639|ref|YP_001574298.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          USA300_TCH1516]
 gi|221142675|ref|ZP_03567168.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          str. JKD6009]
 gi|253316532|ref|ZP_04839745.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          str. CF-Marseille]
 gi|253730731|ref|ZP_04864896.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          USA300_TCH959]
 gi|253735110|ref|ZP_04869275.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          TCH130]
 gi|255005162|ref|ZP_05143763.2| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Mu50-omega]
 gi|257424511|ref|ZP_05600940.1| SSU ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          55/2053]
 gi|257427180|ref|ZP_05603582.1| SSU ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          65-1322]
 gi|257429816|ref|ZP_05606203.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          68-397]
 gi|257432520|ref|ZP_05608883.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus E1410]
 gi|257435422|ref|ZP_05611473.1| SSU ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          M876]
 gi|257794202|ref|ZP_05643181.1| 30S ribosomal protein S18 [Staphylococcus aureus A9781]
 gi|258413513|ref|ZP_05681788.1| 30S ribosomal protein S18 [Staphylococcus aureus A9763]
 gi|258421363|ref|ZP_05684290.1| SSU ribosomal protein S18 [Staphylococcus aureus A9719]
 gi|258424580|ref|ZP_05687457.1| SSU ribosomal protein S18 [Staphylococcus aureus A9635]
 gi|258436936|ref|ZP_05689276.1| ribosomal protein S18 [Staphylococcus aureus A9299]
 gi|258444347|ref|ZP_05692681.1| ribosomal protein S18 [Staphylococcus aureus A8115]
 gi|258444884|ref|ZP_05693205.1| ribosomal protein S18 [Staphylococcus aureus A6300]
 gi|258448089|ref|ZP_05696218.1| ribosomal protein S18 [Staphylococcus aureus A6224]
 gi|258453040|ref|ZP_05701033.1| ribosomal protein S18 [Staphylococcus aureus A5948]
 gi|258455922|ref|ZP_05703877.1| ribosomal protein S18 [Staphylococcus aureus A5937]
 gi|262048929|ref|ZP_06021809.1| 30S ribosomal protein S18 [Staphylococcus aureus D30]
 gi|262052853|ref|ZP_06025038.1| 30S ribosomal protein S18 [Staphylococcus aureus 930918-3]
 gi|269202015|ref|YP_003281284.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          ED98]
 gi|282893528|ref|ZP_06301761.1| 30S ribosomal protein S18 [Staphylococcus aureus A8117]
 gi|282902953|ref|ZP_06310846.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus C160]
 gi|282907350|ref|ZP_06315198.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Btn1260]
 gi|282907693|ref|ZP_06315535.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          WW2703/97]
 gi|282912600|ref|ZP_06320396.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          WBG10049]
 gi|282913226|ref|ZP_06321018.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus M899]
 gi|282915690|ref|ZP_06323461.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          D139]
 gi|282921665|ref|ZP_06329383.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          C427]
 gi|282922341|ref|ZP_06330032.1| 30S ribosomal protein S18 [Staphylococcus aureus A9765]
 gi|282922853|ref|ZP_06330543.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          C101]
 gi|282927422|ref|ZP_06335040.1| 30S ribosomal protein S18 [Staphylococcus aureus A10102]
 gi|283768095|ref|ZP_06341010.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          H19]
 gi|283959806|ref|ZP_06377247.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          A017934/97]
 gi|284023376|ref|ZP_06377774.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          132]
 gi|293498275|ref|ZP_06666129.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          58-424]
 gi|293509216|ref|ZP_06667934.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          M809]
 gi|293550480|ref|ZP_06673152.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus M1015]
 gi|294850016|ref|ZP_06790754.1| 30S ribosomal protein S18 [Staphylococcus aureus A9754]
 gi|295405640|ref|ZP_06815450.1| 30S ribosomal protein S18 [Staphylococcus aureus A8819]
 gi|295426902|ref|ZP_06819541.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          EMRSA16]
 gi|296275194|ref|ZP_06857701.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MR1]
 gi|297209119|ref|ZP_06925518.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          ATCC 51811]
 gi|297245547|ref|ZP_06929415.1| 30S ribosomal protein S18 [Staphylococcus aureus A8796]
 gi|297588886|ref|ZP_06947527.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MN8]
 gi|300911120|ref|ZP_07128569.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          TCH70]
 gi|304380333|ref|ZP_07363053.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          ATCC BAA-39]
 gi|54039414|sp|P66468|RS18_STAAN RecName: Full=30S ribosomal protein S18
 gi|54039415|sp|P66469|RS18_STAAW RecName: Full=30S ribosomal protein S18
 gi|54042149|sp|P66467|RS18_STAAM RecName: Full=30S ribosomal protein S18
 gi|56749541|sp|Q6GCA5|RS18_STAAS RecName: Full=30S ribosomal protein S18
 gi|56749588|sp|Q6GJV1|RS18_STAAR RecName: Full=30S ribosomal protein S18
 gi|71153727|sp|Q5HIS7|RS18_STAAC RecName: Full=30S ribosomal protein S18
 gi|123098065|sp|Q2G111|RS18_STAA8 RecName: Full=30S ribosomal protein S18
 gi|123736012|sp|Q2FJP6|RS18_STAA3 RecName: Full=30S ribosomal protein S18
 gi|123741000|sp|Q2YVJ0|RS18_STAAB RecName: Full=30S ribosomal protein S18
 gi|166222245|sp|A7WY61|RS18_STAA1 RecName: Full=30S ribosomal protein S18
 gi|172048763|sp|A6QE49|RS18_STAAE RecName: Full=30S ribosomal protein S18
 gi|189029691|sp|A6TYM0|RS18_STAA2 RecName: Full=30S ribosomal protein S18
 gi|189029692|sp|A5IPU8|RS18_STAA9 RecName: Full=30S ribosomal protein S18
 gi|189029693|sp|A8YZJ3|RS18_STAAT RecName: Full=30S ribosomal protein S18
 gi|13700281|dbj|BAB41579.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          N315]
 gi|14246135|dbj|BAB56529.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Mu50]
 gi|21203508|dbj|BAB94208.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MW2]
 gi|49240726|emb|CAG39387.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MRSA252]
 gi|49243690|emb|CAG42114.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MSSA476]
 gi|57286813|gb|AAW38907.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus COL]
 gi|82655610|emb|CAI80006.1| 30S ribosomal protein S18 [Staphylococcus aureus RF122]
 gi|87126925|gb|ABD21439.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          USA300_FPR3757]
 gi|87201707|gb|ABD29517.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus NCTC
          8325]
 gi|147739923|gb|ABQ48221.1| SSU ribosomal protein S18P [Staphylococcus aureus subsp. aureus
          JH9]
 gi|149945352|gb|ABR51288.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus JH1]
 gi|150373371|dbj|BAF66631.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          str. Newman]
 gi|156720830|dbj|BAF77247.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Mu3]
 gi|160367448|gb|ABX28419.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          USA300_TCH1516]
 gi|253725575|gb|EES94304.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          USA300_TCH959]
 gi|253726910|gb|EES95639.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          TCH130]
 gi|257273529|gb|EEV05631.1| SSU ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          55/2053]
 gi|257276811|gb|EEV08262.1| SSU ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          65-1322]
 gi|257280297|gb|EEV10884.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          68-397]
 gi|257283399|gb|EEV13531.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus E1410]
 gi|257286018|gb|EEV16134.1| SSU ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          M876]
 gi|257788174|gb|EEV26514.1| 30S ribosomal protein S18 [Staphylococcus aureus A9781]
 gi|257839760|gb|EEV64229.1| 30S ribosomal protein S18 [Staphylococcus aureus A9763]
 gi|257842787|gb|EEV67209.1| SSU ribosomal protein S18 [Staphylococcus aureus A9719]
 gi|257845175|gb|EEV69212.1| SSU ribosomal protein S18 [Staphylococcus aureus A9635]
 gi|257848727|gb|EEV72714.1| ribosomal protein S18 [Staphylococcus aureus A9299]
 gi|257850606|gb|EEV74554.1| ribosomal protein S18 [Staphylococcus aureus A8115]
 gi|257856202|gb|EEV79116.1| ribosomal protein S18 [Staphylococcus aureus A6300]
 gi|257858604|gb|EEV81478.1| ribosomal protein S18 [Staphylococcus aureus A6224]
 gi|257859250|gb|EEV82105.1| ribosomal protein S18 [Staphylococcus aureus A5948]
 gi|257862134|gb|EEV84907.1| ribosomal protein S18 [Staphylococcus aureus A5937]
 gi|259159254|gb|EEW44313.1| 30S ribosomal protein S18 [Staphylococcus aureus 930918-3]
 gi|259163001|gb|EEW47563.1| 30S ribosomal protein S18 [Staphylococcus aureus D30]
 gi|262074305|gb|ACY10278.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          ED98]
 gi|269939947|emb|CBI48319.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          TW20]
 gi|282315074|gb|EFB45460.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          C101]
 gi|282316080|gb|EFB46464.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          C427]
 gi|282320506|gb|EFB50845.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          D139]
 gi|282323326|gb|EFB53645.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus M899]
 gi|282324296|gb|EFB54612.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          WBG10049]
 gi|282328598|gb|EFB58869.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          WW2703/97]
 gi|282330249|gb|EFB59770.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Btn1260]
 gi|282590746|gb|EFB95822.1| 30S ribosomal protein S18 [Staphylococcus aureus A10102]
 gi|282593467|gb|EFB98462.1| 30S ribosomal protein S18 [Staphylococcus aureus A9765]
 gi|282597412|gb|EFC02371.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus C160]
 gi|282764214|gb|EFC04341.1| 30S ribosomal protein S18 [Staphylococcus aureus A8117]
 gi|283461974|gb|EFC09058.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          H19]
 gi|283469674|emb|CAQ48885.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus ST398]
 gi|283789398|gb|EFC28225.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          A017934/97]
 gi|285816089|gb|ADC36576.1| SSU ribosomal protein S18p [Staphylococcus aureus 04-02981]
 gi|290919527|gb|EFD96603.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus M1015]
 gi|291097206|gb|EFE27464.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          58-424]
 gi|291467968|gb|EFF10476.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          M809]
 gi|294823150|gb|EFG39581.1| 30S ribosomal protein S18 [Staphylococcus aureus A9754]
 gi|294969715|gb|EFG45734.1| 30S ribosomal protein S18 [Staphylococcus aureus A8819]
 gi|295129354|gb|EFG58981.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          EMRSA16]
 gi|296886052|gb|EFH24986.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          ATCC 51811]
 gi|297177533|gb|EFH36784.1| 30S ribosomal protein S18 [Staphylococcus aureus A8796]
 gi|297577397|gb|EFH96110.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MN8]
 gi|298693705|gb|ADI96927.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus ED133]
 gi|300887299|gb|EFK82495.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          TCH70]
 gi|302332104|gb|ADL22297.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          JKD6159]
 gi|302750239|gb|ADL64416.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          str. JKD6008]
 gi|304341314|gb|EFM07233.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          ATCC BAA-39]
 gi|312436518|gb|ADQ75589.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          TCH60]
 gi|312828889|emb|CBX33731.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus ECT-R
          2]
 gi|315130015|gb|EFT86004.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          CGS03]
 gi|315194827|gb|EFU25216.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          CGS00]
 gi|315198049|gb|EFU28381.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          CGS01]
 gi|320139324|gb|EFW31203.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MRSA131]
 gi|320142874|gb|EFW34670.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MRSA177]
 gi|323438827|gb|EGA96565.1| 30S ribosomal protein S18 [Staphylococcus aureus O11]
 gi|323442576|gb|EGB00204.1| 30S ribosomal protein S18 [Staphylococcus aureus O46]
 gi|329313060|gb|AEB87473.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          T0131]
 gi|329724234|gb|EGG60747.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus 21189]
 gi|329725657|gb|EGG62136.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus 21172]
 gi|329732622|gb|EGG68972.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus 21193]
          Length = 80

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKR+R++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRSRHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|319891325|ref|YP_004148200.1| SSU ribosomal protein S18p [Staphylococcus pseudintermedius
          HKU10-03]
 gi|317161021|gb|ADV04564.1| SSU ribosomal protein S18p [Staphylococcus pseudintermedius
          HKU10-03]
 gi|323465518|gb|ADX77671.1| ribosomal protein S18 [Staphylococcus pseudintermedius ED99]
          Length = 80

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 72

Query: 78 IAYV 81
          + +V
Sbjct: 73 LPFV 76


>gi|254467876|ref|ZP_05081282.1| ribosomal protein S18 [beta proteobacterium KB13]
 gi|207086686|gb|EDZ63969.1| ribosomal protein S18 [beta proteobacterium KB13]
          Length = 75

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R++  RR+ C  S +G   +DYKD+ LL  F+ + GKI+P+RI+    + QR+L  A+KR
Sbjct: 3  RDMIRRRRYCRFSAEGIKEVDYKDVDLLKDFILENGKIIPARITGTKARYQRQLTTAVKR 62

Query: 72 ARYLGLIAYVN 82
          AR+L L+ Y +
Sbjct: 63 ARFLALLPYTD 73


>gi|53803659|ref|YP_114469.1| 30S ribosomal protein S18 [Methylococcus capsulatus str. Bath]
 gi|59798627|sp|Q606H9|RS18_METCA RecName: Full=30S ribosomal protein S18
 gi|53757420|gb|AAU91711.1| ribosomal protein S18 [Methylococcus capsulatus str. Bath]
          Length = 76

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR+ C  + +    IDYKD+  L  ++S+ GKIVPSRI+  S K QR+LA AIKRAR+L 
Sbjct: 7  RRRYCRFTAEDVKEIDYKDLDTLREYVSETGKIVPSRITGTSAKYQRQLATAIKRARFLA 66

Query: 77 LIAYVN 82
          L+ + +
Sbjct: 67 LLPFCD 72


>gi|126642217|ref|YP_001085201.1| 30S ribosomal protein S18 [Acinetobacter baumannii ATCC 17978]
 gi|169633237|ref|YP_001706973.1| 30S ribosomal protein S18 [Acinetobacter baumannii SDF]
 gi|169795503|ref|YP_001713296.1| 30S ribosomal protein S18 [Acinetobacter baumannii AYE]
 gi|184158695|ref|YP_001847034.1| 30S ribosomal protein S18 [Acinetobacter baumannii ACICU]
 gi|213158557|ref|YP_002319855.1| ribosomal protein S18 [Acinetobacter baumannii AB0057]
 gi|215482990|ref|YP_002325195.1| ribosomal protein S18 [Acinetobacter baumannii AB307-0294]
 gi|226952676|ref|ZP_03823140.1| 30S ribosomal protein S18 [Acinetobacter sp. ATCC 27244]
 gi|239501437|ref|ZP_04660747.1| 30S ribosomal protein S18 [Acinetobacter baumannii AB900]
 gi|260549409|ref|ZP_05823628.1| ribosomal protein S18 [Acinetobacter sp. RUH2624]
 gi|260554565|ref|ZP_05826786.1| ribosomal protein S18 [Acinetobacter baumannii ATCC 19606]
 gi|262372195|ref|ZP_06065474.1| ribosomal protein S18 [Acinetobacter junii SH205]
 gi|293609461|ref|ZP_06691763.1| 30S ribosomal protein S18 [Acinetobacter sp. SH024]
 gi|294649990|ref|ZP_06727378.1| 30S ribosomal protein S18 [Acinetobacter haemolyticus ATCC 19194]
 gi|301345097|ref|ZP_07225838.1| 30S ribosomal protein S18 [Acinetobacter baumannii AB056]
 gi|301510831|ref|ZP_07236068.1| 30S ribosomal protein S18 [Acinetobacter baumannii AB058]
 gi|301595324|ref|ZP_07240332.1| 30S ribosomal protein S18 [Acinetobacter baumannii AB059]
 gi|332850734|ref|ZP_08432981.1| ribosomal protein S18 [Acinetobacter baumannii 6013150]
 gi|332866955|ref|ZP_08437281.1| ribosomal protein S18 [Acinetobacter baumannii 6013113]
 gi|332873687|ref|ZP_08441630.1| ribosomal protein S18 [Acinetobacter baumannii 6014059]
 gi|166220917|sp|A3M6Q5|RS18_ACIBT RecName: Full=30S ribosomal protein S18
 gi|226735105|sp|B7H0J9|RS18_ACIB3 RecName: Full=30S ribosomal protein S18
 gi|226735106|sp|B7IBC2|RS18_ACIB5 RecName: Full=30S ribosomal protein S18
 gi|229470506|sp|B2HUA3|RS18_ACIBC RecName: Full=30S ribosomal protein S18
 gi|229470507|sp|B0VM09|RS18_ACIBS RecName: Full=30S ribosomal protein S18
 gi|229470508|sp|B0V7G6|RS18_ACIBY RecName: Full=30S ribosomal protein S18
 gi|126388101|gb|ABO12599.1| 30S ribosomal protein S18 [Acinetobacter baumannii ATCC 17978]
 gi|169148430|emb|CAM86296.1| 30S ribosomal protein S18 [Acinetobacter baumannii AYE]
 gi|169152029|emb|CAP00909.1| 30S ribosomal protein S18 [Acinetobacter baumannii]
 gi|183210289|gb|ACC57687.1| putative 30S ribosomal protein S18 [Acinetobacter baumannii
          ACICU]
 gi|213057717|gb|ACJ42619.1| ribosomal protein S18 [Acinetobacter baumannii AB0057]
 gi|213989129|gb|ACJ59428.1| ribosomal protein S18 [Acinetobacter baumannii AB307-0294]
 gi|226836582|gb|EEH68965.1| 30S ribosomal protein S18 [Acinetobacter sp. ATCC 27244]
 gi|260407518|gb|EEX00992.1| ribosomal protein S18 [Acinetobacter sp. RUH2624]
 gi|260411107|gb|EEX04404.1| ribosomal protein S18 [Acinetobacter baumannii ATCC 19606]
 gi|262312220|gb|EEY93305.1| ribosomal protein S18 [Acinetobacter junii SH205]
 gi|292824083|gb|EFF82898.1| 30S ribosomal protein S18 [Acinetobacter haemolyticus ATCC 19194]
 gi|292827913|gb|EFF86276.1| 30S ribosomal protein S18 [Acinetobacter sp. SH024]
 gi|322507495|gb|ADX02949.1| rpsR [Acinetobacter baumannii 1656-2]
 gi|323518609|gb|ADX92990.1| 30S ribosomal protein S18 [Acinetobacter baumannii TCDC-AB0715]
 gi|325122723|gb|ADY82246.1| 30S ribosomal protein S18 [Acinetobacter calcoaceticus PHEA-2]
 gi|332730571|gb|EGJ61887.1| ribosomal protein S18 [Acinetobacter baumannii 6013150]
 gi|332734336|gb|EGJ65463.1| ribosomal protein S18 [Acinetobacter baumannii 6013113]
 gi|332738075|gb|EGJ68959.1| ribosomal protein S18 [Acinetobacter baumannii 6014059]
          Length = 75

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI  L +++++ GKIVPSRI+    + QR+LA AIK+ARYL 
Sbjct: 7  RRKFCRFTAENVAYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQARYLS 66

Query: 77 LIAYVN 82
          LI Y +
Sbjct: 67 LIPYTD 72


>gi|254424438|ref|ZP_05038156.1| ribosomal protein S18 [Synechococcus sp. PCC 7335]
 gi|196191927|gb|EDX86891.1| ribosomal protein S18 [Synechococcus sp. PCC 7335]
          Length = 71

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 50/67 (74%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RR+  P+  K   +IDYKD+ LL +F+++RGKI+P RI+ ++ K+QR+L KAIKRAR +
Sbjct: 4  FRRRVSPI--KPEEKIDYKDVDLLRKFVTERGKILPRRITGLTSKQQRDLTKAIKRARVV 61

Query: 76 GLIAYVN 82
           L+ YVN
Sbjct: 62 ALLPYVN 68


>gi|56416480|ref|YP_153554.1| 30S ribosomal protein S18 [Anaplasma marginale str. St. Maries]
 gi|81677669|sp|Q5PBN0|RS18_ANAMM RecName: Full=30S ribosomal protein S18
 gi|56387712|gb|AAV86299.1| small subunit ribosomal protein S18 [Anaplasma marginale str. St.
          Maries]
          Length = 75

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 53/72 (73%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          L+R    + +SCPL+      IDYK+  LL++F+S+ G+I+PSRI+SVS +KQ+ LA+A+
Sbjct: 4  LKRPYFRKSRSCPLAQCPDEDIDYKNRALLSKFVSEYGRILPSRITSVSSRKQKLLARAV 63

Query: 70 KRARYLGLIAYV 81
          KRAR+L L+ Y 
Sbjct: 64 KRARFLALLPYC 75


>gi|291614206|ref|YP_003524363.1| ribosomal protein S18 [Sideroxydans lithotrophicus ES-1]
 gi|291584318|gb|ADE11976.1| ribosomal protein S18 [Sideroxydans lithotrophicus ES-1]
          Length = 89

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 48/72 (66%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  RRK C  + +    +DYKDI +L  F+++ GK++P+RI+    + QR+L+ A+KR
Sbjct: 17 RQLFKRRKFCRFTAEKIAEVDYKDINILKEFITENGKLIPARITGTKTRFQRQLSVAVKR 76

Query: 72 ARYLGLIAYVNL 83
          AR+L L+ Y +L
Sbjct: 77 ARFLALLPYTDL 88


>gi|330443831|ref|YP_004376817.1| 30S ribosomal protein S18 [Chlamydophila pecorum E58]
 gi|328806941|gb|AEB41114.1| ribosomal protein S18 [Chlamydophila pecorum E58]
          Length = 82

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 44/64 (68%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K CP    G   IDYKD+  L +F+++RGKI+P RI+ VS + Q  LA+AIKRAR LGL+
Sbjct: 17 KKCPFVSAGWKTIDYKDVETLKKFITERGKILPRRITGVSSRFQGILAQAIKRARLLGLL 76

Query: 79 AYVN 82
           +V 
Sbjct: 77 PFVG 80


>gi|262277395|ref|ZP_06055188.1| ribosomal protein S18 [alpha proteobacterium HIMB114]
 gi|262224498|gb|EEY74957.1| ribosomal protein S18 [alpha proteobacterium HIMB114]
          Length = 88

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 48/64 (75%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K+CPL+ K    I+YK+I+LL +++S   KI+P+RI++VSH KQ+ L K IK+AR L L
Sbjct: 23 KKNCPLAKKSDEEINYKNIKLLKKYISDSAKILPTRITNVSHGKQKILVKEIKKARALAL 82

Query: 78 IAYV 81
          + YV
Sbjct: 83 LPYV 86


>gi|332971411|gb|EGK10369.1| 30S ribosomal protein S18 [Desmospora sp. 8437]
          Length = 75

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 48/74 (64%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR  + RRK C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L +A
Sbjct: 1  MARRRGNKRRKVCFFTVNKIEYIDYKDVDLLRKFISERGKILPRRVTGTSSKYQRQLTRA 60

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ Y  
Sbjct: 61 IKRARQMALLPYTT 74


>gi|212640664|ref|YP_002317184.1| 30S ribosomal protein S18 [Anoxybacillus flavithermus WK1]
 gi|212562144|gb|ACJ35199.1| Ribosomal protein S18 [Anoxybacillus flavithermus WK1]
          Length = 84

 Score = 70.5 bits (171), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + RRK C  +  G   IDYKD+  L +F+S+RGKI+P R++  S K QR+L  AIKRAR 
Sbjct: 15 TKRRKVCYFTANGITHIDYKDVDTLKKFISERGKILPRRVTGTSAKYQRKLTIAIKRARQ 74

Query: 75 LGLIAYV 81
          + L+ YV
Sbjct: 75 MALLPYV 81


>gi|39938497|ref|NP_950263.1| 30S ribosomal protein S18 [Onion yellows phytoplasma OY-M]
 gi|59798755|sp|Q6YRK3|RS18_ONYPE RecName: Full=30S ribosomal protein S18
 gi|39721606|dbj|BAD04096.1| ribosomal protein S18 [Onion yellows phytoplasma OY-M]
          Length = 79

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 46/65 (70%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  +     +ID+KDI LL RF++ RG+I+  R+++ S K QR+LA AIKRAR++ 
Sbjct: 13 RRKVCFFTENKVTKIDFKDIELLQRFITDRGRILSRRVTNTSAKWQRQLAIAIKRARHMA 72

Query: 77 LIAYV 81
          LI ++
Sbjct: 73 LIPFI 77


>gi|299769499|ref|YP_003731525.1| 30S ribosomal protein S18 [Acinetobacter sp. DR1]
 gi|298699587|gb|ADI90152.1| 30S ribosomal protein S18 [Acinetobacter sp. DR1]
          Length = 75

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI  L +++++ GKIVPSRI+    + QR+LA AIK+ARYL 
Sbjct: 7  RRKFCRFTAENVVYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQARYLS 66

Query: 77 LIAYVN 82
          LI Y +
Sbjct: 67 LIPYTD 72


>gi|28199811|ref|NP_780125.1| 30S ribosomal protein S18 [Xylella fastidiosa Temecula1]
 gi|71275195|ref|ZP_00651482.1| Ribosomal protein S18 [Xylella fastidiosa Dixon]
 gi|71898275|ref|ZP_00680449.1| Ribosomal protein S18 [Xylella fastidiosa Ann-1]
 gi|71899833|ref|ZP_00681983.1| Ribosomal protein S18 [Xylella fastidiosa Ann-1]
 gi|170731186|ref|YP_001776619.1| 30S ribosomal protein S18 [Xylella fastidiosa M12]
 gi|182682563|ref|YP_001830723.1| 30S ribosomal protein S18 [Xylella fastidiosa M23]
 gi|32129999|sp|Q87A84|RS18_XYLFT RecName: Full=30S ribosomal protein S18
 gi|229560083|sp|B2I9S8|RS18_XYLF2 RecName: Full=30S ribosomal protein S18
 gi|229560084|sp|B0U5H1|RS18_XYLFM RecName: Full=30S ribosomal protein S18
 gi|28057932|gb|AAO29774.1| 30S ribosomal protein S18 [Xylella fastidiosa Temecula1]
 gi|71164004|gb|EAO13719.1| Ribosomal protein S18 [Xylella fastidiosa Dixon]
 gi|71730424|gb|EAO32505.1| Ribosomal protein S18 [Xylella fastidiosa Ann-1]
 gi|71732014|gb|EAO34071.1| Ribosomal protein S18 [Xylella fastidiosa Ann-1]
 gi|167965979|gb|ACA12989.1| 30S ribosomal protein S18 [Xylella fastidiosa M12]
 gi|182632673|gb|ACB93449.1| ribosomal protein S18 [Xylella fastidiosa M23]
 gi|307578843|gb|ADN62812.1| 30S ribosomal protein S18 [Xylella fastidiosa subsp. fastidiosa
          GB514]
          Length = 76

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (66%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L ++L++ G+IVPSR++    K QR+L  A+K AR+L 
Sbjct: 7  RRKFCKFTAEGIKEIDYKDLNTLRQYLTENGRIVPSRVTGTKSKYQRQLTTAVKLARFLA 66

Query: 77 LIAYVN 82
          LI Y +
Sbjct: 67 LIPYTD 72


>gi|253996552|ref|YP_003048616.1| 30S ribosomal protein S18 [Methylotenera mobilis JLW8]
 gi|253983231|gb|ACT48089.1| ribosomal protein S18 [Methylotenera mobilis JLW8]
          Length = 77

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 48/73 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R++  RR+ C  S +G   +DYKD+ LL  F+S+  KI+P+R++    + QR+L  A+
Sbjct: 1  MARDMYKRRRYCRFSAEGIKEVDYKDVDLLKDFISENAKIIPARMTGTKARYQRQLTSAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|325981281|ref|YP_004293683.1| 30S ribosomal protein S18 [Nitrosomonas sp. AL212]
 gi|325530800|gb|ADZ25521.1| ribosomal protein S18 [Nitrosomonas sp. AL212]
          Length = 94

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 48/71 (67%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  R+K C  + +G  ++DYKDI +L  F+S+ GK++P+RI+  +   QR+L  AI+R
Sbjct: 22 RPLFKRKKFCRFTAEGIKQVDYKDIEILKDFISENGKVIPARITGTTSFYQRQLGTAIER 81

Query: 72 ARYLGLIAYVN 82
          AR+L L+ Y +
Sbjct: 82 ARFLALLPYTD 92


>gi|157964105|ref|YP_001498929.1| 30S ribosomal protein S18 [Rickettsia massiliae MTU5]
 gi|167011193|sp|A8F0E6|RS18_RICM5 RecName: Full=30S ribosomal protein S18
 gi|157843881|gb|ABV84382.1| 30S ribosomal protein S18 [Rickettsia massiliae MTU5]
          Length = 95

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 48/65 (73%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  A+K AR L 
Sbjct: 27 RRKGCPLSVPHAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAVKIARILA 86

Query: 77 LIAYV 81
          L+ +V
Sbjct: 87 LLPFV 91


>gi|119713694|gb|ABL97744.1| ribosomal protein S18 [uncultured marine bacterium EB0_41B09]
          Length = 75

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 50/73 (68%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R++  RR+ C  S +G   +DYKD+ +L  F+++ GK++P+RI+    + QR+L+ A+
Sbjct: 1  MARDMYKRRRYCRFSAEGISEVDYKDVSILKDFITENGKLIPARITGTKARYQRQLSTAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ + +
Sbjct: 61 KRARFLALLPFTD 73


>gi|29840574|ref|NP_829680.1| 30S ribosomal protein S18 [Chlamydophila caviae GPIC]
 gi|33301610|sp|Q821W8|RS18_CHLCV RecName: Full=30S ribosomal protein S18
 gi|29834924|gb|AAP05558.1| ribosomal protein S18 [Chlamydophila caviae GPIC]
          Length = 82

 Score = 70.1 bits (170), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 46/73 (63%), Gaps = 4/73 (5%)

Query: 13 NVSHRRK----SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          N  HRRK     CP    G   IDYKD   L +F+++RGKI+P RI+ VS + Q  L  A
Sbjct: 7  NNEHRRKRFNKKCPFVSAGWKTIDYKDTETLKKFITERGKILPRRITGVSSRFQGTLTLA 66

Query: 69 IKRARYLGLIAYV 81
          IKRAR++GL+ +V
Sbjct: 67 IKRARHIGLLPFV 79


>gi|15640395|ref|NP_230022.1| 30S ribosomal protein S18 [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121590975|ref|ZP_01678295.1| ribosomal protein S18 [Vibrio cholerae 2740-80]
 gi|121730199|ref|ZP_01682589.1| ribosomal protein S18 [Vibrio cholerae V52]
 gi|147675772|ref|YP_001218637.1| 30S ribosomal protein S18 [Vibrio cholerae O395]
 gi|153216652|ref|ZP_01950559.1| ribosomal protein S18 [Vibrio cholerae 1587]
 gi|153820254|ref|ZP_01972921.1| ribosomal protein S18 [Vibrio cholerae NCTC 8457]
 gi|153824149|ref|ZP_01976816.1| ribosomal protein S18 [Vibrio cholerae B33]
 gi|153827640|ref|ZP_01980307.1| ribosomal protein S18 [Vibrio cholerae MZO-2]
 gi|153830451|ref|ZP_01983118.1| ribosomal protein S18 [Vibrio cholerae 623-39]
 gi|227080580|ref|YP_002809131.1| ribosomal protein S18 [Vibrio cholerae M66-2]
 gi|229504951|ref|ZP_04394462.1| SSU ribosomal protein S18p [Vibrio cholerae BX 330286]
 gi|229508611|ref|ZP_04398107.1| SSU ribosomal protein S18p [Vibrio cholerae B33]
 gi|229512612|ref|ZP_04402082.1| SSU ribosomal protein S18p [Vibrio cholerae TMA 21]
 gi|229516023|ref|ZP_04405474.1| SSU ribosomal protein S18p [Vibrio cholerae RC9]
 gi|229519925|ref|ZP_04409356.1| SSU ribosomal protein S18p [Vibrio cholerae TM 11079-80]
 gi|229525062|ref|ZP_04414467.1| SSU ribosomal protein S18p [Vibrio cholerae bv. albensis VL426]
 gi|229526943|ref|ZP_04416340.1| SSU ribosomal protein S18p [Vibrio cholerae 12129(1)]
 gi|229606351|ref|YP_002876999.1| 30S ribosomal protein S18 [Vibrio cholerae MJ-1236]
 gi|254286208|ref|ZP_04961167.1| ribosomal protein S18 [Vibrio cholerae AM-19226]
 gi|254851679|ref|ZP_05241029.1| 30S ribosomal protein S18 [Vibrio cholerae MO10]
 gi|255747166|ref|ZP_05421109.1| SSU ribosomal protein S18p [Vibrio cholera CIRS 101]
 gi|258622405|ref|ZP_05717428.1| 30S ribosomal protein S18 [Vibrio mimicus VM573]
 gi|258625990|ref|ZP_05720855.1| 30S ribosomal protein S18 [Vibrio mimicus VM603]
 gi|261210395|ref|ZP_05924689.1| SSU ribosomal protein S18p [Vibrio sp. RC341]
 gi|262163855|ref|ZP_06031595.1| SSU ribosomal protein S18p [Vibrio mimicus VM223]
 gi|262166874|ref|ZP_06034596.1| SSU ribosomal protein S18p [Vibrio cholerae RC27]
 gi|262172536|ref|ZP_06040214.1| SSU ribosomal protein S18p [Vibrio mimicus MB-451]
 gi|262401541|ref|ZP_06078108.1| SSU ribosomal protein S18p [Vibrio sp. RC586]
 gi|297582252|ref|ZP_06944167.1| ribosomal protein S18 [Vibrio cholerae RC385]
 gi|298501265|ref|ZP_07011063.1| SSU ribosomal protein S18 [Vibrio cholerae MAK 757]
 gi|11387102|sp|Q9KUZ0|RS18_VIBCH RecName: Full=30S ribosomal protein S18
 gi|172047710|sp|A5F3K5|RS18_VIBC3 RecName: Full=30S ribosomal protein S18
 gi|254812964|sp|C3LRA0|RS18_VIBCM RecName: Full=30S ribosomal protein S18
 gi|9654785|gb|AAF93541.1| ribosomal protein S18 [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121547201|gb|EAX57328.1| ribosomal protein S18 [Vibrio cholerae 2740-80]
 gi|121628057|gb|EAX60602.1| ribosomal protein S18 [Vibrio cholerae V52]
 gi|124114163|gb|EAY32983.1| ribosomal protein S18 [Vibrio cholerae 1587]
 gi|126509205|gb|EAZ71799.1| ribosomal protein S18 [Vibrio cholerae NCTC 8457]
 gi|126518326|gb|EAZ75549.1| ribosomal protein S18 [Vibrio cholerae B33]
 gi|146317655|gb|ABQ22194.1| ribosomal protein S18 [Vibrio cholerae O395]
 gi|148874053|gb|EDL72188.1| ribosomal protein S18 [Vibrio cholerae 623-39]
 gi|149737890|gb|EDM52795.1| ribosomal protein S18 [Vibrio cholerae MZO-2]
 gi|150423623|gb|EDN15565.1| ribosomal protein S18 [Vibrio cholerae AM-19226]
 gi|227008468|gb|ACP04680.1| ribosomal protein S18 [Vibrio cholerae M66-2]
 gi|227012224|gb|ACP08434.1| ribosomal protein S18 [Vibrio cholerae O395]
 gi|229335555|gb|EEO01035.1| SSU ribosomal protein S18p [Vibrio cholerae 12129(1)]
 gi|229338643|gb|EEO03660.1| SSU ribosomal protein S18p [Vibrio cholerae bv. albensis VL426]
 gi|229343053|gb|EEO08040.1| SSU ribosomal protein S18p [Vibrio cholerae TM 11079-80]
 gi|229346926|gb|EEO11893.1| SSU ribosomal protein S18p [Vibrio cholerae RC9]
 gi|229350394|gb|EEO15344.1| SSU ribosomal protein S18p [Vibrio cholerae TMA 21]
 gi|229354379|gb|EEO19306.1| SSU ribosomal protein S18p [Vibrio cholerae B33]
 gi|229358009|gb|EEO22925.1| SSU ribosomal protein S18p [Vibrio cholerae BX 330286]
 gi|229369006|gb|ACQ59429.1| SSU ribosomal protein S18p [Vibrio cholerae MJ-1236]
 gi|254847384|gb|EET25798.1| 30S ribosomal protein S18 [Vibrio cholerae MO10]
 gi|255735215|gb|EET90617.1| SSU ribosomal protein S18p [Vibrio cholera CIRS 101]
 gi|258581738|gb|EEW06622.1| 30S ribosomal protein S18 [Vibrio mimicus VM603]
 gi|258585319|gb|EEW10045.1| 30S ribosomal protein S18 [Vibrio mimicus VM573]
 gi|260840453|gb|EEX67019.1| SSU ribosomal protein S18p [Vibrio sp. RC341]
 gi|261893612|gb|EEY39598.1| SSU ribosomal protein S18p [Vibrio mimicus MB-451]
 gi|262024704|gb|EEY43383.1| SSU ribosomal protein S18p [Vibrio cholerae RC27]
 gi|262027835|gb|EEY46500.1| SSU ribosomal protein S18p [Vibrio mimicus VM223]
 gi|262352256|gb|EEZ01385.1| SSU ribosomal protein S18p [Vibrio sp. RC586]
 gi|297533510|gb|EFH72356.1| ribosomal protein S18 [Vibrio cholerae RC385]
 gi|297540019|gb|EFH76082.1| SSU ribosomal protein S18 [Vibrio cholerae MAK 757]
 gi|327483226|gb|AEA77633.1| SSU ribosomal protein S18p [Vibrio cholerae LMA3894-4]
          Length = 75

 Score = 70.1 bits (170), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 43/59 (72%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+  S K QR+LA+AIKRARYL L+ Y +
Sbjct: 14 TAEGVQEIDYKDVATLKNYITEAGKIVPSRITGTSAKYQRQLARAIKRARYLALLPYTD 72


>gi|22299604|ref|NP_682851.1| 30S ribosomal protein S18 [Thermosynechococcus elongatus BP-1]
 gi|59798900|sp|Q8DH98|RS18_THEEB RecName: Full=30S ribosomal protein S18
 gi|22295788|dbj|BAC09613.1| 30S ribosomal protein S18 [Thermosynechococcus elongatus BP-1]
          Length = 71

 Score = 70.1 bits (170), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 52/68 (76%), Gaps = 2/68 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +RR+  P+   G P IDYKD+ LL RF+++RGKI+P R++ ++ K+QR+LA AIKRAR +
Sbjct: 4  YRRRISPIP-PGQP-IDYKDVDLLRRFITERGKILPRRVTGLTAKQQRQLAVAIKRARIM 61

Query: 76 GLIAYVNL 83
           L+ ++NL
Sbjct: 62 ALLPFLNL 69


>gi|73663680|ref|YP_302461.1| 30S ribosomal protein S18 [Staphylococcus saprophyticus subsp.
          saprophyticus ATCC 15305]
 gi|123747836|sp|Q49UQ2|RS18_STAS1 RecName: Full=30S ribosomal protein S18
 gi|72496195|dbj|BAE19516.1| 30S ribosomal protein S18 [Staphylococcus saprophyticus subsp.
          saprophyticus ATCC 15305]
          Length = 80

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKR+R++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTLAIKRSRHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|226941616|ref|YP_002796690.1| 30S ribosomal protein S18 [Laribacter hongkongensis HLHK9]
 gi|254812944|sp|C1DCR2|RS18_LARHH RecName: Full=30S ribosomal protein S18
 gi|226716543|gb|ACO75681.1| RpsR [Laribacter hongkongensis HLHK9]
          Length = 75

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 48/73 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R +  RRK C  + +G   +DYK + LL  F+++ GKI+P+RI+    + QR+L+ AI
Sbjct: 1  MARQLFKRRKFCRFTAEGIKEVDYKAVDLLKDFIAENGKIIPARITGTKARYQRQLSTAI 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALMPYTD 73


>gi|224824683|ref|ZP_03697790.1| ribosomal protein S18 [Lutiella nitroferrum 2002]
 gi|224603176|gb|EEG09352.1| ribosomal protein S18 [Lutiella nitroferrum 2002]
          Length = 75

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R +  R+K C  + +G   IDYK + LL  F+++ GKI+PSRI+    + QR+L  AI
Sbjct: 1  MARQLFKRKKFCRFTAEGIKEIDYKSVDLLKDFIAENGKIIPSRITGTKARYQRQLTTAI 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L  + Y +
Sbjct: 61 KRARFLAFLPYTD 73


>gi|85713276|ref|ZP_01044299.1| Ribosomal protein S18 [Idiomarina baltica OS145]
 gi|85692894|gb|EAQ30869.1| Ribosomal protein S18 [Idiomarina baltica OS145]
          Length = 75

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%)

Query: 25 GKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
           +G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+LA+AIKRARYL L+ Y +
Sbjct: 15 AEGVKEIDYKDIATLKNYITESGKIVPSRITGTSAKYQRQLARAIKRARYLSLLPYTD 72


>gi|149071994|ref|YP_001293556.1| ribosomal protein S18 [Rhodomonas salina]
 gi|205831411|sp|A6MVX7|RR18_RHDSA RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|134302945|gb|ABO70749.1| ribosomal protein S18 [Rhodomonas salina]
          Length = 73

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 51/67 (76%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +RRK+ P+  K    IDYKD+ LL+ FL+++GKI+P R++ +++K+Q ++ KAIKRAR L
Sbjct: 4  YRRKASPI--KIGDAIDYKDVELLSNFLTEQGKILPKRLTGLTNKQQNKVTKAIKRARML 61

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 62 SLLPFVN 68


>gi|23100932|ref|NP_694399.1| 30S ribosomal protein S18 [Oceanobacillus iheyensis HTE831]
 gi|59798907|sp|Q8EKV5|RS18_OCEIH RecName: Full=30S ribosomal protein S18
 gi|22779167|dbj|BAC15433.1| 30S ribosomal protein S18 [Oceanobacillus iheyensis HTE831]
          Length = 76

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (68%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR + L+ Y
Sbjct: 14 CYFTANGITHIDYKDVDLLRRFISERGKILPRRVTGTSAKYQRKLTIAIKRARTMALLPY 73

Query: 81 V 81
          V
Sbjct: 74 V 74


>gi|148284318|ref|YP_001248408.1| 30S ribosomal protein S18 [Orientia tsutsugamushi str. Boryong]
 gi|205616184|sp|A5CCY6|RS18_ORITB RecName: Full=30S ribosomal protein S18
 gi|146739757|emb|CAM79615.1| 30S ribosomal protein S18 [Orientia tsutsugamushi str. Boryong]
          Length = 102

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (71%), Gaps = 2/67 (2%)

Query: 17 RRKSCPLSGKG--APRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          RRK CPLS     AP I YKD  LL++F+S+ G+++P+R+++V   KQREL KAIK AR 
Sbjct: 33 RRKGCPLSAPDGTAPIITYKDPDLLSKFISECGRVLPARVTNVCRSKQRELTKAIKIARE 92

Query: 75 LGLIAYV 81
          L L+ +V
Sbjct: 93 LALLPFV 99


>gi|220906338|ref|YP_002481649.1| 30S ribosomal protein S18 [Cyanothece sp. PCC 7425]
 gi|219862949|gb|ACL43288.1| ribosomal protein S18 [Cyanothece sp. PCC 7425]
          Length = 71

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 51/67 (76%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +RR+  P+  + A  IDYKD+ LL RF+++RGKI+P RI+ ++ K+QR+L +++KRAR L
Sbjct: 4  YRRRVSPIKPEEA--IDYKDVDLLRRFITERGKILPRRITGLTAKQQRQLTQSVKRARIL 61

Query: 76 GLIAYVN 82
           L+ ++N
Sbjct: 62 ALLPFIN 68


>gi|317130989|ref|YP_004097271.1| ribosomal protein S18 [Bacillus cellulosilyticus DSM 2522]
 gi|315475937|gb|ADU32540.1| ribosomal protein S18 [Bacillus cellulosilyticus DSM 2522]
          Length = 75

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 47/74 (63%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR    RRK C  +      IDYKD  LL +F+S+RGKI+P R++  S K QR+L +A
Sbjct: 1  MARRGRPKRRKVCYFTVNKITSIDYKDTDLLKKFISERGKILPRRVTGTSAKYQRQLTRA 60

Query: 69 IKRARYLGLIAYVN 82
          IKR+R + L+ YV 
Sbjct: 61 IKRSRTMALLPYVT 74


>gi|189183704|ref|YP_001937489.1| 30S ribosomal protein S18 [Orientia tsutsugamushi str. Ikeda]
 gi|229560049|sp|B3CRZ8|RS18_ORITI RecName: Full=30S ribosomal protein S18
 gi|189180475|dbj|BAG40255.1| 30S ribosomal protein S18 [Orientia tsutsugamushi str. Ikeda]
          Length = 102

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (71%), Gaps = 2/67 (2%)

Query: 17 RRKSCPLSGKG--APRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          RRK CPLS     AP I YKD  LL++F+S+ G+++P+R+++V   KQREL KAIK AR 
Sbjct: 33 RRKGCPLSAPDGTAPIITYKDPDLLSKFISECGRVLPARVTNVCRSKQRELTKAIKIARE 92

Query: 75 LGLIAYV 81
          L L+ +V
Sbjct: 93 LALLPFV 99


>gi|225023646|ref|ZP_03712838.1| hypothetical protein EIKCOROL_00509 [Eikenella corrodens ATCC
          23834]
 gi|224943528|gb|EEG24737.1| hypothetical protein EIKCOROL_00509 [Eikenella corrodens ATCC
          23834]
          Length = 76

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK C  + +G  ++DYK + LL  F+S+ GKI+P+RI+      QR+L+ A+
Sbjct: 1  MARQTFKRRKFCRFTAEGIKQVDYKSVDLLKDFISENGKIIPARITGTKAHYQRQLSVAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|56461038|ref|YP_156319.1| ribosomal protein S18 [Idiomarina loihiensis L2TR]
 gi|81678373|sp|Q5QY03|RS18_IDILO RecName: Full=30S ribosomal protein S18
 gi|56180048|gb|AAV82770.1| Ribosomal protein S18 [Idiomarina loihiensis L2TR]
          Length = 75

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 41/56 (73%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+LA+AIKRARYL L+ Y +
Sbjct: 17 GVKEIDYKDIATLKNYITETGKIVPSRITGTSAKYQRQLARAIKRARYLSLLPYTD 72


>gi|85057285|ref|YP_456201.1| 30S ribosomal protein S18 [Aster yellows witches'-broom
          phytoplasma AYWB]
 gi|123725354|sp|Q2NKC1|RS18_AYWBP RecName: Full=30S ribosomal protein S18
 gi|84789390|gb|ABC65122.1| SSU ribosomal protein S18P [Aster yellows witches'-broom
          phytoplasma AYWB]
          Length = 79

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 46/65 (70%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  +     +ID+KDI LL RF++ RG+I+  R+++ S + QR+LA AIKRAR++ 
Sbjct: 13 RRKVCFFTENKVTKIDFKDIELLQRFITDRGRILSRRVTNTSARWQRQLAIAIKRARHMA 72

Query: 77 LIAYV 81
          LI ++
Sbjct: 73 LIPFI 77


>gi|241888999|ref|ZP_04776303.1| ribosomal protein S18 [Gemella haemolysans ATCC 10379]
 gi|241864248|gb|EER68626.1| ribosomal protein S18 [Gemella haemolysans ATCC 10379]
          Length = 82

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 15 KKVCYFTKNNVEFIDYKDVELLKKFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 74

Query: 78 IAYV 81
          + YV
Sbjct: 75 LPYV 78


>gi|329769493|ref|ZP_08260903.1| 30S ribosomal protein S18 [Gemella sanguinis M325]
 gi|328838708|gb|EGF88306.1| 30S ribosomal protein S18 [Gemella sanguinis M325]
          Length = 82

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 15 KKVCYFTKNNIETIDYKDVELLKKFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 74

Query: 78 IAYV 81
          + YV
Sbjct: 75 LPYV 78


>gi|319778266|ref|YP_004129179.1| SSU ribosomal protein S18p [Taylorella equigenitalis MCE9]
 gi|317108290|gb|ADU91036.1| SSU ribosomal protein S18p [Taylorella equigenitalis MCE9]
          Length = 91

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  +  G   IDYKDI  L  F+++ GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 23 RRKFCRFTAAGVDEIDYKDIDTLKDFITETGKIIPARLTGTKANYQRQLDTAIKRARFLA 82

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 83 LLPYTD 88


>gi|110835050|ref|YP_693909.1| 30S ribosomal protein S18 [Alcanivorax borkumensis SK2]
 gi|254427140|ref|ZP_05040847.1| ribosomal protein S18 [Alcanivorax sp. DG881]
 gi|123149283|sp|Q0VMG1|RS18_ALCBS RecName: Full=30S ribosomal protein S18
 gi|110648161|emb|CAL17637.1| 30S ribosomal protein S18 [Alcanivorax borkumensis SK2]
 gi|196193309|gb|EDX88268.1| ribosomal protein S18 [Alcanivorax sp. DG881]
          Length = 76

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIK+AR+L 
Sbjct: 7  RRKFCRFTAEGVEYIDYKDLDTLKAYITETGKIVPSRITGTKARYQRQLASAIKQARFLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYSD 72


>gi|109900046|ref|YP_663301.1| ribosomal protein S18 [Pseudoalteromonas atlantica T6c]
 gi|332308094|ref|YP_004435945.1| ribosomal protein S18 [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|123064136|sp|Q15PE1|RS18_PSEA6 RecName: Full=30S ribosomal protein S18
 gi|109702327|gb|ABG42247.1| SSU ribosomal protein S18P [Pseudoalteromonas atlantica T6c]
 gi|332175423|gb|AEE24677.1| ribosomal protein S18 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 75

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 43/59 (72%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          S  G  +IDYKDI +L  ++++ GKIVPSRI+  S K QR+L+ AIKRAR+L L+ Y +
Sbjct: 14 SADGVVQIDYKDIAMLKNYVTESGKIVPSRITGTSAKYQRQLSTAIKRARFLALLPYTD 72


>gi|317496133|ref|ZP_07954493.1| ribosomal protein S18 [Gemella moribillum M424]
 gi|329768685|ref|ZP_08260169.1| 30S ribosomal protein S18 [Gemella haemolysans M341]
 gi|316913708|gb|EFV35194.1| ribosomal protein S18 [Gemella moribillum M424]
 gi|328836399|gb|EGF86064.1| 30S ribosomal protein S18 [Gemella haemolysans M341]
          Length = 82

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 15 KKVCYFTKNNVEFIDYKDVELLKKFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 74

Query: 78 IAYV 81
          + YV
Sbjct: 75 LPYV 78


>gi|209528144|ref|ZP_03276618.1| ribosomal protein S18 [Arthrospira maxima CS-328]
 gi|284050077|ref|ZP_06380287.1| 30S ribosomal protein S18 [Arthrospira platensis str. Paraca]
 gi|209491432|gb|EDZ91813.1| ribosomal protein S18 [Arthrospira maxima CS-328]
 gi|291568150|dbj|BAI90422.1| 30S ribosomal protein S18 [Arthrospira platensis NIES-39]
          Length = 71

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 49/67 (73%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RR+  P+  K    IDYK+I LL +F+++RGKI+P RI+ ++ K+QR+L KAIKRAR L
Sbjct: 4  FRRQVSPIDPKTP--IDYKNIELLKKFMTERGKILPRRITGLTCKQQRDLTKAIKRARIL 61

Query: 76 GLIAYVN 82
           ++ +VN
Sbjct: 62 AMLPFVN 68


>gi|149182312|ref|ZP_01860791.1| RpsR [Bacillus sp. SG-1]
 gi|148850004|gb|EDL64175.1| RpsR [Bacillus sp. SG-1]
          Length = 65

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 42/61 (68%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ LL +F+S+RGKI+P R++  S K QR L +AIKRAR + L+ Y
Sbjct: 2  CYFTSNGITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRRLTRAIKRARTMALLPY 61

Query: 81 V 81
          V
Sbjct: 62 V 62


>gi|319938326|ref|ZP_08012722.1| 30S ribosomal protein S18 [Coprobacillus sp. 29_1]
 gi|319806509|gb|EFW03171.1| 30S ribosomal protein S18 [Coprobacillus sp. 29_1]
          Length = 76

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 45/73 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +R    R+K C  +      IDYKD+ LL RF+S  GKI+P R++  S K QR+LA AI
Sbjct: 3  FKRQRMGRKKVCFFTKNKIDYIDYKDVELLKRFVSANGKIIPRRVTGTSAKYQRQLAAAI 62

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ YV 
Sbjct: 63 KRARQMALLPYVG 75


>gi|306820942|ref|ZP_07454562.1| 30S ribosomal protein S18 [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
 gi|304551056|gb|EFM39027.1| 30S ribosomal protein S18 [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
          Length = 83

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K  P +G    +IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR + 
Sbjct: 17 RKKVDPFAGDKINQIDYKDVALLKKFISERGKILPRRVTGTSAKAQRKLTNAIKRARIVA 76

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 77 LLPYT 81


>gi|295698471|ref|YP_003603126.1| ribosomal protein S18 [Candidatus Riesia pediculicola USDA]
 gi|291157471|gb|ADD79916.1| ribosomal protein S18 [Candidatus Riesia pediculicola USDA]
          Length = 76

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++ N   R+K C  + + A  IDYKDI  L  ++++ GKIVPSRI+    K QR+L++AI
Sbjct: 1  MKHNFFRRKKFCRFTAEKAREIDYKDIEKLRNYITESGKIVPSRITGTKVKYQRKLSRAI 60

Query: 70 KRARYLGLIAYVN 82
          K ARYL L+ Y +
Sbjct: 61 KIARYLALLPYTD 73


>gi|223982851|ref|ZP_03633072.1| hypothetical protein HOLDEFILI_00346 [Holdemania filiformis DSM
          12042]
 gi|223965173|gb|EEF69464.1| hypothetical protein HOLDEFILI_00346 [Holdemania filiformis DSM
          12042]
          Length = 76

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +      IDYKD+ LL RF+S  GKI+P R++    K QR LA AIKRAR + 
Sbjct: 10 RKKVCYFTKNNITSIDYKDVELLKRFVSANGKIIPRRVTGTRAKYQRMLATAIKRARQMA 69

Query: 77 LIAYVN 82
          L+ YVN
Sbjct: 70 LLPYVN 75


>gi|332712187|ref|ZP_08432115.1| SSU ribosomal protein S18P [Lyngbya majuscula 3L]
 gi|332348993|gb|EGJ28605.1| SSU ribosomal protein S18P [Lyngbya majuscula 3L]
          Length = 71

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 44/52 (84%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD+ LL +F+++RGKI+P RI++++ ++QR+L  AIKRAR+L L+ Y+N
Sbjct: 17 IDYKDVELLRKFITERGKILPRRITNLTTQQQRKLTTAIKRARFLALLPYIN 68


>gi|320120636|gb|EFE27984.2| 30S ribosomal protein S18 [Filifactor alocis ATCC 35896]
          Length = 77

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 46/69 (66%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
          NV  R+K  P +G     IDYKD+ LL +++S+RGKI+P R++  S K QR+L  AIKRA
Sbjct: 7  NVRKRKKVDPFAGDKINTIDYKDVALLKKYISERGKILPRRVTGTSAKAQRKLTLAIKRA 66

Query: 73 RYLGLIAYV 81
          R + L+ Y 
Sbjct: 67 RNIALLPYT 75


>gi|27364783|ref|NP_760311.1| 30S ribosomal protein S18 [Vibrio vulnificus CMCP6]
 gi|28899512|ref|NP_799117.1| 30S ribosomal protein S18 [Vibrio parahaemolyticus RIMD 2210633]
 gi|37681166|ref|NP_935775.1| 30S ribosomal protein S18 [Vibrio vulnificus YJ016]
 gi|84393175|ref|ZP_00991939.1| 30S ribosomal protein S18 [Vibrio splendidus 12B01]
 gi|86148223|ref|ZP_01066520.1| 30S ribosomal protein S18 [Vibrio sp. MED222]
 gi|91227275|ref|ZP_01261700.1| 30S ribosomal protein S18 [Vibrio alginolyticus 12G01]
 gi|148981037|ref|ZP_01816257.1| 30S ribosomal protein S18 [Vibrionales bacterium SWAT-3]
 gi|149191590|ref|ZP_01869835.1| 30S ribosomal protein S18 [Vibrio shilonii AK1]
 gi|153835847|ref|ZP_01988514.1| ribosomal protein S18 [Vibrio harveyi HY01]
 gi|153846004|ref|ZP_01993817.1| ribosomal protein S18 [Vibrio parahaemolyticus AQ3810]
 gi|156972401|ref|YP_001443308.1| 30S ribosomal protein S18 [Vibrio harveyi ATCC BAA-1116]
 gi|163803111|ref|ZP_02196995.1| 30S ribosomal protein S18 [Vibrio sp. AND4]
 gi|218708334|ref|YP_002415955.1| 30S ribosomal protein S18 [Vibrio splendidus LGP32]
 gi|260366343|ref|ZP_05778789.1| ribosomal protein S18 [Vibrio parahaemolyticus K5030]
 gi|260767147|ref|ZP_05876091.1| SSU ribosomal protein S18p [Vibrio furnissii CIP 102972]
 gi|260773678|ref|ZP_05882594.1| SSU ribosomal protein S18p [Vibrio metschnikovii CIP 69.14]
 gi|260775635|ref|ZP_05884532.1| SSU ribosomal protein S18p [Vibrio coralliilyticus ATCC BAA-450]
 gi|260879410|ref|ZP_05891765.1| ribosomal protein S18 [Vibrio parahaemolyticus AN-5034]
 gi|260896871|ref|ZP_05905367.1| ribosomal protein S18 [Vibrio parahaemolyticus Peru-466]
 gi|260902023|ref|ZP_05910418.1| ribosomal protein S18 [Vibrio parahaemolyticus AQ4037]
 gi|261254037|ref|ZP_05946610.1| SSU ribosomal protein S18p [Vibrio orientalis CIP 102891]
 gi|262393107|ref|YP_003284961.1| 30S ribosomal protein S18p [Vibrio sp. Ex25]
 gi|269961474|ref|ZP_06175838.1| 30S ribosomal protein S18 [Vibrio harveyi 1DA3]
 gi|269964320|ref|ZP_06178568.1| 30S ribosomal protein S18 [Vibrio harveyi 1DA3]
 gi|269964440|ref|ZP_06178681.1| 30S ribosomal protein S18 [Vibrio alginolyticus 40B]
 gi|312881936|ref|ZP_07741693.1| 30S ribosomal protein S18 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|320155177|ref|YP_004187556.1| 30S ribosomal protein S18p [Vibrio vulnificus MO6-24/O]
 gi|323493029|ref|ZP_08098164.1| 30S ribosomal protein S18 [Vibrio brasiliensis LMG 20546]
 gi|323496054|ref|ZP_08101114.1| 30S ribosomal protein S18 [Vibrio sinaloensis DSM 21326]
 gi|54039420|sp|P66479|RS18_VIBVU RecName: Full=30S ribosomal protein S18
 gi|54042152|sp|P66478|RS18_VIBPA RecName: Full=30S ribosomal protein S18
 gi|59798812|sp|Q7MH90|RS18_VIBVY RecName: Full=30S ribosomal protein S18
 gi|166222256|sp|A7MSX6|RS18_VIBHB RecName: Full=30S ribosomal protein S18
 gi|254812965|sp|B7VI66|RS18_VIBSL RecName: Full=30S ribosomal protein S18
 gi|27360928|gb|AAO09838.1| ribosomal protein S18 [Vibrio vulnificus CMCP6]
 gi|28807748|dbj|BAC61001.1| ribosomal protein S18 [Vibrio parahaemolyticus RIMD 2210633]
 gi|37199917|dbj|BAC95746.1| ribosomal protein S18 [Vibrio vulnificus YJ016]
 gi|84376227|gb|EAP93111.1| 30S ribosomal protein S18 [Vibrio splendidus 12B01]
 gi|85833993|gb|EAQ52154.1| 30S ribosomal protein S18 [Vibrio sp. MED222]
 gi|91188669|gb|EAS74958.1| 30S ribosomal protein S18 [Vibrio alginolyticus 12G01]
 gi|145961013|gb|EDK26336.1| 30S ribosomal protein S18 [Vibrionales bacterium SWAT-3]
 gi|148834548|gb|EDL51540.1| 30S ribosomal protein S18 [Vibrio shilonii AK1]
 gi|148865657|gb|EDL66797.1| ribosomal protein S18 [Vibrio harveyi HY01]
 gi|149745013|gb|EDM56315.1| ribosomal protein S18 [Vibrio parahaemolyticus AQ3810]
 gi|156523995|gb|ABU69081.1| hypothetical protein VIBHAR_00021 [Vibrio harveyi ATCC BAA-1116]
 gi|159173103|gb|EDP57935.1| 30S ribosomal protein S18 [Vibrio sp. AND4]
 gi|218321353|emb|CAV17303.1| Ribosomal protein S18 [Vibrio splendidus LGP32]
 gi|260608816|gb|EEX34981.1| SSU ribosomal protein S18p [Vibrio coralliilyticus ATCC BAA-450]
 gi|260612817|gb|EEX38020.1| SSU ribosomal protein S18p [Vibrio metschnikovii CIP 69.14]
 gi|260617868|gb|EEX43043.1| SSU ribosomal protein S18p [Vibrio furnissii CIP 102972]
 gi|260937428|gb|EEX93417.1| SSU ribosomal protein S18p [Vibrio orientalis CIP 102891]
 gi|262336701|gb|ACY50496.1| SSU ribosomal protein S18p [Vibrio sp. Ex25]
 gi|269830778|gb|EEZ84996.1| 30S ribosomal protein S18 [Vibrio alginolyticus 40B]
 gi|269830944|gb|EEZ85155.1| 30S ribosomal protein S18 [Vibrio harveyi 1DA3]
 gi|269833851|gb|EEZ87946.1| 30S ribosomal protein S18 [Vibrio harveyi 1DA3]
 gi|308086286|gb|EFO35981.1| ribosomal protein S18 [Vibrio parahaemolyticus Peru-466]
 gi|308089682|gb|EFO39377.1| ribosomal protein S18 [Vibrio parahaemolyticus AN-5034]
 gi|308109417|gb|EFO46957.1| ribosomal protein S18 [Vibrio parahaemolyticus AQ4037]
 gi|308112694|gb|EFO50234.1| ribosomal protein S18 [Vibrio parahaemolyticus K5030]
 gi|309370372|gb|EFP97867.1| 30S ribosomal protein S18 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|315181337|gb|ADT88251.1| 30S ribosomal protein S18 [Vibrio furnissii NCTC 11218]
 gi|319930489|gb|ADV85353.1| SSU ribosomal protein S18p [Vibrio vulnificus MO6-24/O]
 gi|323312727|gb|EGA65856.1| 30S ribosomal protein S18 [Vibrio brasiliensis LMG 20546]
 gi|323318798|gb|EGA71749.1| 30S ribosomal protein S18 [Vibrio sinaloensis DSM 21326]
 gi|328472355|gb|EGF43225.1| 30S ribosomal protein S18 [Vibrio parahaemolyticus 10329]
          Length = 75

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 43/59 (72%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+  S K QR+LA+AIKR+RYL L+ Y +
Sbjct: 14 TAEGVQEIDYKDVATLKNYITEAGKIVPSRITGTSAKYQRQLARAIKRSRYLALLPYTD 72


>gi|297585576|ref|YP_003701356.1| 30S ribosomal protein S18 [Bacillus selenitireducens MLS10]
 gi|297144033|gb|ADI00791.1| ribosomal protein S18 [Bacillus selenitireducens MLS10]
          Length = 75

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 48/74 (64%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR    RRK C  +     +IDYKD  LL +F+S+RGKI+P R++  S K QR+L +A
Sbjct: 1  MARRGRPKRRKVCYFTVNKITKIDYKDTDLLKKFISERGKILPRRVTGTSAKYQRQLTRA 60

Query: 69 IKRARYLGLIAYVN 82
          +KR+R + L+ +V 
Sbjct: 61 VKRSRTMALLPFVT 74


>gi|34499093|ref|NP_903308.1| 30S ribosomal protein S18 [Chromobacterium violaceum ATCC 12472]
 gi|59798832|sp|Q7NRY9|RS18_CHRVO RecName: Full=30S ribosomal protein S18
 gi|34104944|gb|AAQ61300.1| 30S ribosomal protein S18 [Chromobacterium violaceum ATCC 12472]
          Length = 75

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 46/73 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R +  R+K C  + +G   IDYK + LL  F+++ GKI+P+RI+    + QR+L  AI
Sbjct: 1  MARQLFKRKKFCRFTAEGIKEIDYKSVDLLKDFIAENGKIIPARITGTKARYQRQLTTAI 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L  + Y +
Sbjct: 61 KRARFLAFLPYTD 73


>gi|144514|gb|AAA23134.1| ribosomal protein S18 homolog [Chlamydia muridarum]
          Length = 77

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 4/68 (5%)

Query: 15 SHRRK----SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
           HRRK     CP    G   IDYKD+  L RF+++RGKI+P RI+ VS + Q  LA+A+K
Sbjct: 8  EHRRKRFAKKCPFVSAGWKTIDYKDVVTLKRFITERGKILPRRITGVSSRFQALLAQAVK 67

Query: 71 RARYLGLI 78
          RAR++GL+
Sbjct: 68 RARHVGLL 75


>gi|212697312|ref|ZP_03305440.1| hypothetical protein ANHYDRO_01880 [Anaerococcus hydrogenalis DSM
          7454]
 gi|325848774|ref|ZP_08170284.1| ribosomal protein S18 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|212675761|gb|EEB35368.1| hypothetical protein ANHYDRO_01880 [Anaerococcus hydrogenalis DSM
          7454]
 gi|325480418|gb|EGC83480.1| ribosomal protein S18 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 74

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 48/73 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          +RRN   R+K  P     +  IDYKDI  L RF+S RGKI+P R++ ++ K QRE+ +AI
Sbjct: 1  MRRNFRPRKKVDPFVKDPSKVIDYKDIDTLKRFISDRGKILPRRVTGLNAKHQREITRAI 60

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ Y +
Sbjct: 61 KRARQVALLPYED 73


>gi|254784760|ref|YP_003072188.1| 30S ribosomal protein S18 [Teredinibacter turnerae T7901]
 gi|259494820|sp|C5BN46|RS18_TERTT RecName: Full=30S ribosomal protein S18
 gi|237683566|gb|ACR10830.1| ribosomal protein S18 [Teredinibacter turnerae T7901]
          Length = 75

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  +IDYKD+  L  ++S+ GKIVPSRI+    K QR+LA A+KRARYL L+ Y +
Sbjct: 14 TAEGVKQIDYKDLETLKAYISETGKIVPSRITGTKAKYQRQLATAVKRARYLALLPYTD 72


>gi|256545548|ref|ZP_05472908.1| 30S ribosomal protein S18 [Anaerococcus vaginalis ATCC 51170]
 gi|256398759|gb|EEU12376.1| 30S ribosomal protein S18 [Anaerococcus vaginalis ATCC 51170]
          Length = 74

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 48/73 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          +RRN   R+K  P     +  IDYKDI  L RF+S RGKI+P R++ ++ K QRE+ +AI
Sbjct: 1  MRRNFRPRKKVDPFVKDPSKVIDYKDIDTLKRFVSDRGKILPRRVTGLNAKHQREITRAI 60

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ Y +
Sbjct: 61 KRARQVALLPYED 73


>gi|169351670|ref|ZP_02868608.1| hypothetical protein CLOSPI_02451 [Clostridium spiroforme DSM
          1552]
 gi|169291892|gb|EDS74025.1| hypothetical protein CLOSPI_02451 [Clostridium spiroforme DSM
          1552]
          Length = 76

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R+    R+K C  +      IDYKD+ LL RF+S  GKI+P R++  S K QR LA AI
Sbjct: 3  FRKQRMGRKKVCYFTKNNITYIDYKDVELLKRFVSANGKIIPRRVTGTSAKYQRMLATAI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 63 KRARQMALLPYV 74


>gi|153872064|ref|ZP_02001064.1| Ribosomal protein S18 [Beggiatoa sp. PS]
 gi|152071467|gb|EDN68933.1| Ribosomal protein S18 [Beggiatoa sp. PS]
          Length = 75

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  + +G   IDYKD+ LL  ++++ GKIVPSRI+    K QR+LA A+K AR+L 
Sbjct: 7  RKKYCRFTAEGIKEIDYKDLNLLKGYVTETGKIVPSRITGTRTKYQRQLATAVKLARFLA 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYSD 72


>gi|218246505|ref|YP_002371876.1| 30S ribosomal protein S18 [Cyanothece sp. PCC 8801]
 gi|257059538|ref|YP_003137426.1| 30S ribosomal protein S18 [Cyanothece sp. PCC 8802]
 gi|218166983|gb|ACK65720.1| ribosomal protein S18 [Cyanothece sp. PCC 8801]
 gi|256589704|gb|ACV00591.1| ribosomal protein S18 [Cyanothece sp. PCC 8802]
          Length = 71

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 43/52 (82%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD  LL +F+++RGK++P RI+ ++ K+QR+L KA+KRAR+L L+ +VN
Sbjct: 17 IDYKDTELLRKFITERGKLLPRRITGLTAKQQRDLTKAVKRARFLALLPFVN 68


>gi|163784039|ref|ZP_02178996.1| ribosomal protein S18 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880696|gb|EDP74243.1| ribosomal protein S18 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 79

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  +     R+K C    +G    DYK+I +L  F+S+RGKIVPSRIS    K QR
Sbjct: 1  MANNPAQKPFFQKRKKYCKFCAEGI-EPDYKNIDILKEFISERGKIVPSRISGTCGKHQR 59

Query: 64 ELAKAIKRARYLGLIAYV 81
          +LA AIKRAR L L+ YV
Sbjct: 60 KLAVAIKRARQLALLPYV 77


>gi|239995320|ref|ZP_04715844.1| 30S ribosomal protein S18 [Alteromonas macleodii ATCC 27126]
 gi|332143173|ref|YP_004428911.1| 30S ribosomal protein S18 [Alteromonas macleodii str. 'Deep
          ecotype']
 gi|229470505|sp|B4S011|RS18_ALTMD RecName: Full=30S ribosomal protein S18
 gi|327553195|gb|AEA99913.1| 30S ribosomal protein S18 [Alteromonas macleodii str. 'Deep
          ecotype']
          Length = 75

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+L+ AIKRAR+L L+ Y +
Sbjct: 14 TAEGVTEIDYKDIATLKNYITESGKIVPSRITGTSAKYQRQLSSAIKRARFLALLPYTD 72


>gi|328956391|ref|YP_004373777.1| 30S ribosomal protein S18 [Carnobacterium sp. 17-4]
 gi|328672715|gb|AEB28761.1| 30S ribosomal protein S18 [Carnobacterium sp. 17-4]
          Length = 79

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (63%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK    +      +DYKDI LL RF+S+RG+I+P R++    K QR+L KAIK
Sbjct: 5  RRGGKKRRKVDFFAANHIEHVDYKDIDLLKRFISERGRILPRRVTGTYAKNQRKLTKAIK 64

Query: 71 RARYLGLIAYVN 82
          RAR +GL+ +V 
Sbjct: 65 RARIMGLLPFVT 76


>gi|331007839|ref|ZP_08330938.1| SSU ribosomal protein S18p [gamma proteobacterium IMCC1989]
 gi|330418356|gb|EGG92923.1| SSU ribosomal protein S18p [gamma proteobacterium IMCC1989]
          Length = 76

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  +IDYKD+  L  ++S+ GKIVPSRI+    K QR+L+ AIKRARYL L+ Y +
Sbjct: 14 TAEGTKQIDYKDLETLKAYISETGKIVPSRITGTKAKYQRQLSTAIKRARYLALVPYTD 72


>gi|299820814|ref|ZP_07052703.1| 30S ribosomal protein S18 [Listeria grayi DSM 20601]
 gi|299817835|gb|EFI85070.1| 30S ribosomal protein S18 [Listeria grayi DSM 20601]
          Length = 79

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 44/64 (68%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKR+R + L
Sbjct: 12 KKVCYFTANGITHIDYKDVELLKKFVSERGKILPRRVTGTSAKYQRKLTVAIKRSRQMAL 71

Query: 78 IAYV 81
          + +V
Sbjct: 72 LPFV 75


>gi|323342372|ref|ZP_08082604.1| 30S ribosomal protein S18 [Erysipelothrix rhusiopathiae ATCC
          19414]
 gi|322463484|gb|EFY08678.1| 30S ribosomal protein S18 [Erysipelothrix rhusiopathiae ATCC
          19414]
          Length = 77

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  +      IDYKD+ LL RF+S  GKI+P R++    K QR LA AIKRAR + 
Sbjct: 10 RRKVCYFTKNNVKTIDYKDVELLKRFISANGKIIPRRVTGTKAKYQRPLATAIKRARQMA 69

Query: 77 LIAYVN 82
          L+ YV+
Sbjct: 70 LLPYVS 75


>gi|167755264|ref|ZP_02427391.1| hypothetical protein CLORAM_00769 [Clostridium ramosum DSM 1402]
 gi|237735012|ref|ZP_04565493.1| 30S ribosomal protein S18 [Mollicutes bacterium D7]
 gi|167705314|gb|EDS19893.1| hypothetical protein CLORAM_00769 [Clostridium ramosum DSM 1402]
 gi|229381788|gb|EEO31879.1| 30S ribosomal protein S18 [Coprobacillus sp. D7]
          Length = 76

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 44/73 (60%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R+    R+K C  +      IDYKD+ LL RF+S  GKI+P R++  S K QR LA AI
Sbjct: 3  FRKQRMGRKKVCYFTKNKITYIDYKDVELLKRFVSANGKIIPRRVTGTSAKYQRMLATAI 62

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ YV 
Sbjct: 63 KRARQMALLPYVG 75


>gi|310659868|ref|YP_003937589.1| 30S ribosomal protein S18 [Clostridium sticklandii DSM 519]
 gi|308826646|emb|CBH22684.1| 30S ribosomal subunit protein S18 [Clostridium sticklandii]
          Length = 78

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 46/65 (70%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K  P +GK    IDYKD+ LL +++S+RGKI+P RI+  S K QR+L  AIKR+R + 
Sbjct: 12 RKKVDPFAGKKINMIDYKDVNLLKKYISERGKILPRRITGTSAKAQRKLTLAIKRSRNIA 71

Query: 77 LIAYV 81
          L+ YV
Sbjct: 72 LLPYV 76


>gi|113477197|ref|YP_723258.1| 30S ribosomal protein S18 [Trichodesmium erythraeum IMS101]
 gi|122964596|sp|Q10Y89|RS18_TRIEI RecName: Full=30S ribosomal protein S18
 gi|110168245|gb|ABG52785.1| SSU ribosomal protein S18P [Trichodesmium erythraeum IMS101]
          Length = 72

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 51/67 (76%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R++  P+   G P IDYKD+ LL +++++RGKI+P RI+ ++ K+QR+L K+IKRAR +
Sbjct: 5  YRKRVSPIKP-GDP-IDYKDVELLKKYITERGKIMPRRITGLTSKQQRDLTKSIKRARLV 62

Query: 76 GLIAYVN 82
           L+ YVN
Sbjct: 63 ALLPYVN 69


>gi|11467693|ref|NP_050745.1| ribosomal protein S18 [Guillardia theta]
 gi|6094134|sp|O78488|RR18_GUITH RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|3603018|gb|AAC35679.1| ribosomal protein S18 [Guillardia theta]
          Length = 73

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 49/67 (73%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK+ P+  K    IDYKD+ LL++FL+++GKI+P RI+ ++ K+Q  L KA+KRAR L
Sbjct: 4  FRRKNSPI--KKDDFIDYKDVELLSKFLTEQGKILPRRITGLTMKQQSRLTKAVKRARIL 61

Query: 76 GLIAYVN 82
           L+ ++N
Sbjct: 62 SLLPFIN 68


>gi|16799118|ref|NP_469386.1| 30S ribosomal protein S18 [Listeria innocua Clip11262]
 gi|16802094|ref|NP_463579.1| 30S ribosomal protein S18 [Listeria monocytogenes EGD-e]
 gi|46906277|ref|YP_012666.1| 30S ribosomal protein S18 [Listeria monocytogenes serotype 4b
          str. F2365]
 gi|47092171|ref|ZP_00229963.1| ribosomal protein S18 [Listeria monocytogenes str. 4b H7858]
 gi|47095114|ref|ZP_00232726.1| ribosomal protein S18 [Listeria monocytogenes str. 1/2a F6854]
 gi|116871459|ref|YP_848240.1| 30S ribosomal protein S18 [Listeria welshimeri serovar 6b str.
          SLCC5334]
 gi|217965895|ref|YP_002351573.1| ribosomal protein S18 [Listeria monocytogenes HCC23]
 gi|224498256|ref|ZP_03666605.1| 30S ribosomal protein S18 [Listeria monocytogenes Finland 1988]
 gi|224503029|ref|ZP_03671336.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL R2-561]
 gi|226222691|ref|YP_002756798.1| ribosomal protein S18 [Listeria monocytogenes Clip81459]
 gi|254824725|ref|ZP_05229726.1| rpsR [Listeria monocytogenes FSL J1-194]
 gi|254827477|ref|ZP_05232164.1| ribosomal protein S18 [Listeria monocytogenes FSL N3-165]
 gi|254830661|ref|ZP_05235316.1| 30S ribosomal protein S18 [Listeria monocytogenes 10403S]
 gi|254851788|ref|ZP_05241136.1| rpsR [Listeria monocytogenes FSL R2-503]
 gi|254899633|ref|ZP_05259557.1| 30S ribosomal protein S18 [Listeria monocytogenes J0161]
 gi|254913164|ref|ZP_05263176.1| ribosomal protein S18 [Listeria monocytogenes J2818]
 gi|254930815|ref|ZP_05264174.1| ribosomal protein S18 [Listeria monocytogenes HPB2262]
 gi|254937545|ref|ZP_05269242.1| ribosomal protein S18 [Listeria monocytogenes F6900]
 gi|254992264|ref|ZP_05274454.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J2-064]
 gi|255017794|ref|ZP_05289920.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL F2-515]
 gi|255022435|ref|ZP_05294421.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J1-208]
 gi|255025177|ref|ZP_05297163.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J2-003]
 gi|255030368|ref|ZP_05302319.1| 30S ribosomal protein S18 [Listeria monocytogenes LO28]
 gi|255519953|ref|ZP_05387190.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J1-175]
 gi|284803213|ref|YP_003415078.1| 30S ribosomal protein S18 [Listeria monocytogenes 08-5578]
 gi|284996354|ref|YP_003418122.1| 30S ribosomal protein S18 [Listeria monocytogenes 08-5923]
 gi|289433406|ref|YP_003463278.1| 30S ribosomal protein S18 [Listeria seeligeri serovar 1/2b str.
          SLCC3954]
 gi|290892370|ref|ZP_06555365.1| ribosomal protein S18 [Listeria monocytogenes FSL J2-071]
 gi|300765696|ref|ZP_07075673.1| ribosomal protein S18 [Listeria monocytogenes FSL N1-017]
 gi|54039413|sp|P66462|RS18_LISIN RecName: Full=30S ribosomal protein S18
 gi|54042148|sp|P66461|RS18_LISMO RecName: Full=30S ribosomal protein S18
 gi|59798761|sp|Q725B8|RS18_LISMF RecName: Full=30S ribosomal protein S18
 gi|123463368|sp|A0AEM3|RS18_LISW6 RecName: Full=30S ribosomal protein S18
 gi|254812945|sp|B8DAM0|RS18_LISMH RecName: Full=30S ribosomal protein S18
 gi|259494813|sp|C1KV87|RS18_LISMC RecName: Full=30S ribosomal protein S18
 gi|16409405|emb|CAC98261.1| ribosomal protein S18 [Listeria monocytogenes EGD-e]
 gi|16412460|emb|CAC95272.1| ribosomal protein S18 [Listeria innocua Clip11262]
 gi|46879541|gb|AAT02843.1| ribosomal protein S18 [Listeria monocytogenes serotype 4b str.
          F2365]
 gi|47016459|gb|EAL07380.1| ribosomal protein S18 [Listeria monocytogenes str. 1/2a F6854]
 gi|47019373|gb|EAL10114.1| ribosomal protein S18 [Listeria monocytogenes str. 4b H7858]
 gi|116740337|emb|CAK19455.1| 30S ribosomal protein S18 [Listeria welshimeri serovar 6b str.
          SLCC5334]
 gi|217335165|gb|ACK40959.1| ribosomal protein S18 [Listeria monocytogenes HCC23]
 gi|225875153|emb|CAS03845.1| ribosomal protein S18 [Listeria monocytogenes serotype 4b str.
          CLIP 80459]
 gi|258599854|gb|EEW13179.1| ribosomal protein S18 [Listeria monocytogenes FSL N3-165]
 gi|258605081|gb|EEW17689.1| rpsR [Listeria monocytogenes FSL R2-503]
 gi|258610146|gb|EEW22754.1| ribosomal protein S18 [Listeria monocytogenes F6900]
 gi|284058775|gb|ADB69716.1| 30S ribosomal protein S18 [Listeria monocytogenes 08-5578]
 gi|284061821|gb|ADB72760.1| 30S ribosomal protein S18 [Listeria monocytogenes 08-5923]
 gi|289169650|emb|CBH26186.1| 30S ribosomal protein S18 [Listeria seeligeri serovar 1/2b str.
          SLCC3954]
 gi|290558196|gb|EFD91715.1| ribosomal protein S18 [Listeria monocytogenes FSL J2-071]
 gi|293582357|gb|EFF94389.1| ribosomal protein S18 [Listeria monocytogenes HPB2262]
 gi|293591165|gb|EFF99499.1| ribosomal protein S18 [Listeria monocytogenes J2818]
 gi|293593964|gb|EFG01725.1| rpsR [Listeria monocytogenes FSL J1-194]
 gi|300513569|gb|EFK40639.1| ribosomal protein S18 [Listeria monocytogenes FSL N1-017]
 gi|307569562|emb|CAR82741.1| rpsR [Listeria monocytogenes L99]
 gi|328468374|gb|EGF39380.1| 30S ribosomal protein S18 [Listeria monocytogenes 1816]
 gi|328476182|gb|EGF46888.1| 30S ribosomal protein S18 [Listeria monocytogenes 220]
 gi|332310392|gb|EGJ23487.1| 30S ribosomal protein S18 [Listeria monocytogenes str. Scott A]
          Length = 79

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 44/64 (68%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKR+R + L
Sbjct: 12 KKVCYFTSNGITHIDYKDVELLKKFVSERGKILPRRVTGTSAKYQRKLTVAIKRSRQMAL 71

Query: 78 IAYV 81
          + +V
Sbjct: 72 LPFV 75


>gi|32491010|ref|NP_871264.1| hypothetical protein WGLp261 [Wigglesworthia glossinidia
          endosymbiont of Glossina brevipalpis]
 gi|31340412|sp|Q8D2U3|RS18_WIGBR RecName: Full=30S ribosomal protein S18
 gi|25166216|dbj|BAC24407.1| rpsR [Wigglesworthia glossinidia endosymbiont of Glossina
          brevipalpis]
          Length = 75

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKDI LL  ++++ GKIVPSRI+    + QR+L++A+KRARYL 
Sbjct: 7  RRKFCRFTLEKINNIDYKDIILLKNYITENGKIVPSRITGTRARYQRQLSRAVKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>gi|294501974|ref|YP_003565674.1| 30S ribosomal protein S18 [Bacillus megaterium QM B1551]
 gi|295707325|ref|YP_003600400.1| 30S ribosomal protein S18 [Bacillus megaterium DSM 319]
 gi|294351911|gb|ADE72240.1| 30S ribosomal protein S18 [Bacillus megaterium QM B1551]
 gi|294804984|gb|ADF42050.1| 30S ribosomal protein S18 [Bacillus megaterium DSM 319]
          Length = 79

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ +L +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ Y
Sbjct: 16 CFFTANGITHIDYKDVDMLKKFVSERGKILPRRVTGTSAKYQRKLTIAIKRARQMALLPY 75

Query: 81 VN 82
          V+
Sbjct: 76 VS 77


>gi|329896991|ref|ZP_08271784.1| SSU ribosomal protein S18p [gamma proteobacterium IMCC3088]
 gi|328921499|gb|EGG28884.1| SSU ribosomal protein S18p [gamma proteobacterium IMCC3088]
          Length = 75

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  +IDYKD+  L  ++++ GKIVPSRI+    K QR+LA A+KRARYL L+ Y +
Sbjct: 14 TAEGVKQIDYKDLETLKAYITETGKIVPSRITGTKAKYQRQLATAVKRARYLALLPYTD 72


>gi|298372706|ref|ZP_06982696.1| ribosomal protein S18 [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275610|gb|EFI17161.1| ribosomal protein S18 [Bacteroidetes oral taxon 274 str. F0058]
          Length = 93

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R+K C     G   IDYKD   L +FL+++GKI+P RI+  S K QR++A+A+KRAR+L
Sbjct: 23 NRKKYCRFKKSGIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRKVAQAVKRARHL 82

Query: 76 GLIAYVN 82
           L+ YV 
Sbjct: 83 ALLPYVT 89


>gi|261414896|ref|YP_003248579.1| ribosomal protein S18 [Fibrobacter succinogenes subsp.
          succinogenes S85]
 gi|261371352|gb|ACX74097.1| ribosomal protein S18 [Fibrobacter succinogenes subsp.
          succinogenes S85]
 gi|302326241|gb|ADL25442.1| ribosomal protein S18 [Fibrobacter succinogenes subsp.
          succinogenes S85]
          Length = 83

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K+C  +      IDYKD + L RF+S+RGKI+P RIS  S K QR L +AIKRAR + 
Sbjct: 14 RKKTCWFTENNVKFIDYKDEKTLRRFISERGKIIPRRISGTSAKYQRMLNEAIKRARQMA 73

Query: 77 LIAYVN 82
          ++ +V+
Sbjct: 74 ILPFVS 79


>gi|52082634|ref|YP_081425.1| 30S ribosomal protein S18 [Bacillus licheniformis ATCC 14580]
 gi|52788033|ref|YP_093862.1| 30S ribosomal protein S18 [Bacillus licheniformis ATCC 14580]
 gi|319648500|ref|ZP_08002716.1| 30S ribosomal protein S18 [Bacillus sp. BT1B_CT2]
 gi|81690794|sp|Q65CP5|RS18_BACLD RecName: Full=30S ribosomal protein S18
 gi|52005845|gb|AAU25787.1| ribosomal protein S18 [Bacillus licheniformis ATCC 14580]
 gi|52350535|gb|AAU43169.1| RpsR [Bacillus licheniformis ATCC 14580]
 gi|317389579|gb|EFV70390.1| 30S ribosomal protein S18 [Bacillus sp. BT1B_CT2]
          Length = 79

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 42/61 (68%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ Y
Sbjct: 16 CYFTSNGITHIDYKDVDLLRKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPY 75

Query: 81 V 81
          V
Sbjct: 76 V 76


>gi|467373|dbj|BAA05219.1| ribosomal protein S18 [Bacillus subtilis]
          Length = 81

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIKRAR + L+ Y
Sbjct: 18 CYFTSNGITHIDYKDVDLLKKFVSERGKILPRRVTGTNAKYQRKLTAAIKRARQMALLPY 77

Query: 81 VN 82
          V+
Sbjct: 78 VS 79


>gi|89100929|ref|ZP_01173776.1| ribosomal protein S18 [Bacillus sp. NRRL B-14911]
 gi|89084338|gb|EAR63492.1| ribosomal protein S18 [Bacillus sp. NRRL B-14911]
          Length = 81

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIKRAR + L+ Y
Sbjct: 18 CYFTANGITHIDYKDVDLLKKFISERGKILPRRVTGTNAKYQRKLTVAIKRARIMALLPY 77

Query: 81 VN 82
          V+
Sbjct: 78 VS 79


>gi|158337925|ref|YP_001519101.1| 30S ribosomal protein S18 [Acaryochloris marina MBIC11017]
 gi|189029665|sp|B0C2J3|RS18_ACAM1 RecName: Full=30S ribosomal protein S18
 gi|158308166|gb|ABW29783.1| 30S ribosomal protein S18 [Acaryochloris marina MBIC11017]
          Length = 71

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 51/67 (76%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +RR+  P+   G P IDYKD+ LL RF+++RGKI+P RI+ ++ ++QR+L +AIK+AR L
Sbjct: 4  YRRRVSPIK-PGDP-IDYKDVDLLRRFITERGKILPRRITGLTARQQRDLTRAIKQARVL 61

Query: 76 GLIAYVN 82
           L+ ++N
Sbjct: 62 ALLPFIN 68


>gi|149907734|ref|ZP_01896481.1| 30S ribosomal protein S18 [Moritella sp. PE36]
 gi|149809404|gb|EDM69333.1| 30S ribosomal protein S18 [Moritella sp. PE36]
          Length = 75

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 42/60 (70%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+L +AIKRARYL L+ Y +L
Sbjct: 14 TSEGVTEIDYKDIATLKNYVTESGKIVPSRITGTRAKYQRQLGRAIKRARYLSLLPYTDL 73


>gi|332995432|gb|AEF05487.1| 30S ribosomal protein S18 [Alteromonas sp. SN2]
          Length = 75

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          +  G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+L+ AIKRAR+L L+ Y +
Sbjct: 14 TADGVTEIDYKDIATLKNYITESGKIVPSRITGTSAKYQRQLSSAIKRARFLALLPYTD 72


>gi|206895301|ref|YP_002246973.1| ribosomal protein S18 [Coprothermobacter proteolyticus DSM 5265]
 gi|229559979|sp|B5Y876|RS18_COPPD RecName: Full=30S ribosomal protein S18
 gi|206737918|gb|ACI16996.1| ribosomal protein S18 [Coprothermobacter proteolyticus DSM 5265]
          Length = 74

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 41/63 (65%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K CPL   G   +DYKD+  L RF S RGKI+P R++ V    QR L++AIKRAR + L+
Sbjct: 10 KLCPLCADGVREVDYKDVNRLRRFTSDRGKILPRRVTGVCAFHQRSLSRAIKRAREMALL 69

Query: 79 AYV 81
           YV
Sbjct: 70 PYV 72


>gi|205371930|ref|ZP_03224750.1| 30S ribosomal protein S18 [Bacillus coahuilensis m4-4]
          Length = 79

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ Y
Sbjct: 16 CYFTSNNITNIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTTAIKRARMMALLPY 75

Query: 81 VN 82
          V 
Sbjct: 76 VT 77


>gi|293375552|ref|ZP_06621826.1| ribosomal protein S18 [Turicibacter sanguinis PC909]
 gi|325845115|ref|ZP_08168426.1| ribosomal protein S18 [Turicibacter sp. HGF1]
 gi|292645769|gb|EFF63805.1| ribosomal protein S18 [Turicibacter sanguinis PC909]
 gi|325488857|gb|EGC91255.1| ribosomal protein S18 [Turicibacter sp. HGF1]
          Length = 77

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (67%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C  +     +IDYKD+ LL RF+S RGKI+P R++  S K QREL  AIKRAR++ L+
Sbjct: 13 KVCYFTTNKITKIDYKDVDLLKRFVSDRGKILPRRVTGTSAKYQRELTVAIKRARHMALL 72

Query: 79 AY 80
           +
Sbjct: 73 PF 74


>gi|15600127|ref|NP_253621.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa PAO1]
 gi|107104033|ref|ZP_01367951.1| hypothetical protein PaerPA_01005106 [Pseudomonas aeruginosa
          PACS2]
 gi|116053083|ref|YP_793402.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152988792|ref|YP_001350982.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa PA7]
 gi|218894029|ref|YP_002442898.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa LESB58]
 gi|254238351|ref|ZP_04931674.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa C3719]
 gi|254244175|ref|ZP_04937497.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa 2192]
 gi|296391774|ref|ZP_06881249.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa PAb1]
 gi|313109936|ref|ZP_07795864.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa 39016]
 gi|20978739|sp|Q9HUN0|RS18_PSEAE RecName: Full=30S ribosomal protein S18
 gi|122256904|sp|Q02F84|RS18_PSEAB RecName: Full=30S ribosomal protein S18
 gi|166220975|sp|A6VD47|RS18_PSEA7 RecName: Full=30S ribosomal protein S18
 gi|226735123|sp|B7V1Z7|RS18_PSEA8 RecName: Full=30S ribosomal protein S18
 gi|9951213|gb|AAG08319.1|AE004906_7 30S ribosomal protein S18 [Pseudomonas aeruginosa PAO1]
 gi|115588304|gb|ABJ14319.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170282|gb|EAZ55793.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa C3719]
 gi|126197553|gb|EAZ61616.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa 2192]
 gi|150963950|gb|ABR85975.1| ribosomal protein S18 [Pseudomonas aeruginosa PA7]
 gi|218774257|emb|CAW30074.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa LESB58]
 gi|310882366|gb|EFQ40960.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa 39016]
          Length = 76

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++S+ GKIVPSRI+    K QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLNTLKAYVSETGKIVPSRITGTKAKYQRQLATAIKRARYLALLPYTD 72


>gi|295425406|ref|ZP_06818104.1| 30S ribosomal protein S18 [Lactobacillus amylolyticus DSM 11664]
 gi|295064908|gb|EFG55818.1| 30S ribosomal protein S18 [Lactobacillus amylolyticus DSM 11664]
          Length = 77

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 42/51 (82%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          +DYKD+ LL RF+S+RGKI+P R++  S K QR++AKAIKRAR +GL+ +V
Sbjct: 24 VDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKVAKAIKRARIMGLLPFV 74


>gi|163790927|ref|ZP_02185350.1| 30S ribosomal protein S18 [Carnobacterium sp. AT7]
 gi|159873769|gb|EDP67850.1| 30S ribosomal protein S18 [Carnobacterium sp. AT7]
          Length = 79

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 46/72 (63%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK    +      +DYKD+ LL RF+S+RG+I+P R++    K QR+L KAIK
Sbjct: 5  RRGGKKRRKVDFFAANHIEHVDYKDVDLLKRFISERGRILPRRVTGTYAKNQRKLTKAIK 64

Query: 71 RARYLGLIAYVN 82
          RAR +GL+ +V 
Sbjct: 65 RARIMGLLPFVT 76


>gi|89898004|ref|YP_515114.1| 30S ribosomal protein S18 [Chlamydophila felis Fe/C-56]
 gi|329943157|ref|ZP_08291931.1| ribosomal protein S18 [Chlamydophila psittaci Cal10]
 gi|332287739|ref|YP_004422640.1| 30S ribosomal protein S18 [Chlamydophila psittaci 6BC]
 gi|123763226|sp|Q255R9|RS18_CHLFF RecName: Full=30S ribosomal protein S18
 gi|89331376|dbj|BAE80969.1| 30S ribosomal protein S18 [Chlamydophila felis Fe/C-56]
 gi|313848310|emb|CBY17313.1| 30S ribosomal protein S18 [Chlamydophila psittaci RD1]
 gi|325507290|gb|ADZ18928.1| 30S ribosomal protein S18 [Chlamydophila psittaci 6BC]
 gi|328814704|gb|EGF84694.1| ribosomal protein S18 [Chlamydophila psittaci Cal10]
 gi|328914993|gb|AEB55826.1| ribosomal protein S18 [Chlamydophila psittaci 6BC]
          Length = 82

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 45/73 (61%), Gaps = 4/73 (5%)

Query: 13 NVSHRRK----SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          N  HRRK     CP    G   IDYKD   L +F+++RGKI+P RI+ VS + Q  L  A
Sbjct: 7  NNEHRRKRFNKKCPFVSAGWKTIDYKDTETLKKFITERGKILPRRITGVSSRFQGILTLA 66

Query: 69 IKRARYLGLIAYV 81
          IKRAR++G + +V
Sbjct: 67 IKRARHIGFLPFV 79


>gi|74318121|ref|YP_315861.1| 30S ribosomal protein S18 [Thiobacillus denitrificans ATCC 25259]
 gi|74057616|gb|AAZ98056.1| ribosomal protein S18 [Thiobacillus denitrificans ATCC 25259]
          Length = 95

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 46/72 (63%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  RRK C  + +    +DYKD+ +L  F+++ G+I+P+RI+      QR+L  AIKR
Sbjct: 23 RGLFKRRKFCRFTAEKVVEVDYKDVDVLKEFIAENGRIIPARITGTKAHYQRQLGTAIKR 82

Query: 72 ARYLGLIAYVNL 83
          AR+L L+ Y +L
Sbjct: 83 ARFLALMPYTDL 94


>gi|50812313|ref|NP_391969.2| 30S ribosomal protein S18 [Bacillus subtilis subsp. subtilis str.
          168]
 gi|221312071|ref|ZP_03593918.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. subtilis str.
          168]
 gi|221316396|ref|ZP_03598201.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. subtilis str.
          NCIB 3610]
 gi|221321309|ref|ZP_03602603.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. subtilis str.
          JH642]
 gi|221325592|ref|ZP_03606886.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. subtilis str.
          SMY]
 gi|296330018|ref|ZP_06872502.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. spizizenii
          ATCC 6633]
 gi|305676742|ref|YP_003868414.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. spizizenii
          str. W23]
 gi|321313649|ref|YP_004205936.1| 30S ribosomal protein S18 [Bacillus subtilis BSn5]
 gi|585940|sp|P21475|RS18_BACSU RecName: Full=30S ribosomal protein S18; AltName: Full=BS21
 gi|32468848|emb|CAB16126.2| ribosomal protein S18 [Bacillus subtilis subsp. subtilis str.
          168]
 gi|296153057|gb|EFG93922.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. spizizenii
          ATCC 6633]
 gi|305414986|gb|ADM40105.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. spizizenii
          str. W23]
 gi|320019923|gb|ADV94909.1| 30S ribosomal protein S18 [Bacillus subtilis BSn5]
          Length = 79

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIKRAR + L+ Y
Sbjct: 16 CYFTSNGITHIDYKDVDLLKKFVSERGKILPRRVTGTNAKYQRKLTAAIKRARQMALLPY 75

Query: 81 VN 82
          V+
Sbjct: 76 VS 77


>gi|205620144|sp|Q3SH33|RS18_THIDA RecName: Full=30S ribosomal protein S18
          Length = 91

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 46/72 (63%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  RRK C  + +    +DYKD+ +L  F+++ G+I+P+RI+      QR+L  AIKR
Sbjct: 19 RGLFKRRKFCRFTAEKVVEVDYKDVDVLKEFIAENGRIIPARITGTKAHYQRQLGTAIKR 78

Query: 72 ARYLGLIAYVNL 83
          AR+L L+ Y +L
Sbjct: 79 ARFLALMPYTDL 90


>gi|282882898|ref|ZP_06291503.1| ribosomal protein S18 [Peptoniphilus lacrimalis 315-B]
 gi|300813419|ref|ZP_07093767.1| ribosomal protein S18 [Peptoniphilus sp. oral taxon 836 str.
          F0141]
 gi|281297309|gb|EFA89800.1| ribosomal protein S18 [Peptoniphilus lacrimalis 315-B]
 gi|300512469|gb|EFK39621.1| ribosomal protein S18 [Peptoniphilus sp. oral taxon 836 str.
          F0141]
          Length = 74

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 47/71 (66%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++R  + R+K  P       +IDYKD+ +L  ++S+RGKI+P RI+ ++ K QRE+  AI
Sbjct: 1  MQRRFTRRKKVDPFEKDKTKKIDYKDVDMLRNYISERGKILPRRITGLNAKHQREMTVAI 60

Query: 70 KRARYLGLIAY 80
          KRAR + LI Y
Sbjct: 61 KRARQIALIPY 71


>gi|11466410|ref|NP_038414.1| ribosomal protein S18 [Mesostigma viride]
 gi|12230596|sp|Q9MUP6|RR18_MESVI RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|7259553|gb|AAF43854.1|AF166114_66 ribosomal protein S18 [Mesostigma viride]
          Length = 71

 Score = 67.4 bits (163), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 52/66 (78%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR++ P+  K    IDYK+I LL++F++++GKI+P R++++S K+QR + KAIK+AR+L 
Sbjct: 5  RRRTSPI--KPTDSIDYKNIDLLSQFITEQGKILPRRVNNISAKQQRAITKAIKQARFLT 62

Query: 77 LIAYVN 82
          L+ ++N
Sbjct: 63 LLPFLN 68


>gi|260101870|ref|ZP_05752107.1| 30S ribosomal protein S18 [Lactobacillus helveticus DSM 20075]
 gi|260084298|gb|EEW68418.1| 30S ribosomal protein S18 [Lactobacillus helveticus DSM 20075]
          Length = 76

 Score = 67.4 bits (163), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 46/65 (70%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK   ++      +DYKD+ LL RF+S+RGKI+P R++  S K QR++A AIKRAR +G
Sbjct: 9  RRKVDYIAANHIDYVDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKVANAIKRARIMG 68

Query: 77 LIAYV 81
          L+ +V
Sbjct: 69 LLPFV 73


>gi|229825620|ref|ZP_04451689.1| hypothetical protein GCWU000182_00982 [Abiotrophia defectiva ATCC
          49176]
 gi|229790183|gb|EEP26297.1| hypothetical protein GCWU000182_00982 [Abiotrophia defectiva ATCC
          49176]
          Length = 92

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR +  R+K C L+ +    +DYKD   L +F+S+RGKI+P RI+  S + QR L  AIK
Sbjct: 20 RRPMHRRKKVCALTPEELDNLDYKDAAKLKKFISERGKILPRRITGTSARHQRILTTAIK 79

Query: 71 RARYLGLIAYV 81
          RAR+L LI YV
Sbjct: 80 RARHLALIPYV 90


>gi|319651070|ref|ZP_08005204.1| ribosomal protein S18 [Bacillus sp. 2_A_57_CT2]
 gi|317397240|gb|EFV77944.1| ribosomal protein S18 [Bacillus sp. 2_A_57_CT2]
          Length = 79

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIKRAR + L+ Y
Sbjct: 16 CFFTANGITHIDYKDVDLLKKFISERGKILPRRVTGTNAKYQRKLTIAIKRARQMALLPY 75

Query: 81 VN 82
          V+
Sbjct: 76 VS 77


>gi|254283309|ref|ZP_04958277.1| ribosomal protein S18 [gamma proteobacterium NOR51-B]
 gi|219679512|gb|EED35861.1| ribosomal protein S18 [gamma proteobacterium NOR51-B]
          Length = 75

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L +++++ GKIVPSRI+    K QR+LA A+KRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLETLKQYVTETGKIVPSRITGTKAKYQRQLATAVKRARYLALLPYSD 72


>gi|172038260|ref|YP_001804761.1| 30S ribosomal protein S18 [Cyanothece sp. ATCC 51142]
 gi|171699714|gb|ACB52695.1| 30S ribosomal protein S18 [Cyanothece sp. ATCC 51142]
          Length = 71

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 48/67 (71%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R++  P+  K    IDYKD  LL +F+++RGKI+P RI+ ++ K+QR L  A+KRAR+L
Sbjct: 4  YRKRLSPIPPKQP--IDYKDTELLRKFITERGKILPRRITGLTAKQQRALTSAVKRARFL 61

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 62 ALLPFVN 68


>gi|126660661|ref|ZP_01731762.1| 30S ribosomal protein S18 [Cyanothece sp. CCY0110]
 gi|126618054|gb|EAZ88822.1| 30S ribosomal protein S18 [Cyanothece sp. CCY0110]
          Length = 71

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 48/67 (71%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R++  P+  K    IDYKD  LL +F+++RGKI+P RI+ ++ K+QR L  A+KRAR+L
Sbjct: 4  YRKRLSPIPPKQP--IDYKDTELLRKFITERGKILPRRITGLTAKQQRALTAAVKRARFL 61

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 62 ALLPFVN 68


>gi|225075138|ref|ZP_03718337.1| hypothetical protein NEIFLAOT_00138 [Neisseria flavescens
          NRL30031/H210]
 gi|241760281|ref|ZP_04758376.1| ribosomal protein S18 [Neisseria flavescens SK114]
 gi|261365214|ref|ZP_05978097.1| ribosomal protein S18 [Neisseria mucosa ATCC 25996]
 gi|261379686|ref|ZP_05984259.1| ribosomal protein S18 [Neisseria subflava NJ9703]
 gi|298368603|ref|ZP_06979921.1| ribosomal protein S18 [Neisseria sp. oral taxon 014 str. F0314]
 gi|319637637|ref|ZP_07992403.1| 30S ribosomal protein S18 [Neisseria mucosa C102]
 gi|224953622|gb|EEG34831.1| hypothetical protein NEIFLAOT_00138 [Neisseria flavescens
          NRL30031/H210]
 gi|241319159|gb|EER55637.1| ribosomal protein S18 [Neisseria flavescens SK114]
 gi|284797348|gb|EFC52695.1| ribosomal protein S18 [Neisseria subflava NJ9703]
 gi|288566476|gb|EFC88036.1| ribosomal protein S18 [Neisseria mucosa ATCC 25996]
 gi|298282606|gb|EFI24093.1| ribosomal protein S18 [Neisseria sp. oral taxon 014 str. F0314]
 gi|317400792|gb|EFV81447.1| 30S ribosomal protein S18 [Neisseria mucosa C102]
          Length = 76

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK C  + +    +DYK + LL  F+S+ GKI+P+RI+      QR+LA A+
Sbjct: 1  MARQSFKRRKFCRFTAEKIQEVDYKQVDLLKDFISENGKIIPARITGTKAHYQRQLATAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|49082502|gb|AAT50651.1| PA4934 [synthetic construct]
          Length = 77

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++S+ GKIVPSRI+    K QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLNTLRAYVSETGKIVPSRITGTKAKYQRQLATAIKRARYLALLPYTD 72


>gi|83644550|ref|YP_432985.1| ribosomal protein S18 [Hahella chejuensis KCTC 2396]
 gi|123739986|sp|Q2SLB4|RS18_HAHCH RecName: Full=30S ribosomal protein S18
 gi|83632593|gb|ABC28560.1| ribosomal protein S18 [Hahella chejuensis KCTC 2396]
          Length = 76

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+ +L  ++++ GKIVPSRI+    + QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDVEVLKGYITETGKIVPSRITGTKARYQRQLATAIKRARYLALLPYTD 72


>gi|297538624|ref|YP_003674393.1| 30S ribosomal protein S18 [Methylotenera sp. 301]
 gi|297257971|gb|ADI29816.1| ribosomal protein S18 [Methylotenera sp. 301]
          Length = 76

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R +  RR+ C  S +G   +DYKD+ LL  F+S+  KI+P+R++    + QR+L  A+
Sbjct: 1  MAREMYKRRRYCRFSAEGIKEVDYKDVDLLKDFISENAKIIPARMTGTKARYQRQLTTAV 60

Query: 70 KRARYLGLIAYVN 82
          K AR+L L+ Y +
Sbjct: 61 KLARFLALLPYTD 73


>gi|114332337|ref|YP_748559.1| 30S ribosomal protein S18 [Nitrosomonas eutropha C91]
 gi|114309351|gb|ABI60594.1| SSU ribosomal protein S18P [Nitrosomonas eutropha C91]
          Length = 92

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 50/79 (63%), Gaps = 5/79 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  PL +R     +K C  + +G  +IDYKD+ LL  F+S+ G+I+P+RI+      QR
Sbjct: 17 MANRPLFKR-----KKFCRFTAEGIKKIDYKDVDLLKDFISENGRIIPARITGTRSYYQR 71

Query: 64 ELAKAIKRARYLGLIAYVN 82
          +L  AI+RAR+L L+ Y +
Sbjct: 72 QLNLAIERARFLALLPYTD 90


>gi|309390332|gb|ADO78212.1| SSU ribosomal protein S18P [Halanaerobium praevalens DSM 2228]
          Length = 71

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 43/65 (66%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R KSC        +IDYKD+R LNR+L+ RGKI+P R++    K Q+ + KA+KRAR + 
Sbjct: 5  RNKSCHFCANENKKIDYKDLRTLNRYLTDRGKIMPRRVTGNCSKHQKLITKAVKRARSVA 64

Query: 77 LIAYV 81
          L+ YV
Sbjct: 65 LLPYV 69


>gi|205562195|sp|Q0ADI8|RS18_NITEC RecName: Full=30S ribosomal protein S18
          Length = 76

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  R+K C  + +G  +IDYKD+ LL  F+S+ G+I+P+RI+      QR+L  AI+R
Sbjct: 4  RPLFKRKKFCRFTAEGIKKIDYKDVDLLKDFISENGRIIPARITGTRSYYQRQLNLAIER 63

Query: 72 ARYLGLIAYVN 82
          AR+L L+ Y +
Sbjct: 64 ARFLALLPYTD 74


>gi|315652548|ref|ZP_07905530.1| 30S ribosomal protein S18 [Eubacterium saburreum DSM 3986]
 gi|315485191|gb|EFU75591.1| 30S ribosomal protein S18 [Eubacterium saburreum DSM 3986]
          Length = 89

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 4/76 (5%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P   LRR    R+K C   G+    IDYKD+  L +++S+RGKI+P RIS    K QRE+
Sbjct: 16 PANGLRR----RKKVCAFCGEKEKAIDYKDVATLRKYISERGKILPRRISGSCAKHQREI 71

Query: 66 AKAIKRARYLGLIAYV 81
            AIK+AR++ L+ YV
Sbjct: 72 TVAIKKARHIALLPYV 87


>gi|302669612|ref|YP_003829572.1| ribosomal protein S18 RpsR [Butyrivibrio proteoclasticus B316]
 gi|302394085|gb|ADL32990.1| ribosomal protein S18 RpsR [Butyrivibrio proteoclasticus B316]
          Length = 87

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 50/81 (61%), Gaps = 2/81 (2%)

Query: 2  AEVAPTPLLRRNVSHRRKS-CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          ++ +  P+ R+   HRRK  C   GK    IDYKD   L +F+S+ GKI+P RI+    K
Sbjct: 6  SDKSDAPMRRKGGMHRRKKVCVFCGKDNV-IDYKDTAKLKKFVSESGKILPRRITGNCAK 64

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QREL  A+KRAR+L L+ YV
Sbjct: 65 HQRELTSAVKRARHLALMPYV 85


>gi|282901219|ref|ZP_06309148.1| Ribosomal protein S18 [Cylindrospermopsis raciborskii CS-505]
 gi|281193919|gb|EFA68887.1| Ribosomal protein S18 [Cylindrospermopsis raciborskii CS-505]
          Length = 71

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 50/67 (74%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +RR+  P+   G P IDYKD+ LL +F+++RGKI+P RI+ ++ ++QR+L  AIKRAR L
Sbjct: 4  YRRRLSPIK-PGEP-IDYKDVELLRKFMTERGKILPRRITGLTSQQQRQLTLAIKRARIL 61

Query: 76 GLIAYVN 82
           ++ ++N
Sbjct: 62 AMLPFIN 68


>gi|166367546|ref|YP_001659819.1| 30S ribosomal protein S18 [Microcystis aeruginosa NIES-843]
 gi|189029681|sp|B0JVN4|RS18_MICAN RecName: Full=30S ribosomal protein S18
 gi|166089919|dbj|BAG04627.1| 30S ribosomal protein S18 [Microcystis aeruginosa NIES-843]
          Length = 71

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 49/67 (73%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R++  P+S      IDYKD  LL +F+++RGKI+P RI+ ++ K+QR+L +A+KRAR +
Sbjct: 4  YRKRLSPISPSQP--IDYKDTELLRKFITERGKILPRRITGLTSKQQRDLTEAVKRARLM 61

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 62 ALLPFVN 68


>gi|238021237|ref|ZP_04601663.1| hypothetical protein GCWU000324_01135 [Kingella oralis ATCC
          51147]
 gi|294669620|ref|ZP_06734687.1| hypothetical protein NEIELOOT_01521 [Neisseria elongata subsp.
          glycolytica ATCC 29315]
 gi|294788326|ref|ZP_06753569.1| ribosomal protein S18 [Simonsiella muelleri ATCC 29453]
 gi|325265837|ref|ZP_08132523.1| 50S ribosomal protein L21 [Kingella denitrificans ATCC 33394]
 gi|329119366|ref|ZP_08248052.1| 50S ribosomal protein L21 [Neisseria bacilliformis ATCC BAA-1200]
 gi|237868217|gb|EEP69223.1| hypothetical protein GCWU000324_01135 [Kingella oralis ATCC
          51147]
 gi|291308533|gb|EFE49776.1| hypothetical protein NEIELOOT_01521 [Neisseria elongata subsp.
          glycolytica ATCC 29315]
 gi|294483757|gb|EFG31441.1| ribosomal protein S18 [Simonsiella muelleri ATCC 29453]
 gi|324982475|gb|EGC18101.1| 50S ribosomal protein L21 [Kingella denitrificans ATCC 33394]
 gi|327464511|gb|EGF10810.1| 50S ribosomal protein L21 [Neisseria bacilliformis ATCC BAA-1200]
 gi|332970412|gb|EGK09404.1| 50S ribosomal protein L21 [Kingella kingae ATCC 23330]
          Length = 76

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 45/73 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK C  + +    +DYK + LL  F+++ GKI+P+RI+      QR+LA A+
Sbjct: 1  MARQTFKRRKFCRFTAEKIQEVDYKQVDLLKDFITENGKIIPARITGTKAHYQRQLAVAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|154688193|ref|YP_001423354.1| 30S ribosomal protein S18 [Bacillus amyloliquefaciens FZB42]
 gi|308175795|ref|YP_003922500.1| 30S ribosomal protein S18 [Bacillus amyloliquefaciens DSM 7]
 gi|154354044|gb|ABS76123.1| RpsR [Bacillus amyloliquefaciens FZB42]
 gi|307608659|emb|CBI45030.1| ribosomal protein S18 [Bacillus amyloliquefaciens DSM 7]
          Length = 81

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (67%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIKRAR + L+ Y
Sbjct: 18 CYFTSNGITHIDYKDVDLLRKFVSERGKILPRRVTGTNAKYQRKLTIAIKRARQMALLPY 77

Query: 81 VN 82
          V 
Sbjct: 78 VT 79


>gi|300869626|ref|ZP_07114206.1| 30S ribosomal protein S18 [Oscillatoria sp. PCC 6506]
 gi|300332404|emb|CBN59406.1| 30S ribosomal protein S18 [Oscillatoria sp. PCC 6506]
          Length = 71

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (71%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RR+  P+   G P IDYKD+ LL +F+++RGKI+P RI+ ++ K+QR+L   IKRAR L
Sbjct: 4  FRRRVSPIK-PGDP-IDYKDVDLLRKFVTERGKILPRRITGLTAKQQRDLTTGIKRARIL 61

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 62 ALMPFVN 68


>gi|300311392|ref|YP_003775484.1| 30S ribosomal protein S18 [Herbaspirillum seropedicae SmR1]
 gi|300074177|gb|ADJ63576.1| 30S ribosomal subunit S18 protein [Herbaspirillum seropedicae
          SmR1]
          Length = 94

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 43/67 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G  ++DYKD+  L  F+ + GKI+P+R++      QR++  AIKRARYL 
Sbjct: 25 RKKFCRFTAAGVEQVDYKDVDTLKDFVQENGKIMPARLTGTKAHYQRQVDTAIKRARYLA 84

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 85 LLPYTDL 91


>gi|162447065|ref|YP_001620197.1| 30S ribosomal protein S18 [Acholeplasma laidlawii PG-8A]
 gi|205556720|sp|A9NEP1|RS18_ACHLI RecName: Full=30S ribosomal protein S18
 gi|161985172|gb|ABX80821.1| small subunit ribosomal protein S18 [Acholeplasma laidlawii
          PG-8A]
          Length = 80

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 44/65 (67%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +      ID+KD  LL RF+++RGKI+P R++  S K QR LA AIKRAR++ 
Sbjct: 14 RKKVCFFTQNKFTHIDFKDTELLKRFITERGKILPRRVTGTSAKWQRPLAVAIKRARHMA 73

Query: 77 LIAYV 81
          L+ +V
Sbjct: 74 LLPFV 78


>gi|298493170|ref|YP_003723347.1| 30S ribosomal protein S18 ['Nostoc azollae' 0708]
 gi|298235088|gb|ADI66224.1| ribosomal protein S18 ['Nostoc azollae' 0708]
          Length = 71

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 50/67 (74%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +RR+  P+   G P IDYKD+ LL +F+++RGKI+P RI+ ++ ++QREL  AIKRAR +
Sbjct: 4  YRRRLSPIK-PGEP-IDYKDVDLLRKFITERGKILPRRITGLTSQQQRELTLAIKRARIV 61

Query: 76 GLIAYVN 82
           L+ ++N
Sbjct: 62 ALLPFIN 68


>gi|146328891|ref|YP_001210004.1| 30S ribosomal protein S18 [Dichelobacter nodosus VCS1703A]
 gi|205557281|sp|A5EXN0|RS18_DICNV RecName: Full=30S ribosomal protein S18
 gi|146232361|gb|ABQ13339.1| 30S ribosomal protein S18 [Dichelobacter nodosus VCS1703A]
          Length = 71

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 47/69 (68%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          ++ R++ C  + +G   IDYKD+  L  ++++ GKIVP+RI+  +   QR+LA A+KRAR
Sbjct: 1  MARRKRICRFTAEGVKEIDYKDLETLKAYITEVGKIVPARITGTNVFYQRQLATAVKRAR 60

Query: 74 YLGLIAYVN 82
          +L L+ Y +
Sbjct: 61 FLALLPYTD 69


>gi|119488089|ref|ZP_01621533.1| 30S ribosomal protein S18 [Lyngbya sp. PCC 8106]
 gi|119455378|gb|EAW36517.1| 30S ribosomal protein S18 [Lyngbya sp. PCC 8106]
          Length = 71

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 49/67 (73%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RR+  P+  K    IDYK+I LL +F+++RGKI+P RI+ ++ K+QR+L KAIK+AR L
Sbjct: 4  FRRQVSPIDPKTP--IDYKNIELLRKFVTERGKILPRRITGLTCKQQRDLTKAIKQARIL 61

Query: 76 GLIAYVN 82
           ++ +VN
Sbjct: 62 AMLPFVN 68


>gi|86609095|ref|YP_477857.1| 30S ribosomal protein S18 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123724452|sp|Q2JL28|RS18_SYNJB RecName: Full=30S ribosomal protein S18
 gi|86557637|gb|ABD02594.1| ribosomal protein S18 [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 71

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 49/69 (71%), Gaps = 2/69 (2%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          V  RR+  P+   G P I Y D+ LL +F+++RGKI+P RI+ ++ K+QREL  AIKRAR
Sbjct: 2  VYARRRLSPIK-PGEP-IRYTDVELLKKFVTERGKILPRRITGLTAKQQRELTAAIKRAR 59

Query: 74 YLGLIAYVN 82
           +GL+ +VN
Sbjct: 60 IMGLLYFVN 68


>gi|295099557|emb|CBK88646.1| SSU ribosomal protein S18P [Eubacterium cylindroides T2-87]
          Length = 76

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +      IDYKD+ LL RF++  GKI+P R++    K QR LAKAIKRAR + 
Sbjct: 10 RKKVCYFTKNKIKEIDYKDVELLKRFINANGKIIPRRVTGTRAKYQRMLAKAIKRARQMA 69

Query: 77 LIAYV 81
          L+ YV
Sbjct: 70 LLPYV 74


>gi|146283969|ref|YP_001174122.1| 30S ribosomal protein S18 [Pseudomonas stutzeri A1501]
 gi|166220978|sp|A4VQM9|RS18_PSEU5 RecName: Full=30S ribosomal protein S18
 gi|145572174|gb|ABP81280.1| 30S ribosomal protein S18 [Pseudomonas stutzeri A1501]
 gi|327482297|gb|AEA85607.1| 30S ribosomal protein S18 [Pseudomonas stutzeri DSM 4166]
          Length = 76

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLNTLKAYISETGKIVPSRITGTKARYQRQLATAIKRARYLALLPYTD 72


>gi|323487706|ref|ZP_08092964.1| ribosomal protein S18 [Planococcus donghaensis MPA1U2]
 gi|323398440|gb|EGA91228.1| ribosomal protein S18 [Planococcus donghaensis MPA1U2]
          Length = 78

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    R+K C  +      IDYKD  LL +F+S+RGKI+P R++  S K QR+L  AIK
Sbjct: 4  RRGGKKRKKVCYFTSNNITHIDYKDTDLLKKFISERGKILPRRVTGTSAKWQRKLTIAIK 63

Query: 71 RARYLGLIAYV 81
          R+R + L+ +V
Sbjct: 64 RSRIMALLPFV 74


>gi|240144659|ref|ZP_04743260.1| ribosomal protein S18 [Roseburia intestinalis L1-82]
 gi|257203299|gb|EEV01584.1| ribosomal protein S18 [Roseburia intestinalis L1-82]
 gi|291537110|emb|CBL10222.1| SSU ribosomal protein S18P [Roseburia intestinalis M50/1]
 gi|291540345|emb|CBL13456.1| SSU ribosomal protein S18P [Roseburia intestinalis XB6B4]
          Length = 87

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 1/80 (1%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          A+    P+ RR +  R+K C   GK    IDYKD   L R++S+RGKI+P RI+    K 
Sbjct: 7  ADKDGAPMKRRPMHRRKKVCVFCGKDNV-IDYKDTNKLKRYISERGKILPRRITGNCAKH 65

Query: 62 QRELAKAIKRARYLGLIAYV 81
          QR L  AIKRAR++ L+ YV
Sbjct: 66 QRALTVAIKRARHVALMPYV 85


>gi|332685544|ref|YP_004455318.1| 30S ribosomal protein S18p [Melissococcus plutonius ATCC 35311]
 gi|332369553|dbj|BAK20509.1| SSU ribosomal protein S18p [Melissococcus plutonius ATCC 35311]
          Length = 79

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/52 (59%), Positives = 41/52 (78%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKDI LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+ +V+
Sbjct: 25 IDYKDIELLKRFISERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLLPFVS 76


>gi|227508138|ref|ZP_03938187.1| 30S ribosomal protein S18 [Lactobacillus brevis subsp.
          gravesensis ATCC 27305]
 gi|227511162|ref|ZP_03941211.1| 30S ribosomal protein S18 [Lactobacillus buchneri ATCC 11577]
 gi|227523349|ref|ZP_03953398.1| 30S ribosomal protein S18 [Lactobacillus hilgardii ATCC 8290]
 gi|227085644|gb|EEI20956.1| 30S ribosomal protein S18 [Lactobacillus buchneri ATCC 11577]
 gi|227089455|gb|EEI24767.1| 30S ribosomal protein S18 [Lactobacillus hilgardii ATCC 8290]
 gi|227192367|gb|EEI72434.1| 30S ribosomal protein S18 [Lactobacillus brevis subsp.
          gravesensis ATCC 27305]
          Length = 78

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 41/51 (80%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+++V
Sbjct: 25 IDYKDVDLLKRFVSERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLMSFV 75


>gi|205562353|sp|A7ZAU7|RS18_BACA2 RecName: Full=30S ribosomal protein S18
 gi|328555771|gb|AEB26263.1| 30S ribosomal protein S18 [Bacillus amyloliquefaciens TA208]
          Length = 79

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (67%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIKRAR + L+ Y
Sbjct: 16 CYFTSNGITHIDYKDVDLLRKFVSERGKILPRRVTGTNAKYQRKLTIAIKRARQMALLPY 75

Query: 81 VN 82
          V 
Sbjct: 76 VT 77


>gi|229542337|ref|ZP_04431397.1| ribosomal protein S18 [Bacillus coagulans 36D1]
 gi|229326757|gb|EEN92432.1| ribosomal protein S18 [Bacillus coagulans 36D1]
          Length = 79

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ Y
Sbjct: 15 CYFTANHITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTTAIKRARQMALLPY 74

Query: 81 V 81
          V
Sbjct: 75 V 75


>gi|313900367|ref|ZP_07833861.1| ribosomal protein S18 [Clostridium sp. HGF2]
 gi|312954916|gb|EFR36590.1| ribosomal protein S18 [Clostridium sp. HGF2]
          Length = 76

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +      IDYKDI LL RF+S  GKI+P R++    K QR LA AIKRAR + 
Sbjct: 10 RKKVCYFTKNKIESIDYKDIELLKRFISANGKIIPRRVTGTRAKYQRMLATAIKRARQMA 69

Query: 77 LIAYVN 82
          L+ YV+
Sbjct: 70 LLPYVS 75


>gi|138897054|ref|YP_001127507.1| 30S ribosomal protein S18 [Geobacillus thermodenitrificans
          NG80-2]
 gi|134268567|gb|ABO68762.1| Ribosomal protein S18 [Geobacillus thermodenitrificans NG80-2]
          Length = 91

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ Y
Sbjct: 28 CYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPY 87

Query: 81 V 81
          V
Sbjct: 88 V 88


>gi|17231943|ref|NP_488491.1| 30S ribosomal protein S18 [Nostoc sp. PCC 7120]
 gi|75907544|ref|YP_321840.1| 30S ribosomal protein S18 [Anabaena variabilis ATCC 29413]
 gi|20978694|sp|Q8YNW0|RS18_ANASP RecName: Full=30S ribosomal protein S18
 gi|123731561|sp|Q3MDJ1|RS18_ANAVT RecName: Full=30S ribosomal protein S18
 gi|17133587|dbj|BAB76150.1| 30S ribosomal protein S18 [Nostoc sp. PCC 7120]
 gi|75701269|gb|ABA20945.1| SSU ribosomal protein S18P [Anabaena variabilis ATCC 29413]
          Length = 71

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 50/67 (74%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +RR+  P+   G P IDYKD+ LL +F+++RGKI+P RI+ ++ K+QREL  AIKR+R +
Sbjct: 4  YRRRLSPIK-PGEP-IDYKDVDLLRKFITERGKILPRRITGLTAKQQRELTLAIKRSRLV 61

Query: 76 GLIAYVN 82
           L+ ++N
Sbjct: 62 ALLPFIN 68


>gi|229917472|ref|YP_002886118.1| ribosomal protein S18 [Exiguobacterium sp. AT1b]
 gi|229468901|gb|ACQ70673.1| ribosomal protein S18 [Exiguobacterium sp. AT1b]
          Length = 76

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C  +      IDYKD+ LL RF+S+RGKI+P R++  S K QR L  AIKR+R + L+
Sbjct: 12 KVCFFTSNNITHIDYKDVELLKRFVSERGKILPRRVTGTSAKYQRPLTVAIKRSRQMALL 71

Query: 79 AYV 81
           YV
Sbjct: 72 PYV 74


>gi|158520026|ref|YP_001527896.1| ribosomal protein S18 [Desulfococcus oleovorans Hxd3]
 gi|205557251|sp|A8ZRQ2|RS18_DESOH RecName: Full=30S ribosomal protein S18
 gi|158508852|gb|ABW65819.1| ribosomal protein S18 [Desulfococcus oleovorans Hxd3]
          Length = 83

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (61%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P+P  ++ V HRRK C      +  IDYK+ + L  F+++RGKI+P RIS    K QR +
Sbjct: 3  PSPRGKKRVFHRRKYCRFCADSSLPIDYKNPKSLKSFITERGKIIPRRISGTCAKHQRAI 62

Query: 66 AKAIKRARYLGLIAYV 81
           + IKRAR + L+ YV
Sbjct: 63 TREIKRARTIALLPYV 78


>gi|62185391|ref|YP_220176.1| 30S ribosomal protein S18 [Chlamydophila abortus S26/3]
 gi|81312459|sp|Q5L566|RS18_CHLAB RecName: Full=30S ribosomal protein S18
 gi|62148458|emb|CAH64228.1| 30S ribosomal protein S18 [Chlamydophila abortus S26/3]
          Length = 87

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (61%), Gaps = 4/73 (5%)

Query: 13 NVSHRRK----SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          N  HRRK     CP    G   IDYKD   L +F++++GKI+P RI+ VS + Q  L  A
Sbjct: 12 NNEHRRKRFNKKCPFVSAGWKTIDYKDTETLKKFITEKGKILPRRITGVSSRFQGILTLA 71

Query: 69 IKRARYLGLIAYV 81
          IKRAR++G + +V
Sbjct: 72 IKRARHIGFLPFV 84


>gi|59798883|sp|Q82XQ8|RS18_NITEU RecName: Full=30S ribosomal protein S18
          Length = 76

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (66%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  + +G   IDYKDI LL  F+S+ G+I+P+RI+      QR+L  AI+RAR+L 
Sbjct: 9  RKKFCRFTAEGIKHIDYKDIDLLKDFVSENGRIIPARITGTRAYYQRQLNLAIERARFLA 68

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 69 LLPYTD 74


>gi|56422015|ref|YP_149333.1| 30S ribosomal protein S18 [Geobacillus kaustophilus HTA426]
 gi|196249872|ref|ZP_03148568.1| ribosomal protein S18 [Geobacillus sp. G11MC16]
 gi|261420889|ref|YP_003254571.1| 30S ribosomal protein S18 [Geobacillus sp. Y412MC61]
 gi|297531674|ref|YP_003672949.1| ribosomal protein S18 [Geobacillus sp. C56-T3]
 gi|319768560|ref|YP_004134061.1| ribosomal protein S18 [Geobacillus sp. Y412MC52]
 gi|585939|sp|P10806|RS18_BACST RecName: Full=30S ribosomal protein S18; AltName: Full=BS19;
          AltName: Full=BS21
 gi|81675665|sp|Q5KU71|RS18_GEOKA RecName: Full=30S ribosomal protein S18
 gi|205562283|sp|A4ITV8|RS18_GEOTN RecName: Full=30S ribosomal protein S18
 gi|56381857|dbj|BAD77765.1| 30S ribosomal protein S18 (BS21) [Geobacillus kaustophilus
          HTA426]
 gi|196210748|gb|EDY05511.1| ribosomal protein S18 [Geobacillus sp. G11MC16]
 gi|261377346|gb|ACX80089.1| ribosomal protein S18 [Geobacillus sp. Y412MC61]
 gi|297254926|gb|ADI28372.1| ribosomal protein S18 [Geobacillus sp. C56-T3]
 gi|317113426|gb|ADU95918.1| ribosomal protein S18 [Geobacillus sp. Y412MC52]
          Length = 78

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ Y
Sbjct: 15 CYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPY 74

Query: 81 V 81
          V
Sbjct: 75 V 75


>gi|28376983|ref|NP_783875.1| 30S ribosomal protein S18 [Lactobacillus plantarum WCFS1]
 gi|254555178|ref|YP_003061595.1| 30S ribosomal protein S18 [Lactobacillus plantarum JDM1]
 gi|300769114|ref|ZP_07079003.1| 30S ribosomal protein S18 [Lactobacillus plantarum subsp.
          plantarum ATCC 14917]
 gi|308179200|ref|YP_003923328.1| 30S ribosomal protein S18 [Lactobacillus plantarum subsp.
          plantarum ST-III]
 gi|38258549|sp|Q890K0|RS18_LACPL RecName: Full=30S ribosomal protein S18
 gi|28269814|emb|CAD62711.1| ribosomal protein S18 [Lactobacillus plantarum WCFS1]
 gi|254044105|gb|ACT60898.1| 30S ribosomal protein S18 [Lactobacillus plantarum JDM1]
 gi|300493354|gb|EFK28533.1| 30S ribosomal protein S18 [Lactobacillus plantarum subsp.
          plantarum ATCC 14917]
 gi|308044691|gb|ADN97234.1| 30S ribosomal protein S18 [Lactobacillus plantarum subsp.
          plantarum ST-III]
          Length = 78

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/52 (59%), Positives = 40/52 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR +GL+A+V+
Sbjct: 25 IDYKDTDLLRRFISERGKILPRRVTGTSAKNQRSLTIAIKRARIMGLLAFVS 76


>gi|206901836|ref|YP_002251075.1| ribosomal protein S18 [Dictyoglomus thermophilum H-6-12]
 gi|254765427|sp|B5YEW7|RS18_DICT6 RecName: Full=30S ribosomal protein S18
 gi|206740939|gb|ACI19997.1| ribosomal protein S18 [Dictyoglomus thermophilum H-6-12]
          Length = 84

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 48/79 (60%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          E   T   +   S ++K C    +    IDYK++  L RF++++GKI+P RIS    + Q
Sbjct: 4  EKTSTKAPKFTYSSKKKFCVFCSEKIDYIDYKNVERLKRFMTEKGKIIPRRISGNCARHQ 63

Query: 63 RELAKAIKRARYLGLIAYV 81
          R+L+ AIKRARY+ L+ YV
Sbjct: 64 RQLSTAIKRARYMALLPYV 82


>gi|30248220|ref|NP_840290.1| 30S ribosomal protein S18 [Nitrosomonas europaea ATCC 19718]
 gi|30180105|emb|CAD84107.1| Ribosomal protein S18 [Nitrosomonas europaea ATCC 19718]
          Length = 92

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 49/79 (62%), Gaps = 5/79 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  PL +R     +K C  + +G   IDYKDI LL  F+S+ G+I+P+RI+      QR
Sbjct: 17 MANRPLFKR-----KKFCRFTAEGIKHIDYKDIDLLKDFVSENGRIIPARITGTRAYYQR 71

Query: 64 ELAKAIKRARYLGLIAYVN 82
          +L  AI+RAR+L L+ Y +
Sbjct: 72 QLNLAIERARFLALLPYTD 90


>gi|89075972|ref|ZP_01162344.1| 30S ribosomal protein S18 [Photobacterium sp. SKA34]
 gi|90581364|ref|ZP_01237160.1| 30S ribosomal protein S18 [Vibrio angustum S14]
 gi|262275142|ref|ZP_06052953.1| SSU ribosomal protein S18p [Grimontia hollisae CIP 101886]
 gi|269103597|ref|ZP_06156294.1| SSU ribosomal protein S18p [Photobacterium damselae subsp.
          damselae CIP 102761]
 gi|330445015|ref|ZP_08308669.1| ribosomal protein S18 [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
 gi|89048321|gb|EAR53900.1| 30S ribosomal protein S18 [Photobacterium sp. SKA34]
 gi|90437474|gb|EAS62669.1| 30S ribosomal protein S18 [Vibrio angustum S14]
 gi|262221705|gb|EEY73019.1| SSU ribosomal protein S18p [Grimontia hollisae CIP 101886]
 gi|268163495|gb|EEZ41991.1| SSU ribosomal protein S18p [Photobacterium damselae subsp.
          damselae CIP 102761]
 gi|328493133|dbj|GAA03166.1| ribosomal protein S18 [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
          Length = 75

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+LA+AIKR+RYL L+ Y +
Sbjct: 14 TAEGVQEIDYKDVATLKNYITEAGKIVPSRITGTRAKYQRQLARAIKRSRYLALLPYTD 72


>gi|226308|prf||1506337A ribosomal protein S18
          Length = 77

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ Y
Sbjct: 14 CYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPY 73

Query: 81 V 81
          V
Sbjct: 74 V 74


>gi|300812002|ref|ZP_07092458.1| ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus PB2003/044-T3-4]
 gi|300497028|gb|EFK32094.1| ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus PB2003/044-T3-4]
          Length = 78

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 41/51 (80%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          +DYKD+ LL RF+S+RGKI+P R++  S K QR++A AIKRAR +GL+ +V
Sbjct: 25 VDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKVANAIKRARIMGLLPFV 75


>gi|160916101|ref|ZP_02078308.1| hypothetical protein EUBDOL_02128 [Eubacterium dolichum DSM 3991]
 gi|158431825|gb|EDP10114.1| hypothetical protein EUBDOL_02128 [Eubacterium dolichum DSM 3991]
          Length = 76

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +      IDYKD+ LL RF+S  GKI+P R++    K QR LA AIKRAR + 
Sbjct: 10 RKKVCYFTKNKIETIDYKDVELLKRFISANGKIIPRRVTGTRAKYQRMLATAIKRARQMA 69

Query: 77 LIAYVN 82
          L+ YV+
Sbjct: 70 LLPYVS 75


>gi|59712918|ref|YP_205694.1| 30S ribosomal protein S18 [Vibrio fischeri ES114]
 gi|197335451|ref|YP_002157106.1| ribosomal protein S18 [Vibrio fischeri MJ11]
 gi|209696170|ref|YP_002264100.1| 30S ribosomal protein S18 [Aliivibrio salmonicida LFI1238]
 gi|75506909|sp|Q5E2E0|RS18_VIBF1 RecName: Full=30S ribosomal protein S18
 gi|229470510|sp|B6EMP4|RS18_ALISL RecName: Full=30S ribosomal protein S18
 gi|229560080|sp|B5FBQ1|RS18_VIBFM RecName: Full=30S ribosomal protein S18
 gi|59481019|gb|AAW86806.1| 30S ribosomal subunit protein S18 [Vibrio fischeri ES114]
 gi|197316941|gb|ACH66388.1| ribosomal protein S18 [Vibrio fischeri MJ11]
 gi|208010123|emb|CAQ80448.1| 30S ribosomal subunit protein S18 [Aliivibrio salmonicida
          LFI1238]
          Length = 75

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+LA+AIKR+RYL L+ Y +
Sbjct: 14 TAEGVQEIDYKDVATLKNYITEAGKIVPSRITGTRAKYQRQLARAIKRSRYLALLPYTD 72


>gi|212550375|ref|YP_002308692.1| 30S ribosomal protein S18 [Candidatus Azobacteroides
          pseudotrichonymphae genomovar. CFP2]
 gi|212548613|dbj|BAG83281.1| 30S ribosomal protein S18 [Candidatus Azobacteroides
          pseudotrichonymphae genomovar. CFP2]
          Length = 92

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 45/69 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
          +  +R+K C     G   IDYKD   L +FL+++GKI+P RI+  S K Q  +A+A+KRA
Sbjct: 19 DTKNRKKYCRFKKNGIKFIDYKDPEFLKKFLNEQGKILPRRITGTSAKFQHRVAQAVKRA 78

Query: 73 RYLGLIAYV 81
          R+L L+ YV
Sbjct: 79 RHLALLPYV 87


>gi|163857367|ref|YP_001631665.1| 30S ribosomal protein S18 [Bordetella petrii DSM 12804]
 gi|229559965|sp|A9IT96|RS18_BORPD RecName: Full=30S ribosomal protein S18
 gi|163261095|emb|CAP43397.1| 30S ribosomal protein S18 [Bordetella petrii]
          Length = 90

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  +  G   IDYKD+  L  F+ + GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RRKFCRFTAAGVEEIDYKDLDTLRDFVQENGKIIPARLTGTKAHYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LLPYTD 87


>gi|331003444|ref|ZP_08326943.1| hypothetical protein HMPREF0491_01805 [Lachnospiraceae oral taxon
          107 str. F0167]
 gi|330412490|gb|EGG91879.1| hypothetical protein HMPREF0491_01805 [Lachnospiraceae oral taxon
          107 str. F0167]
          Length = 89

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (61%), Gaps = 4/76 (5%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P   LRR    R+K C   G     IDYKD+  L +++S+RGKI+P RIS    K QRE+
Sbjct: 16 PANGLRR----RKKVCTFCGDKEKAIDYKDVATLRKYISERGKILPRRISGSCAKHQREI 71

Query: 66 AKAIKRARYLGLIAYV 81
            AIK+AR++ L+ YV
Sbjct: 72 TVAIKKARHIALLPYV 87


>gi|291561870|emb|CBL40671.1| SSU ribosomal protein S18P [butyrate-producing bacterium SS3/4]
          Length = 88

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 1/81 (1%)

Query: 2  AEVAPTPLLRRNVSHRRKS-CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
           + + +  +RR   HRRK  C   G     IDYKD+  L R++S+RGKI+P RI+    K
Sbjct: 6  GDKSDSSRVRRGGMHRRKKVCVFCGDKNGEIDYKDVNKLKRYVSERGKILPRRITGNCAK 65

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QR L  AIKRAR++ L+ Y 
Sbjct: 66 HQRALTVAIKRARHIALMPYT 86


>gi|311032234|ref|ZP_07710324.1| 30S ribosomal protein S18 [Bacillus sp. m3-13]
          Length = 79

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (67%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD  +L +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ Y
Sbjct: 16 CYFTANGITHIDYKDTDVLKKFVSERGKILPRRVTGTSAKYQRKLTIAIKRARQMALLPY 75

Query: 81 VN 82
          V+
Sbjct: 76 VS 77


>gi|148381563|ref|YP_001256104.1| ribosomal protein S18 [Clostridium botulinum A str. ATCC 3502]
 gi|153932032|ref|YP_001385940.1| 30S ribosomal protein S18 [Clostridium botulinum A str. ATCC
          19397]
 gi|153934477|ref|YP_001389347.1| 30S ribosomal protein S18 [Clostridium botulinum A str. Hall]
 gi|153939405|ref|YP_001392982.1| 30S ribosomal protein S18 [Clostridium botulinum F str.
          Langeland]
 gi|168181093|ref|ZP_02615757.1| ribosomal protein S18 [Clostridium botulinum NCTC 2916]
 gi|168183704|ref|ZP_02618368.1| 30S ribosomal protein S18 [Clostridium botulinum Bf]
 gi|170756238|ref|YP_001783261.1| 30S ribosomal protein S18 [Clostridium botulinum B1 str. Okra]
 gi|170759820|ref|YP_001788968.1| 30S ribosomal protein S18 [Clostridium botulinum A3 str. Loch
          Maree]
 gi|226951078|ref|YP_002806169.1| ribosomal protein S18 [Clostridium botulinum A2 str. Kyoto]
 gi|237797083|ref|YP_002864635.1| 30S ribosomal protein S18 [Clostridium botulinum Ba4 str. 657]
 gi|166220944|sp|A7FZG9|RS18_CLOB1 RecName: Full=30S ribosomal protein S18
 gi|166220945|sp|A5I7Z9|RS18_CLOBH RecName: Full=30S ribosomal protein S18
 gi|166220946|sp|A7GJM2|RS18_CLOBL RecName: Full=30S ribosomal protein S18
 gi|229559977|sp|B1IHQ2|RS18_CLOBK RecName: Full=30S ribosomal protein S18
 gi|229559978|sp|B1KU95|RS18_CLOBM RecName: Full=30S ribosomal protein S18
 gi|254765421|sp|C1FP14|RS18_CLOBJ RecName: Full=30S ribosomal protein S18
 gi|259494803|sp|C3KWH8|RS18_CLOB6 RecName: Full=30S ribosomal protein S18
 gi|148291047|emb|CAL85184.1| 30S ribosomal protein S18 [Clostridium botulinum A str. ATCC
          3502]
 gi|152928076|gb|ABS33576.1| 30S ribosomal protein S18 [Clostridium botulinum A str. ATCC
          19397]
 gi|152930391|gb|ABS35890.1| 30S ribosomal protein S18 [Clostridium botulinum A str. Hall]
 gi|152935301|gb|ABS40799.1| 30S ribosomal protein S18 [Clostridium botulinum F str.
          Langeland]
 gi|169121450|gb|ACA45286.1| 30S ribosomal protein S18 [Clostridium botulinum B1 str. Okra]
 gi|169406809|gb|ACA55220.1| 30S ribosomal protein S18 [Clostridium botulinum A3 str. Loch
          Maree]
 gi|182668122|gb|EDT80101.1| ribosomal protein S18 [Clostridium botulinum NCTC 2916]
 gi|182673233|gb|EDT85194.1| 30S ribosomal protein S18 [Clostridium botulinum Bf]
 gi|226841199|gb|ACO83865.1| ribosomal protein S18 [Clostridium botulinum A2 str. Kyoto]
 gi|229260880|gb|ACQ51913.1| 30S ribosomal protein S18 [Clostridium botulinum Ba4 str. 657]
 gi|295320957|gb|ADG01335.1| 30S ribosomal protein S18 [Clostridium botulinum F str. 230613]
 gi|322807950|emb|CBZ05525.1| SSU ribosomal protein S18p [Clostridium botulinum H04402 065]
          Length = 80

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK C    + +  IDYKDI  L +F+++RGKI+P RIS    K QREL +AIKRAR + 
Sbjct: 14 KRKVCTFCAEKSEAIDYKDINKLRKFVTERGKILPRRISGNCAKHQRELTRAIKRARNIA 73

Query: 77 LIAYVN 82
          L+ +  
Sbjct: 74 LLPFTT 79


>gi|220933166|ref|YP_002510074.1| ribosomal protein S18 [Halothermothrix orenii H 168]
 gi|219994476|gb|ACL71079.1| ribosomal protein S18 [Halothermothrix orenii H 168]
          Length = 70

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 44/68 (64%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          ++ R K C        ++DYK+++ L RFL+ RGKIVP RI+    K QR+L +AIKRAR
Sbjct: 1  MARRNKPCYFCTNKKAKLDYKEVKTLERFLTNRGKIVPRRITGNCAKHQRQLTRAIKRAR 60

Query: 74 YLGLIAYV 81
           + L+ YV
Sbjct: 61 NIALLPYV 68


>gi|114773242|ref|ZP_01450477.1| 30S ribosomal subunit protein S18 [alpha proteobacterium
          HTCC2255]
 gi|114546361|gb|EAU49270.1| 30S ribosomal subunit protein S18 [alpha proteobacterium
          HTCC2255]
          Length = 75

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          S +G   IDYKD   L  ++++ GKIVPSRI+  S K QR+L+ AIKRAR+L L+ Y +
Sbjct: 14 SAEGVVEIDYKDTATLRNYVTESGKIVPSRITGTSAKYQRQLSTAIKRARFLALLPYTD 72


>gi|15677187|ref|NP_274340.1| 30S ribosomal protein S18 [Neisseria meningitidis MC58]
 gi|59801014|ref|YP_207726.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae FA 1090]
 gi|121635032|ref|YP_975277.1| 30S ribosomal protein S18 [Neisseria meningitidis FAM18]
 gi|161870196|ref|YP_001599366.1| 30S ribosomal protein S18 [Neisseria meningitidis 053442]
 gi|194098898|ref|YP_002001963.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae NCCP11945]
 gi|218768341|ref|YP_002342853.1| 30S ribosomal protein S18 [Neisseria meningitidis Z2491]
 gi|239999181|ref|ZP_04719105.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae 35/02]
 gi|240013911|ref|ZP_04720824.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae DGI18]
 gi|240016353|ref|ZP_04722893.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae FA6140]
 gi|240080472|ref|ZP_04725015.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae FA19]
 gi|240113160|ref|ZP_04727650.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae MS11]
 gi|240115916|ref|ZP_04729978.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID18]
 gi|240118214|ref|ZP_04732276.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID1]
 gi|240121480|ref|ZP_04734442.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID24-1]
 gi|240123762|ref|ZP_04736718.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID332]
 gi|240125953|ref|ZP_04738839.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae SK-92-679]
 gi|240128465|ref|ZP_04741126.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae SK-93-1035]
 gi|254493952|ref|ZP_05107123.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae 1291]
 gi|254805120|ref|YP_003083341.1| 30S ribosomal protein S18 [Neisseria meningitidis alpha14]
 gi|260440269|ref|ZP_05794085.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae DGI2]
 gi|261379073|ref|ZP_05983646.1| ribosomal protein S18 [Neisseria cinerea ATCC 14685]
 gi|268595011|ref|ZP_06129178.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae 35/02]
 gi|268596609|ref|ZP_06130776.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae FA19]
 gi|268599239|ref|ZP_06133406.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae MS11]
 gi|268601586|ref|ZP_06135753.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID18]
 gi|268603925|ref|ZP_06138092.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID1]
 gi|268682388|ref|ZP_06149250.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID332]
 gi|268684546|ref|ZP_06151408.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae SK-92-679]
 gi|268686856|ref|ZP_06153718.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae SK-93-1035]
 gi|291043563|ref|ZP_06569279.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae DGI2]
 gi|293398877|ref|ZP_06643042.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae F62]
 gi|296314492|ref|ZP_06864433.1| ribosomal protein S18 [Neisseria polysaccharea ATCC 43768]
 gi|304387368|ref|ZP_07369560.1| 30S ribosomal protein S18 [Neisseria meningitidis ATCC 13091]
 gi|313668458|ref|YP_004048742.1| 30S ribosomal protein S18 [Neisseria lactamica ST-640]
 gi|60397121|sp|P0A0X6|RS18_NEIMA RecName: Full=30S ribosomal protein S18
 gi|60397126|sp|P0A0X7|RS18_NEIMB RecName: Full=30S ribosomal protein S18
 gi|60397129|sp|P0A0X8|RS18_NEIGO RecName: Full=30S ribosomal protein S18
 gi|75507399|sp|Q5F923|RS18_NEIG1 RecName: Full=30S ribosomal protein S18
 gi|166220963|sp|A1KUE8|RS18_NEIMF RecName: Full=30S ribosomal protein S18
 gi|189029682|sp|A9LZQ1|RS18_NEIM0 RecName: Full=30S ribosomal protein S18
 gi|229560046|sp|B4RMH8|RS18_NEIG2 RecName: Full=30S ribosomal protein S18
 gi|2196759|gb|AAB61230.1| ribosomal protein S18 [Neisseria gonorrhoeae]
 gi|7226563|gb|AAF41696.1| 30S ribosomal protein S18 [Neisseria meningitidis MC58]
 gi|59717909|gb|AAW89314.1| putative 30S ribosomal protein S18 [Neisseria gonorrhoeae FA
          1090]
 gi|120866738|emb|CAM10491.1| 30S ribosomal protein S18 [Neisseria meningitidis FAM18]
 gi|121052349|emb|CAM08681.1| 30S ribosomal protein S18 [Neisseria meningitidis Z2491]
 gi|161595749|gb|ABX73409.1| 30S ribosomal protein S18 [Neisseria meningitidis 053442]
 gi|193934188|gb|ACF30012.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae NCCP11945]
 gi|226512992|gb|EEH62337.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae 1291]
 gi|254668662|emb|CBA06343.1| 30S ribosomal protein S18 [Neisseria meningitidis alpha14]
 gi|254671749|emb|CBA09574.1| 30S ribosomal protein S18 [Neisseria meningitidis alpha153]
 gi|254673115|emb|CBA07862.1| 30S ribosomal protein S18 [Neisseria meningitidis alpha275]
 gi|261392399|emb|CAX49941.1| 30S ribosomal protein S18 [Neisseria meningitidis 8013]
 gi|268548400|gb|EEZ43818.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae 35/02]
 gi|268550397|gb|EEZ45416.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae FA19]
 gi|268583370|gb|EEZ48046.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae MS11]
 gi|268585717|gb|EEZ50393.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID18]
 gi|268588056|gb|EEZ52732.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID1]
 gi|268622672|gb|EEZ55072.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID332]
 gi|268624830|gb|EEZ57230.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae SK-92-679]
 gi|268627140|gb|EEZ59540.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae SK-93-1035]
 gi|269144452|gb|EEZ70870.1| ribosomal protein S18 [Neisseria cinerea ATCC 14685]
 gi|291012026|gb|EFE04015.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae DGI2]
 gi|291610291|gb|EFF39401.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae F62]
 gi|296838794|gb|EFH22732.1| ribosomal protein S18 [Neisseria polysaccharea ATCC 43768]
 gi|304338619|gb|EFM04737.1| 30S ribosomal protein S18 [Neisseria meningitidis ATCC 13091]
 gi|308389439|gb|ADO31759.1| 30S ribosomal protein S18 [Neisseria meningitidis alpha710]
 gi|309379250|emb|CBX22207.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313005920|emb|CBN87377.1| 30S ribosomal protein S18 [Neisseria lactamica 020-06]
 gi|316984123|gb|EFV63101.1| ribosomal protein S18 [Neisseria meningitidis H44/76]
 gi|317164469|gb|ADV08010.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae TCDC-NG08107]
 gi|319410587|emb|CBY90956.1| 30S ribosomal protein S18 [Neisseria meningitidis WUE 2594]
 gi|325128382|gb|EGC51265.1| ribosomal protein S18 [Neisseria meningitidis N1568]
 gi|325130390|gb|EGC53155.1| ribosomal protein S18 [Neisseria meningitidis OX99.30304]
 gi|325132479|gb|EGC55172.1| ribosomal protein S18 [Neisseria meningitidis M6190]
 gi|325134439|gb|EGC57084.1| ribosomal protein S18 [Neisseria meningitidis M13399]
 gi|325136176|gb|EGC58784.1| ribosomal protein S18 [Neisseria meningitidis M0579]
 gi|325138253|gb|EGC60822.1| ribosomal protein S18 [Neisseria meningitidis ES14902]
 gi|325140455|gb|EGC62976.1| ribosomal protein S18 [Neisseria meningitidis CU385]
 gi|325142508|gb|EGC64909.1| ribosomal protein S18 [Neisseria meningitidis 961-5945]
 gi|325144539|gb|EGC66838.1| ribosomal protein S18 [Neisseria meningitidis M01-240013]
 gi|325198472|gb|ADY93928.1| ribosomal protein S18 [Neisseria meningitidis G2136]
 gi|325200054|gb|ADY95509.1| ribosomal protein S18 [Neisseria meningitidis H44/76]
 gi|325201969|gb|ADY97423.1| ribosomal protein S18 [Neisseria meningitidis M01-240149]
 gi|325204320|gb|ADY99773.1| ribosomal protein S18 [Neisseria meningitidis M01-240355]
 gi|325205907|gb|ADZ01360.1| ribosomal protein S18 [Neisseria meningitidis M04-240196]
 gi|325208280|gb|ADZ03732.1| ribosomal protein S18 [Neisseria meningitidis NZ-05/33]
          Length = 76

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK C  + +    +DYK + LL  F+S+ GKI+P+RI+      QR+LA A+
Sbjct: 1  MARQSFKRRKFCRFTAEKIQEVDYKQVDLLKDFISENGKIIPARITGTKAFYQRQLAVAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|15675656|ref|NP_269830.1| 30S ribosomal protein S18 [Streptococcus pyogenes M1 GAS]
 gi|19746762|ref|NP_607898.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS8232]
 gi|21911116|ref|NP_665384.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS315]
 gi|28895199|ref|NP_801549.1| 30S ribosomal protein S18 [Streptococcus pyogenes SSI-1]
 gi|50914911|ref|YP_060883.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS10394]
 gi|71904202|ref|YP_281005.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS6180]
 gi|71911366|ref|YP_282916.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS5005]
 gi|94989188|ref|YP_597289.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS9429]
 gi|94991129|ref|YP_599229.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS10270]
 gi|94993075|ref|YP_601174.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS2096]
 gi|94995008|ref|YP_603106.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS10750]
 gi|139473173|ref|YP_001127888.1| 30S ribosomal protein S18 [Streptococcus pyogenes str. Manfredo]
 gi|195977489|ref|YP_002122733.1| 30S ribosomal protein S18 [Streptococcus equi subsp.
          zooepidemicus MGCS10565]
 gi|222153664|ref|YP_002562841.1| 30S ribosomal protein S18 [Streptococcus uberis 0140J]
 gi|225869195|ref|YP_002745143.1| 30S ribosomal protein S18 [Streptococcus equi subsp.
          zooepidemicus]
 gi|225869851|ref|YP_002745798.1| 30S ribosomal protein S18 [Streptococcus equi subsp. equi 4047]
 gi|251783273|ref|YP_002997578.1| 30S ribosomal protein S18 [Streptococcus dysgalactiae subsp.
          equisimilis GGS_124]
 gi|306826730|ref|ZP_07460032.1| 30S ribosomal protein S18 [Streptococcus pyogenes ATCC 10782]
 gi|313889713|ref|ZP_07823356.1| ribosomal protein S18 [Streptococcus pseudoporcinus SPIN 20026]
 gi|332523695|ref|ZP_08399947.1| ribosomal protein S18 [Streptococcus porcinus str. Jelinkova 176]
 gi|54039418|sp|P66476|RS18_STRP3 RecName: Full=30S ribosomal protein S18
 gi|54039419|sp|P66477|RS18_STRP8 RecName: Full=30S ribosomal protein S18
 gi|54042151|sp|P66475|RS18_STRP1 RecName: Full=30S ribosomal protein S18
 gi|59798612|sp|Q5XA63|RS18_STRP6 RecName: Full=30S ribosomal protein S18
 gi|122986815|sp|Q1J524|RS18_STRPF RecName: Full=30S ribosomal protein S18
 gi|123080292|sp|Q1JF74|RS18_STRPD RecName: Full=30S ribosomal protein S18
 gi|123382262|sp|Q1JA31|RS18_STRPB RecName: Full=30S ribosomal protein S18
 gi|123382494|sp|Q1JK78|RS18_STRPC RecName: Full=30S ribosomal protein S18
 gi|123761392|sp|Q48RL0|RS18_STRPM RecName: Full=30S ribosomal protein S18
 gi|166222246|sp|A2RCR6|RS18_STRPG RecName: Full=30S ribosomal protein S18
 gi|229560067|sp|B4U153|RS18_STREM RecName: Full=30S ribosomal protein S18
 gi|254812956|sp|C0MB81|RS18_STRE4 RecName: Full=30S ribosomal protein S18
 gi|254812959|sp|B9DVK2|RS18_STRU0 RecName: Full=30S ribosomal protein S18
 gi|259494819|sp|C0MEL9|RS18_STRS7 RecName: Full=30S ribosomal protein S18
 gi|13622868|gb|AAK34551.1| 30S ribosomal protein S18 [Streptococcus pyogenes M1 GAS]
 gi|19748993|gb|AAL98397.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS8232]
 gi|21905326|gb|AAM80187.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS315]
 gi|28810445|dbj|BAC63382.1| 30S ribosomal protein S18 [Streptococcus pyogenes SSI-1]
 gi|50903985|gb|AAT87700.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS10394]
 gi|71803297|gb|AAX72650.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS6180]
 gi|71854148|gb|AAZ52171.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS5005]
 gi|94542696|gb|ABF32745.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS9429]
 gi|94544637|gb|ABF34685.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS10270]
 gi|94546583|gb|ABF36630.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS2096]
 gi|94548516|gb|ABF38562.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS10750]
 gi|134271419|emb|CAM29639.1| 30S ribosomal protein S18 [Streptococcus pyogenes str. Manfredo]
 gi|195974194|gb|ACG61720.1| 30S ribosomal protein S18 [Streptococcus equi subsp.
          zooepidemicus MGCS10565]
 gi|222114477|emb|CAR43335.1| 30S ribosomal protein S18 [Streptococcus uberis 0140J]
 gi|225699255|emb|CAW92568.1| 30S ribosomal protein S18 [Streptococcus equi subsp. equi 4047]
 gi|225702471|emb|CAX00375.1| 30S ribosomal protein S18 [Streptococcus equi subsp.
          zooepidemicus]
 gi|242391905|dbj|BAH82364.1| 30S ribosomal protein S18 [Streptococcus dysgalactiae subsp.
          equisimilis GGS_124]
 gi|304431019|gb|EFM34026.1| 30S ribosomal protein S18 [Streptococcus pyogenes ATCC 10782]
 gi|313122010|gb|EFR45106.1| ribosomal protein S18 [Streptococcus pseudoporcinus SPIN 20026]
 gi|322412656|gb|EFY03564.1| 30S ribosomal protein S18 [Streptococcus dysgalactiae subsp.
          dysgalactiae ATCC 27957]
 gi|323127997|gb|ADX25294.1| 30S ribosomal protein S18 [Streptococcus dysgalactiae subsp.
          equisimilis ATCC 12394]
 gi|332314959|gb|EGJ27944.1| ribosomal protein S18 [Streptococcus porcinus str. Jelinkova 176]
          Length = 79

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 11 RRNVSHRRKSCP-LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          RR    RRK    ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  AI
Sbjct: 5  RRGGFKRRKKVDFIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAI 64

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ YVN
Sbjct: 65 KRARVMALMPYVN 77


>gi|161506643|ref|YP_001576591.1| 30S ribosomal protein S18 [Lactobacillus helveticus DPC 4571]
 gi|172048334|sp|A8YW49|RS18_LACH4 RecName: Full=30S ribosomal protein S18
 gi|160347632|gb|ABX26306.1| 30S ribosomal protein S18 [Lactobacillus helveticus DPC 4571]
 gi|328468768|gb|EGF39739.1| 30S ribosomal protein S18 [Lactobacillus helveticus MTCC 5463]
          Length = 77

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 41/51 (80%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          +DYKD+ LL RF+S+RGKI+P R++  S K QR++A AIKRAR +GL+ +V
Sbjct: 24 VDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKVANAIKRARIMGLLPFV 74


>gi|58336363|ref|YP_192948.1| 30S ribosomal protein S18 [Lactobacillus acidophilus NCFM]
 gi|227877549|ref|ZP_03995609.1| 30S ribosomal protein S18 [Lactobacillus crispatus JV-V01]
 gi|227893830|ref|ZP_04011635.1| 30S ribosomal protein S18 [Lactobacillus ultunensis DSM 16047]
 gi|227902586|ref|ZP_04020391.1| 30S ribosomal protein S18 [Lactobacillus acidophilus ATCC 4796]
 gi|256843823|ref|ZP_05549310.1| 30S ribosomal protein S18 [Lactobacillus crispatus 125-2-CHN]
 gi|256849622|ref|ZP_05555054.1| 30S ribosomal protein S18 [Lactobacillus crispatus MV-1A-US]
 gi|262046290|ref|ZP_06019253.1| 30S ribosomal protein S18 [Lactobacillus crispatus MV-3A-US]
 gi|293380899|ref|ZP_06626935.1| 30S ribosomal protein S18 [Lactobacillus crispatus 214-1]
 gi|295691871|ref|YP_003600481.1| 30S ribosomal protein s18 [Lactobacillus crispatus ST1]
 gi|312977110|ref|ZP_07788859.1| ribosomal protein S18 [Lactobacillus crispatus CTV-05]
 gi|315037239|ref|YP_004030807.1| 30S ribosomal protein S18 [Lactobacillus amylovorus GRL 1112]
 gi|325955730|ref|YP_004286340.1| 30S ribosomal protein S18 [Lactobacillus acidophilus 30SC]
 gi|75507681|sp|Q5FN07|RS18_LACAC RecName: Full=30S ribosomal protein S18
 gi|58253680|gb|AAV41917.1| 30S Ribosomal protein S18 [Lactobacillus acidophilus NCFM]
 gi|227862848|gb|EEJ70307.1| 30S ribosomal protein S18 [Lactobacillus crispatus JV-V01]
 gi|227864319|gb|EEJ71740.1| 30S ribosomal protein S18 [Lactobacillus ultunensis DSM 16047]
 gi|227869675|gb|EEJ77096.1| 30S ribosomal protein S18 [Lactobacillus acidophilus ATCC 4796]
 gi|256613728|gb|EEU18930.1| 30S ribosomal protein S18 [Lactobacillus crispatus 125-2-CHN]
 gi|256713738|gb|EEU28727.1| 30S ribosomal protein S18 [Lactobacillus crispatus MV-1A-US]
 gi|260573620|gb|EEX30177.1| 30S ribosomal protein S18 [Lactobacillus crispatus MV-3A-US]
 gi|290922572|gb|EFD99538.1| 30S ribosomal protein S18 [Lactobacillus crispatus 214-1]
 gi|295029977|emb|CBL49456.1| 30S ribosomal protein S18 [Lactobacillus crispatus ST1]
 gi|310896438|gb|EFQ45503.1| ribosomal protein S18 [Lactobacillus crispatus CTV-05]
 gi|312275372|gb|ADQ58012.1| 30S ribosomal protein S18 [Lactobacillus amylovorus GRL 1112]
 gi|323465566|gb|ADX69253.1| 30S ribosomal protein S18 [Lactobacillus helveticus H10]
 gi|325332295|gb|ADZ06203.1| 30S ribosomal protein S18 [Lactobacillus acidophilus 30SC]
 gi|327182558|gb|AEA31005.1| 30S ribosomal protein S18 [Lactobacillus amylovorus GRL 1118]
          Length = 78

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 41/51 (80%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          +DYKD+ LL RF+S+RGKI+P R++  S K QR++A AIKRAR +GL+ +V
Sbjct: 25 VDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKVANAIKRARIMGLLPFV 75


>gi|309776775|ref|ZP_07671749.1| ribosomal protein S18 [Erysipelotrichaceae bacterium 3_1_53]
 gi|308915523|gb|EFP61289.1| ribosomal protein S18 [Erysipelotrichaceae bacterium 3_1_53]
          Length = 76

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +      IDYKD+ LL RF+S  GKI+P R++    K QR LA AIKRAR + 
Sbjct: 10 RKKVCYFTKNKIESIDYKDVELLKRFISANGKIIPRRVTGTRAKYQRMLATAIKRARQMA 69

Query: 77 LIAYVN 82
          L+ YV+
Sbjct: 70 LLPYVS 75


>gi|225677181|ref|ZP_03788177.1| ribosomal protein S18 [Wolbachia endosymbiont of Muscidifurax
          uniraptor]
 gi|225590768|gb|EEH11999.1| ribosomal protein S18 [Wolbachia endosymbiont of Muscidifurax
          uniraptor]
          Length = 91

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 45/70 (64%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R  S R K CPL+      +DYK+I LL++F S  G+I+P R++ V  KKQR+L  AI R
Sbjct: 18 RTGSRRSKVCPLAASKDEDVDYKNIDLLSKFTSDYGRILPRRLTGVCAKKQRKLRLAIIR 77

Query: 72 ARYLGLIAYV 81
          AR+L LI Y 
Sbjct: 78 ARFLALIPYC 87


>gi|22537851|ref|NP_688702.1| 30S ribosomal protein S18 [Streptococcus agalactiae 2603V/R]
 gi|25011796|ref|NP_736191.1| 30S ribosomal protein S18 [Streptococcus agalactiae NEM316]
 gi|76786818|ref|YP_330321.1| 30S ribosomal protein S18 [Streptococcus agalactiae A909]
 gi|76798964|ref|ZP_00781165.1| ribosomal protein S18 [Streptococcus agalactiae 18RS21]
 gi|77406986|ref|ZP_00784002.1| ribosomal protein S18 [Streptococcus agalactiae H36B]
 gi|77410339|ref|ZP_00786755.1| ribosomal protein S18 [Streptococcus agalactiae COH1]
 gi|77412637|ref|ZP_00788913.1| ribosomal protein S18 [Streptococcus agalactiae CJB111]
 gi|228477147|ref|ZP_04061785.1| ribosomal protein S18 [Streptococcus salivarius SK126]
 gi|312863068|ref|ZP_07723306.1| ribosomal protein S18 [Streptococcus vestibularis F0396]
 gi|322516033|ref|ZP_08068970.1| 30S ribosomal protein S18 [Streptococcus vestibularis ATCC 49124]
 gi|59798902|sp|Q8DXY3|RS18_STRA5 RecName: Full=30S ribosomal protein S18
 gi|59798903|sp|Q8E3K2|RS18_STRA3 RecName: Full=30S ribosomal protein S18
 gi|123601328|sp|Q3JZI2|RS18_STRA1 RecName: Full=30S ribosomal protein S18
 gi|22534746|gb|AAN00575.1|AE014269_19 ribosomal protein S18 [Streptococcus agalactiae 2603V/R]
 gi|24413337|emb|CAD47416.1| 30S ribosomal protein S18 [Streptococcus agalactiae NEM316]
 gi|76561875|gb|ABA44459.1| ribosomal protein S18 [Streptococcus agalactiae A909]
 gi|76585685|gb|EAO62242.1| ribosomal protein S18 [Streptococcus agalactiae 18RS21]
 gi|77161309|gb|EAO72344.1| ribosomal protein S18 [Streptococcus agalactiae CJB111]
 gi|77171052|gb|EAO74505.1| ribosomal protein S18 [Streptococcus agalactiae COH1]
 gi|77174410|gb|EAO77263.1| ribosomal protein S18 [Streptococcus agalactiae H36B]
 gi|228251166|gb|EEK10337.1| ribosomal protein S18 [Streptococcus salivarius SK126]
 gi|311100604|gb|EFQ58809.1| ribosomal protein S18 [Streptococcus vestibularis F0396]
 gi|319745682|gb|EFV97981.1| 30S ribosomal protein S18 [Streptococcus agalactiae ATCC 13813]
 gi|322125448|gb|EFX96794.1| 30S ribosomal protein S18 [Streptococcus vestibularis ATCC 49124]
          Length = 79

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 11 RRNVSHRRKSCP-LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          RR    RRK    ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  AI
Sbjct: 5  RRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAI 64

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ YVN
Sbjct: 65 KRARVMALMPYVN 77


>gi|56477753|ref|YP_159342.1| 30S ribosomal protein S18 [Aromatoleum aromaticum EbN1]
 gi|56313796|emb|CAI08441.1| 30S Ribosomal protein S18 [Aromatoleum aromaticum EbN1]
          Length = 91

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 46/72 (63%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  RRK C  + +    +DYKD+ +L  F+++  KI+P+RI+      QR+L+ A+KR
Sbjct: 18 RGLFKRRKFCRFTAEKIEEVDYKDVDILKDFVTENSKIMPARITGTKAGYQRQLSTAVKR 77

Query: 72 ARYLGLIAYVNL 83
          AR+L L+ Y +L
Sbjct: 78 ARFLALLPYTDL 89


>gi|227540353|ref|ZP_03970402.1| ribosomal protein S18 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300771167|ref|ZP_07081043.1| 30S ribosomal protein S18 [Sphingobacterium spiritivorum ATCC
          33861]
 gi|227239677|gb|EEI89692.1| ribosomal protein S18 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300761837|gb|EFK58657.1| 30S ribosomal protein S18 [Sphingobacterium spiritivorum ATCC
          33861]
          Length = 87

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 46/67 (68%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
           +R+K C     G   IDYKD   L +F++ +GKI+P R++  S K QR++A+A+KRAR+
Sbjct: 16 DNRKKYCRFKKNGIKYIDYKDANFLLKFVNDQGKILPRRLTGTSLKFQRKVAQAVKRARH 75

Query: 75 LGLIAYV 81
          +GL+ YV
Sbjct: 76 IGLLPYV 82


>gi|86606307|ref|YP_475070.1| 30S ribosomal protein S18 [Synechococcus sp. JA-3-3Ab]
 gi|123724575|sp|Q2JU22|RS18_SYNJA RecName: Full=30S ribosomal protein S18
 gi|86554849|gb|ABC99807.1| ribosomal protein S18 [Synechococcus sp. JA-3-3Ab]
          Length = 71

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 51/69 (73%), Gaps = 2/69 (2%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          V  RR+  P+   G P I Y D+ LL +F+++RGKI+P RI+ ++ K+QR+++KAIK+AR
Sbjct: 2  VYARRRLSPIK-PGEP-IKYTDVELLKKFVTERGKILPRRITGLTAKQQRQVSKAIKQAR 59

Query: 74 YLGLIAYVN 82
           LGL+ +VN
Sbjct: 60 ILGLLYFVN 68


>gi|313122784|ref|YP_004033043.1| 30S ribosomal protein s18 [Lactobacillus delbrueckii subsp.
          bulgaricus ND02]
 gi|312279347|gb|ADQ60066.1| 30S ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus ND02]
 gi|325685098|gb|EGD27229.1| 30S ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          lactis DSM 20072]
          Length = 78

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 41/51 (80%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          +DYKD+ LL  F+S+RGKI+P R++  S K QR++AKAIKRAR +GL+ +V
Sbjct: 25 VDYKDVDLLKHFISERGKILPRRVTGTSAKNQRKVAKAIKRARIMGLLPFV 75


>gi|159027933|emb|CAO87096.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 71

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 49/67 (73%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R++  P+S      IDYKD  LL +F+++RGK++P RI+ ++ K+QR+L +A+KRAR +
Sbjct: 4  YRKRLSPISPSQP--IDYKDTELLRKFITERGKLLPRRITGLTSKQQRDLTEAVKRARLM 61

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 62 ALLPFVN 68


>gi|282895502|ref|ZP_06303639.1| Ribosomal protein S18 [Raphidiopsis brookii D9]
 gi|281199535|gb|EFA74398.1| Ribosomal protein S18 [Raphidiopsis brookii D9]
          Length = 71

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 49/67 (73%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +RR+  P+   G P IDYKD+ LL +F+++RGKI+P RI+ ++ ++QR+L  AIKRAR L
Sbjct: 4  YRRRLSPIK-PGEP-IDYKDVDLLRKFMTERGKILPRRITGLTSQQQRQLTLAIKRARIL 61

Query: 76 GLIAYVN 82
            + ++N
Sbjct: 62 AFLPFIN 68


>gi|116493585|ref|YP_805319.1| 30S ribosomal protein S18 [Lactobacillus casei ATCC 334]
 gi|191636835|ref|YP_001986001.1| 30S ribosomal protein S18 [Lactobacillus casei BL23]
 gi|199598219|ref|ZP_03211640.1| Ribosomal protein S18 [Lactobacillus rhamnosus HN001]
 gi|227533495|ref|ZP_03963544.1| ribosomal protein S18 [Lactobacillus paracasei subsp. paracasei
          ATCC 25302]
 gi|229551090|ref|ZP_04439815.1| ribosomal protein S18 [Lactobacillus rhamnosus LMS2-1]
 gi|239630816|ref|ZP_04673847.1| SSU ribosomal protein S18P [Lactobacillus paracasei subsp.
          paracasei 8700:2]
 gi|258507008|ref|YP_003169759.1| 30S ribosomal protein S18 [Lactobacillus rhamnosus GG]
 gi|258538205|ref|YP_003172704.1| 30S ribosomal protein S18 [Lactobacillus rhamnosus Lc 705]
 gi|301065139|ref|YP_003787162.1| 30S ribosomal protein L18 [Lactobacillus casei str. Zhang]
 gi|122264952|sp|Q03D45|RS18_LACC3 RecName: Full=30S ribosomal protein S18
 gi|229560041|sp|B3W6R6|RS18_LACCB RecName: Full=30S ribosomal protein S18
 gi|116103735|gb|ABJ68877.1| SSU ribosomal protein S18P [Lactobacillus casei ATCC 334]
 gi|190711137|emb|CAQ65143.1| 30S ribosomal protein S18 [Lactobacillus casei BL23]
 gi|199590822|gb|EDY98907.1| Ribosomal protein S18 [Lactobacillus rhamnosus HN001]
 gi|227188824|gb|EEI68891.1| ribosomal protein S18 [Lactobacillus paracasei subsp. paracasei
          ATCC 25302]
 gi|229315551|gb|EEN81524.1| ribosomal protein S18 [Lactobacillus rhamnosus LMS2-1]
 gi|239527099|gb|EEQ66100.1| SSU ribosomal protein S18P [Lactobacillus paracasei subsp.
          paracasei 8700:2]
 gi|257146935|emb|CAR85908.1| SSU/30S ribosomal protein S18P [Lactobacillus rhamnosus GG]
 gi|257149881|emb|CAR88853.1| SSU/30S ribosomal protein S18P [Lactobacillus rhamnosus Lc 705]
 gi|259648377|dbj|BAI40539.1| 30S ribosomal protein S18 [Lactobacillus rhamnosus GG]
 gi|300437546|gb|ADK17312.1| Ribosomal protein S18 [Lactobacillus casei str. Zhang]
 gi|327380874|gb|AEA52350.1| 30S ribosomal protein S18 [Lactobacillus casei LC2W]
 gi|327384038|gb|AEA55512.1| 30S ribosomal protein S18 [Lactobacillus casei BD-II]
 gi|328463730|gb|EGF35304.1| 30S ribosomal protein S18 [Lactobacillus rhamnosus MTCC 5462]
          Length = 78

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 41/52 (78%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD  LL+RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+ +V+
Sbjct: 25 IDYKDTNLLDRFISERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLLPFVS 76


>gi|293400277|ref|ZP_06644423.1| ribosomal protein S18 [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306677|gb|EFE47920.1| ribosomal protein S18 [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 76

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +      IDYKD+ LL RF+S  GKI+P R++    K QR LA AIKRAR + 
Sbjct: 10 RKKVCYFTKNKIEYIDYKDVELLKRFISANGKIIPRRVTGTRAKYQRMLATAIKRARQMA 69

Query: 77 LIAYVN 82
          L+ YV+
Sbjct: 70 LLPYVS 75


>gi|170692294|ref|ZP_02883457.1| ribosomal protein S18 [Burkholderia graminis C4D1M]
 gi|307729539|ref|YP_003906763.1| 30S ribosomal protein S18 [Burkholderia sp. CCGE1003]
 gi|170142724|gb|EDT10889.1| ribosomal protein S18 [Burkholderia graminis C4D1M]
 gi|307584074|gb|ADN57472.1| ribosomal protein S18 [Burkholderia sp. CCGE1003]
          Length = 91

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G   IDYKDI  L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RKKFCRFTAAGVEYIDYKDIETLKDFIGENGKITPARLTGTKSHYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LVPYTD 87


>gi|116628692|ref|YP_813864.1| ribosomal protein S18 [Lactobacillus gasseri ATCC 33323]
 gi|311111569|ref|ZP_07712966.1| ribosomal protein S18 [Lactobacillus gasseri MV-22]
 gi|122274310|sp|Q047E6|RS18_LACGA RecName: Full=30S ribosomal protein S18
 gi|116094274|gb|ABJ59426.1| SSU ribosomal protein S18P [Lactobacillus gasseri ATCC 33323]
 gi|311066723|gb|EFQ47063.1| ribosomal protein S18 [Lactobacillus gasseri MV-22]
          Length = 77

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 40/51 (78%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+ +V
Sbjct: 24 IDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKLTVAIKRARVMGLLPFV 74


>gi|124112116|ref|YP_001019134.1| ribosomal protein S18 [Chlorokybus atmophyticus]
 gi|205831445|sp|Q19V75|RR18_CHLAT RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|124012224|gb|ABD62248.2| ribosomal protein S18 [Chlorokybus atmophyticus]
          Length = 71

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 53/70 (75%), Gaps = 3/70 (4%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
          N+S RR S P+  K    IDYK+I LL++F++++GKI+P R++ +S K+QR + KAIK+A
Sbjct: 2  NLSRRRVS-PI--KPGETIDYKNIDLLSQFITEQGKILPRRVNGISAKQQRAITKAIKQA 58

Query: 73 RYLGLIAYVN 82
          R+L L+ ++N
Sbjct: 59 RFLALLPFLN 68


>gi|42518093|ref|NP_964023.1| 30S ribosomal protein S18 [Lactobacillus johnsonii NCC 533]
 gi|227889149|ref|ZP_04006954.1| 30S ribosomal protein S18 [Lactobacillus johnsonii ATCC 33200]
 gi|238853347|ref|ZP_04643727.1| ribosomal protein S18 [Lactobacillus gasseri 202-4]
 gi|268318570|ref|YP_003292226.1| ribosomal protein S18 [Lactobacillus johnsonii FI9785]
 gi|282852324|ref|ZP_06261666.1| ribosomal protein S18 [Lactobacillus gasseri 224-1]
 gi|300362670|ref|ZP_07058846.1| 30S ribosomal protein S18 [Lactobacillus gasseri JV-V03]
 gi|59798807|sp|Q74M26|RS18_LACJO RecName: Full=30S ribosomal protein S18
 gi|41582377|gb|AAS07989.1| 30S ribosomal protein S19 [Lactobacillus johnsonii NCC 533]
 gi|227850378|gb|EEJ60464.1| 30S ribosomal protein S18 [Lactobacillus johnsonii ATCC 33200]
 gi|238834035|gb|EEQ26292.1| ribosomal protein S18 [Lactobacillus gasseri 202-4]
 gi|262396945|emb|CAX65959.1| ribosomal protein S18 [Lactobacillus johnsonii FI9785]
 gi|282556066|gb|EFB61686.1| ribosomal protein S18 [Lactobacillus gasseri 224-1]
 gi|300353661|gb|EFJ69533.1| 30S ribosomal protein S18 [Lactobacillus gasseri JV-V03]
 gi|329666400|gb|AEB92348.1| 30S ribosomal protein S19 [Lactobacillus johnsonii DPC 6026]
          Length = 78

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 40/51 (78%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+ +V
Sbjct: 25 IDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKLTVAIKRARVMGLLPFV 75


>gi|301062683|ref|ZP_07203301.1| ribosomal protein S18 [delta proteobacterium NaphS2]
 gi|300443206|gb|EFK07353.1| ribosomal protein S18 [delta proteobacterium NaphS2]
          Length = 93

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 41/71 (57%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R   HRRK C      +  IDYKD+++L  F ++RGKI P RIS    K QR L  AIKR
Sbjct: 19 RKTYHRRKVCKFCADSSLSIDYKDVKILRYFTTERGKITPRRISGNCAKHQRMLTVAIKR 78

Query: 72 ARYLGLIAYVN 82
          AR + L+ Y  
Sbjct: 79 ARNIALLPYTT 89


>gi|118602663|ref|YP_903878.1| 30S ribosomal protein S18 [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
 gi|205617138|sp|A1AWV0|RS18_RUTMC RecName: Full=30S ribosomal protein S18
 gi|118567602|gb|ABL02407.1| SSU ribosomal protein S18P [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
          Length = 84

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G  RIDYKD+  L + +++ GKI PSR++  S K QR+L  AIKRAR+L LI Y
Sbjct: 19 CRFTAAGITRIDYKDVDTLLKNINESGKITPSRMTGTSAKFQRQLTTAIKRARFLALIPY 78

Query: 81 VN 82
           +
Sbjct: 79 TD 80


>gi|55821724|ref|YP_140166.1| 30S ribosomal protein S18 [Streptococcus thermophilus LMG 18311]
 gi|55823644|ref|YP_142085.1| 30S ribosomal protein S18 [Streptococcus thermophilus CNRZ1066]
 gi|116628444|ref|YP_821063.1| 30S ribosomal protein S18 [Streptococcus thermophilus LMD-9]
 gi|81676514|sp|Q5LY50|RS18_STRT1 RecName: Full=30S ribosomal protein S18
 gi|81676666|sp|Q5M2Q5|RS18_STRT2 RecName: Full=30S ribosomal protein S18
 gi|122266961|sp|Q03IV5|RS18_STRTD RecName: Full=30S ribosomal protein S18
 gi|55737709|gb|AAV61351.1| 30S ribosomal protein S18 [Streptococcus thermophilus LMG 18311]
 gi|55739629|gb|AAV63270.1| 30S ribosomal protein S18 [Streptococcus thermophilus CNRZ1066]
 gi|116101721|gb|ABJ66867.1| SSU ribosomal protein S18P [Streptococcus thermophilus LMD-9]
 gi|312279064|gb|ADQ63721.1| 30S ribosomal protein S18 [Streptococcus thermophilus ND03]
          Length = 79

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 45/66 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K   ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  AIKRAR + 
Sbjct: 12 RKKFDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAIKRARVMA 71

Query: 77 LIAYVN 82
          L+ YVN
Sbjct: 72 LMPYVN 77


>gi|172059038|ref|YP_001815498.1| ribosomal protein S18 [Exiguobacterium sibiricum 255-15]
 gi|171991559|gb|ACB62481.1| ribosomal protein S18 [Exiguobacterium sibiricum 255-15]
          Length = 76

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 40/61 (65%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +      IDYKD+ LL RF+S+RGKI+P R++  S K QR L  AIKR+R + LI Y
Sbjct: 14 CYFTSNHITHIDYKDVELLKRFISERGKILPRRVTGTSAKYQRPLTIAIKRSRQMALIPY 73

Query: 81 V 81
          V
Sbjct: 74 V 74


>gi|186475678|ref|YP_001857148.1| 30S ribosomal protein S18 [Burkholderia phymatum STM815]
 gi|229559972|sp|B2JG20|RS18_BURP8 RecName: Full=30S ribosomal protein S18
 gi|184192137|gb|ACC70102.1| ribosomal protein S18 [Burkholderia phymatum STM815]
          Length = 91

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G  +IDYKDI  L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RKKFCRFTAAGVEQIDYKDIDTLKDFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LMPYTD 87


>gi|326799756|ref|YP_004317575.1| 30S ribosomal protein S18 [Sphingobacterium sp. 21]
 gi|326550520|gb|ADZ78905.1| 30S ribosomal protein S18 [Sphingobacterium sp. 21]
          Length = 87

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (67%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
           +R+K C     G   IDYKD   L +F++ +GKI+P R++  S K QR++A+A+KRAR+
Sbjct: 16 DNRKKYCRFKKNGIKYIDYKDANFLLKFVNDQGKILPRRLTGTSLKFQRKVAQAVKRARH 75

Query: 75 LGLIAYVN 82
          +GL+ YV 
Sbjct: 76 IGLLPYVT 83


>gi|29654192|ref|NP_819884.1| 30S ribosomal protein S18 [Coxiella burnetii RSA 493]
 gi|153209209|ref|ZP_01947275.1| ribosomal protein S18 [Coxiella burnetii 'MSU Goat Q177']
 gi|154705894|ref|YP_001424310.1| 30S ribosomal protein S18 [Coxiella burnetii Dugway 5J108-111]
 gi|161829761|ref|YP_001596842.1| 30S ribosomal protein S18 [Coxiella burnetii RSA 331]
 gi|165918540|ref|ZP_02218626.1| ribosomal protein S18 [Coxiella burnetii RSA 334]
 gi|212212682|ref|YP_002303618.1| 30S ribosomal protein S18 [Coxiella burnetii CbuG_Q212]
 gi|212218345|ref|YP_002305132.1| 30S ribosomal protein S18 [Coxiella burnetii CbuK_Q154]
 gi|59798886|sp|Q83D75|RS18_COXBU RecName: Full=30S ribosomal protein S18
 gi|189029674|sp|A9KFL6|RS18_COXBN RecName: Full=30S ribosomal protein S18
 gi|189029675|sp|A9ND52|RS18_COXBR RecName: Full=30S ribosomal protein S18
 gi|29541458|gb|AAO90398.1| SSU ribosomal protein S18P [Coxiella burnetii RSA 493]
 gi|120575464|gb|EAX32088.1| ribosomal protein S18 [Coxiella burnetii 'MSU Goat Q177']
 gi|154355180|gb|ABS76642.1| SSU ribosomal protein S18P [Coxiella burnetii Dugway 5J108-111]
 gi|161761628|gb|ABX77270.1| ribosomal protein S18 [Coxiella burnetii RSA 331]
 gi|165917786|gb|EDR36390.1| ribosomal protein S18 [Coxiella burnetii RSA 334]
 gi|212011092|gb|ACJ18473.1| SSU ribosomal protein S18P [Coxiella burnetii CbuG_Q212]
 gi|212012607|gb|ACJ19987.1| SSU ribosomal protein S18P [Coxiella burnetii CbuK_Q154]
          Length = 73

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C    K    IDYKD+  L  ++ + G++VPSRI+    K QR++++AIK ARYL 
Sbjct: 5  RKKFCAFDAKNLQEIDYKDVNTLKDYIMESGRVVPSRITGTCAKHQRQISRAIKLARYLA 64

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 65 LLPYCD 70


>gi|119897011|ref|YP_932224.1| 30S ribosomal protein S18 [Azoarcus sp. BH72]
 gi|237654323|ref|YP_002890637.1| 30S ribosomal protein S18 [Thauera sp. MZ1T]
 gi|119669424|emb|CAL93337.1| 30S ribosomal protein S18 [Azoarcus sp. BH72]
 gi|237625570|gb|ACR02260.1| ribosomal protein S18 [Thauera sp. MZ1T]
          Length = 91

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 46/72 (63%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  RRK C  + +    +DYKD+ +L  F+++  KI+P+RI+      QR+L+ A+KR
Sbjct: 18 RGLFKRRKFCRFTAEKIEEVDYKDVDILKDFITENAKIMPARITGTKAGYQRQLSVAVKR 77

Query: 72 ARYLGLIAYVNL 83
          AR+L L+ Y +L
Sbjct: 78 ARFLALMPYTDL 89


>gi|323526189|ref|YP_004228342.1| 30S ribosomal protein S18 [Burkholderia sp. CCGE1001]
 gi|323383191|gb|ADX55282.1| ribosomal protein S18 [Burkholderia sp. CCGE1001]
          Length = 91

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G   IDYKDI  L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RKKFCRFTAAGVEYIDYKDIETLKDFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LVPYTD 87


>gi|157694460|ref|YP_001488922.1| 30S ribosomal protein S18 [Bacillus pumilus SAFR-032]
 gi|167011187|sp|A8FJE5|RS18_BACP2 RecName: Full=30S ribosomal protein S18
 gi|157683218|gb|ABV64362.1| ribosomal protein S18 [Bacillus pumilus SAFR-032]
          Length = 79

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 42/62 (67%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIK++R + L+ Y
Sbjct: 16 CFFTSNGITHIDYKDVDLLRKFVSERGKILPRRVTGTSAKYQRKLTLAIKKSRQMALLPY 75

Query: 81 VN 82
          V 
Sbjct: 76 VT 77


>gi|56750435|ref|YP_171136.1| 30S ribosomal protein S18 [Synechococcus elongatus PCC 6301]
 gi|81299932|ref|YP_400140.1| 30S ribosomal protein S18 [Synechococcus elongatus PCC 7942]
 gi|81676949|sp|Q5N503|RS18_SYNP6 RecName: Full=30S ribosomal protein S18
 gi|123769262|sp|Q31P66|RS18_SYNE7 RecName: Full=30S ribosomal protein S18
 gi|56685394|dbj|BAD78616.1| 30S ribosomal protein S18 [Synechococcus elongatus PCC 6301]
 gi|81168813|gb|ABB57153.1| SSU ribosomal protein S18P [Synechococcus elongatus PCC 7942]
          Length = 71

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 50/67 (74%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RR+  P+  K +  IDYKD+ LL +F+++RGKI+P RI+ ++ ++QR+LA AIKRAR L
Sbjct: 4  FRRRLSPI--KPSDPIDYKDVDLLRKFITERGKILPRRITGLTARQQRDLAVAIKRARIL 61

Query: 76 GLIAYVN 82
           L+ ++N
Sbjct: 62 ALLPFLN 68


>gi|148244753|ref|YP_001219447.1| 30S ribosomal protein S18 [Candidatus Vesicomyosocius okutanii
          HA]
 gi|205618817|sp|A5CWE0|RS18_VESOH RecName: Full=30S ribosomal protein S18
 gi|146326580|dbj|BAF61723.1| 30S ribosomal protein S18 [Candidatus Vesicomyosocius okutanii
          HA]
          Length = 84

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G  +IDYKDI +L + + + GKI PSR++  S K QR+L  AIKRAR+L LI Y
Sbjct: 19 CRFTAAGVTKIDYKDIDILLKNIDESGKITPSRMTGTSAKFQRKLTTAIKRARFLALIPY 78

Query: 81 VN 82
           +
Sbjct: 79 TD 80


>gi|269216494|ref|ZP_06160348.1| ribosomal protein S18 [Slackia exigua ATCC 700122]
 gi|269130023|gb|EEZ61105.1| ribosomal protein S18 [Slackia exigua ATCC 700122]
          Length = 86

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 42/69 (60%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
          N   RRK C     G   IDYKD  +L +F++ RGKI P R++    + QR++A AIK A
Sbjct: 5  NKQPRRKFCQFCKDGTDYIDYKDTAMLRKFVTDRGKIKPRRVTGACVQHQRDIATAIKNA 64

Query: 73 RYLGLIAYV 81
          R +GL+ YV
Sbjct: 65 REMGLMPYV 73


>gi|67924091|ref|ZP_00517538.1| Ribosomal protein S18 [Crocosphaera watsonii WH 8501]
 gi|67854052|gb|EAM49364.1| Ribosomal protein S18 [Crocosphaera watsonii WH 8501]
          Length = 71

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 48/67 (71%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R++  P+  K    I+YKD  LL +F+++RGKI+P RI+ ++ K+QR L  A+KRAR+L
Sbjct: 4  YRKRLSPIPPKQP--INYKDTELLRKFITERGKILPRRITGLTAKQQRALTTAVKRARFL 61

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 62 ALLPFVN 68


>gi|255284244|ref|ZP_05348799.1| ribosomal protein S18 [Bryantella formatexigens DSM 14469]
 gi|255265197|gb|EET58402.1| ribosomal protein S18 [Bryantella formatexigens DSM 14469]
          Length = 87

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (62%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          A +P+ RR    R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR 
Sbjct: 9  ADSPMKRRGGRRRKKVCVFCGKENNEIDYKDVAKLKKYVSERGKILPRRITGTCAKHQRS 68

Query: 65 LAKAIKRARYLGLIAYVN 82
          L  AIKRAR+L ++ YV 
Sbjct: 69 LTVAIKRARHLAMMPYVQ 86


>gi|72382180|ref|YP_291535.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. NATL2A]
 gi|124025720|ref|YP_001014836.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. NATL1A]
 gi|123759898|sp|Q46KZ6|RS18_PROMT RecName: Full=30S ribosomal protein S18
 gi|166220971|sp|A2C261|RS18_PROM1 RecName: Full=30S ribosomal protein S18
 gi|72002030|gb|AAZ57832.1| SSU ribosomal protein S18P [Prochlorococcus marinus str. NATL2A]
 gi|123960788|gb|ABM75571.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. NATL1A]
          Length = 73

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 49/70 (70%), Gaps = 2/70 (2%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
          N   ++K  P+   G P IDYKD+ LL +F++ RGKI+P R++ ++ K+QR+L  A+KRA
Sbjct: 3  NSLFKQKLSPIK-PGDP-IDYKDVELLKKFITDRGKILPRRLTGLTAKQQRDLTTAVKRA 60

Query: 73 RYLGLIAYVN 82
          R + L+ +VN
Sbjct: 61 RIIALLPFVN 70


>gi|329116032|ref|ZP_08244749.1| ribosomal protein S18 [Streptococcus parauberis NCFD 2020]
 gi|326906437|gb|EGE53351.1| ribosomal protein S18 [Streptococcus parauberis NCFD 2020]
          Length = 79

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 46/73 (63%), Gaps = 1/73 (1%)

Query: 11 RRNVSHRRKSCP-LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          RR    RRK    ++      +DYKD  LL RF+S+RGKI+P R++  S K QR++  AI
Sbjct: 5  RRGGFKRRKKVDFIAANKIEYVDYKDTELLGRFVSERGKILPRRVTGTSAKNQRKVTAAI 64

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ YVN
Sbjct: 65 KRARVMALMPYVN 77


>gi|87303683|ref|ZP_01086458.1| 30S ribosomal protein S18 [Synechococcus sp. WH 5701]
 gi|87281788|gb|EAQ73753.1| 30S ribosomal protein S18 [Synechococcus sp. WH 5701]
          Length = 73

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 44/56 (78%), Gaps = 1/56 (1%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G P IDYKD+ LL +F+++RGKI+P R+S ++ K+QR+L  A+KRAR + L+ +VN
Sbjct: 16 GDP-IDYKDVDLLKKFITERGKILPRRLSGLTAKQQRDLTNAVKRARIVALLPFVN 70


>gi|284929339|ref|YP_003421861.1| 30S ribosomal protein S18P [cyanobacterium UCYN-A]
 gi|284809783|gb|ADB95480.1| SSU ribosomal protein S18P [cyanobacterium UCYN-A]
          Length = 71

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R++  P+  K    IDYKD  LL +F+++RGKI+P RI+ ++ K+QR L  A+KRAR L
Sbjct: 4  YRKRLSPIPPKQP--IDYKDTELLRKFITERGKILPRRITGLTAKQQRALTTAVKRARIL 61

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 62 ALLPFVN 68


>gi|259500769|ref|ZP_05743671.1| 30S ribosomal protein S18 [Lactobacillus iners DSM 13335]
 gi|302190780|ref|ZP_07267034.1| ribosomal protein S18 [Lactobacillus iners AB-1]
 gi|309804084|ref|ZP_07698165.1| ribosomal protein S18 [Lactobacillus iners LactinV 11V1-d]
 gi|309804852|ref|ZP_07698914.1| ribosomal protein S18 [Lactobacillus iners LactinV 09V1-c]
 gi|309805906|ref|ZP_07699938.1| ribosomal protein S18 [Lactobacillus iners LactinV 03V1-b]
 gi|309807825|ref|ZP_07701757.1| ribosomal protein S18 [Lactobacillus iners LactinV 01V1-a]
 gi|309809776|ref|ZP_07703630.1| ribosomal protein S18 [Lactobacillus iners SPIN 2503V10-D]
 gi|312871319|ref|ZP_07731417.1| ribosomal protein S18 [Lactobacillus iners LEAF 3008A-a]
 gi|312872794|ref|ZP_07732859.1| ribosomal protein S18 [Lactobacillus iners LEAF 2062A-h1]
 gi|312873277|ref|ZP_07733332.1| ribosomal protein S18 [Lactobacillus iners LEAF 2052A-d]
 gi|312874897|ref|ZP_07734916.1| ribosomal protein S18 [Lactobacillus iners LEAF 2053A-b]
 gi|315654139|ref|ZP_07907055.1| 30S ribosomal protein S18 [Lactobacillus iners ATCC 55195]
 gi|325912331|ref|ZP_08174728.1| ribosomal protein S18 [Lactobacillus iners UPII 143-D]
 gi|325913704|ref|ZP_08176066.1| ribosomal protein S18 [Lactobacillus iners UPII 60-B]
 gi|329919826|ref|ZP_08276777.1| ribosomal protein S18 [Lactobacillus iners SPIN 1401G]
 gi|259167463|gb|EEW51958.1| 30S ribosomal protein S18 [Lactobacillus iners DSM 13335]
 gi|308163852|gb|EFO66118.1| ribosomal protein S18 [Lactobacillus iners LactinV 11V1-d]
 gi|308165791|gb|EFO68012.1| ribosomal protein S18 [Lactobacillus iners LactinV 09V1-c]
 gi|308167682|gb|EFO69829.1| ribosomal protein S18 [Lactobacillus iners LactinV 03V1-b]
 gi|308168927|gb|EFO71013.1| ribosomal protein S18 [Lactobacillus iners LactinV 01V1-a]
 gi|308169955|gb|EFO71994.1| ribosomal protein S18 [Lactobacillus iners SPIN 2503V10-D]
 gi|311089642|gb|EFQ48067.1| ribosomal protein S18 [Lactobacillus iners LEAF 2053A-b]
 gi|311091157|gb|EFQ49546.1| ribosomal protein S18 [Lactobacillus iners LEAF 2052A-d]
 gi|311091836|gb|EFQ50215.1| ribosomal protein S18 [Lactobacillus iners LEAF 2062A-h1]
 gi|311093333|gb|EFQ51679.1| ribosomal protein S18 [Lactobacillus iners LEAF 3008A-a]
 gi|315488835|gb|EFU78481.1| 30S ribosomal protein S18 [Lactobacillus iners ATCC 55195]
 gi|325475990|gb|EGC79159.1| ribosomal protein S18 [Lactobacillus iners UPII 143-D]
 gi|325477063|gb|EGC80213.1| ribosomal protein S18 [Lactobacillus iners UPII 60-B]
 gi|328937173|gb|EGG33601.1| ribosomal protein S18 [Lactobacillus iners SPIN 1401G]
          Length = 78

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 42/60 (70%)

Query: 23 LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          +S      IDYKD+ LL RF+S+RGKI+P R++  S K QR L  AIKRAR +GL+ +V+
Sbjct: 17 ISANHIDYIDYKDVDLLKRFISERGKILPRRVTGTSAKNQRMLTVAIKRARVMGLLPFVS 76


>gi|160871730|ref|ZP_02061862.1| ribosomal protein S18 [Rickettsiella grylli]
 gi|159120529|gb|EDP45867.1| ribosomal protein S18 [Rickettsiella grylli]
          Length = 78

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 1/66 (1%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C +S +G   +DYKD+ LL   L++  KIVPSR +  +   QR+L +AIKRAR+LG
Sbjct: 8  RRKHCRISAEGME-VDYKDLALLKSHLTETAKIVPSRTTGTTACVQRKLTQAIKRARFLG 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYCD 72


>gi|77163756|ref|YP_342281.1| ribosomal protein S18 [Nitrosococcus oceani ATCC 19707]
 gi|254435623|ref|ZP_05049130.1| ribosomal protein S18 [Nitrosococcus oceani AFC27]
 gi|300115387|ref|YP_003761962.1| 30S ribosomal protein S18 [Nitrosococcus watsonii C-113]
 gi|123595160|sp|Q3JEJ5|RS18_NITOC RecName: Full=30S ribosomal protein S18
 gi|76882070|gb|ABA56751.1| SSU ribosomal protein S18P [Nitrosococcus oceani ATCC 19707]
 gi|207088734|gb|EDZ66006.1| ribosomal protein S18 [Nitrosococcus oceani AFC27]
 gi|299541324|gb|ADJ29641.1| ribosomal protein S18 [Nitrosococcus watsonii C-113]
          Length = 74

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+L++A+KRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLATLKDYITETGKIVPSRITGTKAKYQRQLSRAVKRARYLALLPYCD 72


>gi|326790180|ref|YP_004308001.1| ribosomal protein S18 [Clostridium lentocellum DSM 5427]
 gi|326540944|gb|ADZ82803.1| ribosomal protein S18 [Clostridium lentocellum DSM 5427]
          Length = 77

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (65%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + +R+   RRK    +G    +I+YKDI  L +F+S+RGKI+P RI+  S K QR+L  A
Sbjct: 3  MQKRHNRRRRKINQFAGDNIKKINYKDINTLKKFISERGKILPRRITGNSAKAQRKLTVA 62

Query: 69 IKRARYLGLIAYV 81
          IKRAR++ L+ Y 
Sbjct: 63 IKRARHIALLPYT 75


>gi|91783365|ref|YP_558571.1| 30S ribosomal protein S18 [Burkholderia xenovorans LB400]
 gi|296157726|ref|ZP_06840560.1| ribosomal protein S18 [Burkholderia sp. Ch1-1]
 gi|123168536|sp|Q13ZH0|RS18_BURXL RecName: Full=30S ribosomal protein S18
 gi|91687319|gb|ABE30519.1| SSU ribosomal protein S18P [Burkholderia xenovorans LB400]
 gi|295891972|gb|EFG71756.1| ribosomal protein S18 [Burkholderia sp. Ch1-1]
          Length = 91

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G   IDYKD+  L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RKKFCRFTAAGVDHIDYKDLETLKDFIGENGKITPARLTGTKSHYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LVPYTD 87


>gi|310815618|ref|YP_003963582.1| ribosomal protein S18 [Ketogulonicigenium vulgare Y25]
 gi|308754353|gb|ADO42282.1| ribosomal protein S18 [Ketogulonicigenium vulgare Y25]
          Length = 65

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (72%), Gaps = 5/55 (9%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVS 58
          +A  P  RR     RKS P  G+GAP IDYKD RLL R++S+RGKIVP+RI++VS
Sbjct: 1  MATKPFFRR-----RKSDPFEGEGAPVIDYKDTRLLQRYISERGKIVPARITAVS 50


>gi|293604275|ref|ZP_06686682.1| 30S ribosomal protein S18 [Achromobacter piechaudii ATCC 43553]
 gi|311105035|ref|YP_003977888.1| 30S ribosomal protein S18 [Achromobacter xylosoxidans A8]
 gi|292817152|gb|EFF76226.1| 30S ribosomal protein S18 [Achromobacter piechaudii ATCC 43553]
 gi|310759724|gb|ADP15173.1| ribosomal protein S18 [Achromobacter xylosoxidans A8]
 gi|317402865|gb|EFV83407.1| 30S ribosomal protein S18 [Achromobacter xylosoxidans C54]
          Length = 90

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  +  G   IDYKD+  L  F+ + GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RRKFCRFTAAGVEEIDYKDLDTLRDFVQENGKIIPARLTGTKAIYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LLPYTD 87


>gi|295112204|emb|CBL28954.1| SSU ribosomal protein S18P [Synergistetes bacterium SGP1]
          Length = 92

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 47/77 (61%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
           AP   +RR    R K C    +   ++DYKD+  L +++S+RGKIVP R++    K QR
Sbjct: 13 AAPRGGMRRGSKRRPKFCYYCVEKQEKVDYKDVEKLRKYISERGKIVPRRVTGNCAKHQR 72

Query: 64 ELAKAIKRARYLGLIAY 80
           L +AIKRARY+ L+ Y
Sbjct: 73 LLTEAIKRARYMALLPY 89


>gi|166030697|ref|ZP_02233526.1| hypothetical protein DORFOR_00371 [Dorea formicigenerans ATCC
          27755]
 gi|166029489|gb|EDR48246.1| hypothetical protein DORFOR_00371 [Dorea formicigenerans ATCC
          27755]
          Length = 88

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 1/72 (1%)

Query: 11 RRNVSHRRKS-CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          RRN   RRK  C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AI
Sbjct: 15 RRNPGRRRKKVCVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQRALTVAI 74

Query: 70 KRARYLGLIAYV 81
          KRAR++ L+ YV
Sbjct: 75 KRARHVALMPYV 86


>gi|120555297|ref|YP_959648.1| 30S ribosomal protein S18 [Marinobacter aquaeolei VT8]
 gi|166220958|sp|A1U392|RS18_MARAV RecName: Full=30S ribosomal protein S18
 gi|120325146|gb|ABM19461.1| SSU ribosomal protein S18P [Marinobacter aquaeolei VT8]
          Length = 76

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLDTLKGYITETGKIVPSRITGTKARYQRQLATAIKRARYLALLPYTD 72


>gi|92113017|ref|YP_572945.1| SSU ribosomal protein S18P [Chromohalobacter salexigens DSM 3043]
 gi|123084170|sp|Q1QZ62|RS18_CHRSD RecName: Full=30S ribosomal protein S18
 gi|91796107|gb|ABE58246.1| SSU ribosomal protein S18P [Chromohalobacter salexigens DSM 3043]
          Length = 75

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKDI  L  ++++ GKIVPSRI+    + QR+L+ AIKRARYL L+ Y +
Sbjct: 14 TAEGVKYIDYKDIDTLKSYITETGKIVPSRITGTKARYQRQLSTAIKRARYLALLPYTD 72


>gi|254417640|ref|ZP_05031374.1| ribosomal protein S18 [Microcoleus chthonoplastes PCC 7420]
 gi|196175558|gb|EDX70588.1| ribosomal protein S18 [Microcoleus chthonoplastes PCC 7420]
          Length = 71

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 44/56 (78%), Gaps = 1/56 (1%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G P IDYKD+ LL +F+++RGKI+P RI+ ++ ++QR L ++IKRAR L L+ +VN
Sbjct: 14 GEP-IDYKDVELLRKFITERGKILPRRITGLTSQQQRALTRSIKRARLLALLPFVN 68


>gi|226942913|ref|YP_002797986.1| 30S ribosomal protein S18 [Azotobacter vinelandii DJ]
 gi|259494801|sp|C1DLR3|RS18_AZOVD RecName: Full=30S ribosomal protein S18
 gi|226717840|gb|ACO77011.1| 30S ribosomal protein S18 [Azotobacter vinelandii DJ]
          Length = 76

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   ID+KD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDFKDLNTLKAYISETGKIVPSRITGTKARYQRQLATAIKRARYLALLPYTD 72


>gi|257866284|ref|ZP_05645937.1| ribosomal protein S18 [Enterococcus casseliflavus EC30]
 gi|257873200|ref|ZP_05652853.1| ribosomal protein S18 [Enterococcus casseliflavus EC10]
 gi|257875901|ref|ZP_05655554.1| ribosomal protein S18 [Enterococcus casseliflavus EC20]
 gi|325567633|ref|ZP_08144300.1| 30S ribosomal protein S18 [Enterococcus casseliflavus ATCC 12755]
 gi|257800242|gb|EEV29270.1| ribosomal protein S18 [Enterococcus casseliflavus EC30]
 gi|257807364|gb|EEV36186.1| ribosomal protein S18 [Enterococcus casseliflavus EC10]
 gi|257810067|gb|EEV38887.1| ribosomal protein S18 [Enterococcus casseliflavus EC20]
 gi|325159066|gb|EGC71212.1| 30S ribosomal protein S18 [Enterococcus casseliflavus ATCC 12755]
          Length = 78

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 39/52 (75%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKDI LL RF+S+RGKI+P R++    K QR+L  AIKRAR +GL+ +V 
Sbjct: 25 IDYKDIELLKRFISERGKILPRRVTGTGAKNQRKLTIAIKRARIMGLLPFVG 76


>gi|325979062|ref|YP_004288778.1| 30S ribosomal protein S18 [Streptococcus gallolyticus subsp.
          gallolyticus ATCC BAA-2069]
 gi|325178990|emb|CBZ49034.1| 30S ribosomal protein S18 [Streptococcus gallolyticus subsp.
          gallolyticus ATCC BAA-2069]
          Length = 79

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (63%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          R     R+K   ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  AIK
Sbjct: 6  RSGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAIK 65

Query: 71 RARYLGLIAYVN 82
          RAR + L+ +VN
Sbjct: 66 RARVMALMPFVN 77


>gi|28872046|ref|NP_794665.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tomato str.
          DC3000]
 gi|66043849|ref|YP_233690.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. syringae
          B728a]
 gi|70734082|ref|YP_257722.1| 30S ribosomal protein S18 [Pseudomonas fluorescens Pf-5]
 gi|71735317|ref|YP_272877.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. phaseolicola
          1448A]
 gi|77456763|ref|YP_346268.1| 30S ribosomal protein S18 [Pseudomonas fluorescens Pf0-1]
 gi|213967934|ref|ZP_03396080.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tomato T1]
 gi|229588087|ref|YP_002870206.1| 30S ribosomal protein S18 [Pseudomonas fluorescens SBW25]
 gi|237798288|ref|ZP_04586749.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. oryzae str.
          1_6]
 gi|257482398|ref|ZP_05636439.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tabaci ATCC
          11528]
 gi|289624607|ref|ZP_06457561.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. aesculi str.
          NCPPB3681]
 gi|289648617|ref|ZP_06479960.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. aesculi str.
          2250]
 gi|298484905|ref|ZP_07003004.1| SSU ribosomal protein S18p [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
 gi|301383749|ref|ZP_07232167.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tomato Max13]
 gi|302059276|ref|ZP_07250817.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tomato K40]
 gi|302132344|ref|ZP_07258334.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tomato NCPPB
          1108]
 gi|302185450|ref|ZP_07262123.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. syringae 642]
 gi|330807241|ref|YP_004351703.1| 30S ribosomal protein S18 [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|38258466|sp|Q87VK4|RS18_PSESM RecName: Full=30S ribosomal protein S18
 gi|81308571|sp|Q4ZYX0|RS18_PSEU2 RecName: Full=30S ribosomal protein S18
 gi|123606171|sp|Q3KIX7|RS18_PSEPF RecName: Full=30S ribosomal protein S18
 gi|123734036|sp|Q48NZ2|RS18_PSE14 RecName: Full=30S ribosomal protein S18
 gi|123748561|sp|Q4KJ61|RS18_PSEF5 RecName: Full=30S ribosomal protein S18
 gi|259494816|sp|C3KE68|RS18_PSEFS RecName: Full=30S ribosomal protein S18
 gi|28855299|gb|AAO58360.1| ribosomal protein S18 [Pseudomonas syringae pv. tomato str.
          DC3000]
 gi|63254556|gb|AAY35652.1| Ribosomal protein S18 [Pseudomonas syringae pv. syringae B728a]
 gi|68348381|gb|AAY95987.1| ribosomal protein S18 [Pseudomonas fluorescens Pf-5]
 gi|71555870|gb|AAZ35081.1| ribosomal protein S18 [Pseudomonas syringae pv. phaseolicola
          1448A]
 gi|77380766|gb|ABA72279.1| 30S ribosomal protein S18 [Pseudomonas fluorescens Pf0-1]
 gi|213927277|gb|EEB60826.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tomato T1]
 gi|229359953|emb|CAY46807.1| 30S ribosomal protein S18 [Pseudomonas fluorescens SBW25]
 gi|298160592|gb|EFI01614.1| SSU ribosomal protein S18p [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
 gi|320321873|gb|EFW77969.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. glycinea str.
          B076]
 gi|320331022|gb|EFW86996.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. glycinea str.
          race 4]
 gi|327375349|gb|AEA66699.1| 30S ribosomal protein S18 [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|330865905|gb|EGH00614.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. aesculi str.
          0893_23]
 gi|330872264|gb|EGH06413.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. glycinea str.
          race 4]
 gi|330873775|gb|EGH07924.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. morsprunorum
          str. M302280PT]
 gi|330886612|gb|EGH20273.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. mori str.
          301020]
 gi|330899906|gb|EGH31325.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. japonica str.
          M301072PT]
 gi|330939890|gb|EGH43112.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. pisi str.
          1704B]
 gi|330951488|gb|EGH51748.1| 30S ribosomal protein S18 [Pseudomonas syringae Cit 7]
 gi|330960078|gb|EGH60338.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. maculicola
          str. ES4326]
 gi|330965992|gb|EGH66252.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. actinidiae
          str. M302091]
 gi|330971571|gb|EGH71637.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. aceris str.
          M302273PT]
 gi|330978936|gb|EGH77995.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. aptata str.
          DSM 50252]
 gi|330984550|gb|EGH82653.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. lachrymans
          str. M301315]
 gi|331009772|gb|EGH89828.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tabaci ATCC
          11528]
 gi|331014621|gb|EGH94677.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. lachrymans
          str. M302278PT]
 gi|331021140|gb|EGI01197.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. oryzae str.
          1_6]
          Length = 76

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +    IDYKD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRAR+L L+AY +
Sbjct: 14 TAEDVKEIDYKDLNTLKAYVSETGKIVPSRITGTKARYQRQLATAIKRARFLALLAYTD 72


>gi|90020705|ref|YP_526532.1| 30S ribosomal protein S18 [Saccharophagus degradans 2-40]
 gi|122996417|sp|Q21LV9|RS18_SACD2 RecName: Full=30S ribosomal protein S18
 gi|89950305|gb|ABD80320.1| SSU ribosomal protein S18P [Saccharophagus degradans 2-40]
          Length = 75

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++S+ GKIVPSRI+    K QR+LA AIKRAR++ L+ Y +
Sbjct: 14 TAEGVKSIDYKDLDTLKAYVSETGKIVPSRITGTKAKYQRQLATAIKRARFIALLPYTD 72


>gi|209520395|ref|ZP_03269158.1| ribosomal protein S18 [Burkholderia sp. H160]
 gi|295676424|ref|YP_003604948.1| ribosomal protein S18 [Burkholderia sp. CCGE1002]
 gi|209499180|gb|EDZ99272.1| ribosomal protein S18 [Burkholderia sp. H160]
 gi|295436267|gb|ADG15437.1| ribosomal protein S18 [Burkholderia sp. CCGE1002]
          Length = 91

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G   IDYKDI  L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RKKFCRFTAAGVEYIDYKDIETLKDFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LMPYTD 87


>gi|289672603|ref|ZP_06493493.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. syringae FF5]
          Length = 76

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +    IDYKD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRAR+L L+AY +
Sbjct: 14 TAEDVKEIDYKDLNTLKAYVSETGKIVPSRITGTKARYQRQLATAIKRARFLALLAYTD 72


>gi|255066238|ref|ZP_05318093.1| ribosomal protein S18 [Neisseria sicca ATCC 29256]
 gi|255049448|gb|EET44912.1| ribosomal protein S18 [Neisseria sicca ATCC 29256]
          Length = 76

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    +D+K + LL  F+S+ GKI+P+RI+      QR+LA A+KRAR+L 
Sbjct: 8  RRKFCRFTAEKIQEVDHKQVDLLKDFISENGKIIPARITGTKAHYQRQLATAVKRARFLA 67

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 68 LLPYTD 73


>gi|331700406|ref|YP_004397365.1| 30S ribosomal protein S18 [Lactobacillus buchneri NRRL B-30929]
 gi|329127749|gb|AEB72302.1| 30S ribosomal protein S18 [Lactobacillus buchneri NRRL B-30929]
          Length = 79

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/51 (60%), Positives = 39/51 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKDI LL RF+S+RGKI+P R++  S K QR L  AIKRAR +GL+ +V
Sbjct: 26 IDYKDIDLLKRFVSERGKILPRRVTGTSAKNQRALTIAIKRARIMGLMPFV 76


>gi|317969855|ref|ZP_07971245.1| 30S ribosomal protein S18 [Synechococcus sp. CB0205]
          Length = 73

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 44/56 (78%), Gaps = 1/56 (1%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G P IDYKD+ LL +F+++RGKI+P R++ ++ K+QR+L  A+KRAR + L+ +VN
Sbjct: 16 GEP-IDYKDVDLLKKFITERGKILPRRLTGLTAKQQRDLTNAVKRARIVALLPFVN 70


>gi|187777390|ref|ZP_02993863.1| hypothetical protein CLOSPO_00946 [Clostridium sporogenes ATCC
          15579]
 gi|187774318|gb|EDU38120.1| hypothetical protein CLOSPO_00946 [Clostridium sporogenes ATCC
          15579]
          Length = 80

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK C    + +  IDYKDI  L +F+++RGKI+P RIS    K QREL +AIKRAR + 
Sbjct: 14 KRKVCTFCMEKSEAIDYKDINKLRKFVTERGKILPRRISGNCAKHQRELTRAIKRARNIA 73

Query: 77 LIAYVN 82
          L+ +  
Sbjct: 74 LLPFTT 79


>gi|40062773|gb|AAR37667.1| ribosomal protein S18 [uncultured marine bacterium 439]
          Length = 85

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 47/81 (58%), Gaps = 7/81 (8%)

Query: 9  LLRRNVSHRRKS-------CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          + ++ V+ RRK        C  +  G   IDYKD+ +L + +   GKI PSRI+  S K 
Sbjct: 1  MAKKQVTKRRKFQIPINRFCRFTKAGFKEIDYKDVDILLKNIDDSGKITPSRITGTSAKF 60

Query: 62 QRELAKAIKRARYLGLIAYVN 82
          QR+L  AIKRAR+L LI Y +
Sbjct: 61 QRQLTTAIKRARFLALIPYTD 81


>gi|218282110|ref|ZP_03488409.1| hypothetical protein EUBIFOR_00984 [Eubacterium biforme DSM 3989]
 gi|218216903|gb|EEC90441.1| hypothetical protein EUBIFOR_00984 [Eubacterium biforme DSM 3989]
          Length = 76

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +      IDYKD+ LL RF++  GKI+P R++    K QR LA AIKRAR + 
Sbjct: 10 RKKVCYFTKNKIKEIDYKDVELLKRFINANGKIIPRRVTGTRAKYQRMLATAIKRARQMA 69

Query: 77 LIAYV 81
          L+ YV
Sbjct: 70 LLPYV 74


>gi|94501371|ref|ZP_01307891.1| ribosomal protein S18 [Oceanobacter sp. RED65]
 gi|94426484|gb|EAT11472.1| ribosomal protein S18 [Oceanobacter sp. RED65]
          Length = 75

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  +IDYKD+  L  ++++ GKIVPSRI+    K QR+L+ AIKRARY+ L+ Y +
Sbjct: 14 TAEGVDQIDYKDLDTLKGYITETGKIVPSRITGTKAKYQRQLSSAIKRARYVALLPYTD 72


>gi|318041407|ref|ZP_07973363.1| 30S ribosomal protein S18 [Synechococcus sp. CB0101]
          Length = 73

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 44/56 (78%), Gaps = 1/56 (1%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G P IDYKD+ LL +F+++RGKI+P R++ ++ K+QR+L  A+KRAR + L+ +VN
Sbjct: 16 GDP-IDYKDVDLLKKFITERGKILPRRLTGLTAKQQRDLTNAVKRARIVALLPFVN 70


>gi|307546115|ref|YP_003898594.1| 30S ribosomal protein S18 [Halomonas elongata DSM 2581]
 gi|307218139|emb|CBV43409.1| 30S ribosomal protein S18 [Halomonas elongata DSM 2581]
          Length = 75

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  +IDYKD+  L  ++++ GKIVPSRI+    + QR+L+ AIKRARYL L+ Y +
Sbjct: 14 TAEGVKQIDYKDLDTLKAYVTETGKIVPSRITGTKARYQRQLSTAIKRARYLALLPYTD 72


>gi|238855514|ref|ZP_04645819.1| ribosomal protein S18 [Lactobacillus jensenii 269-3]
 gi|256851682|ref|ZP_05557070.1| ribosomal protein S18 [Lactobacillus jensenii 27-2-CHN]
 gi|260661601|ref|ZP_05862513.1| ribosomal protein S18 [Lactobacillus jensenii 115-3-CHN]
 gi|260665218|ref|ZP_05866067.1| ribosomal protein S18 [Lactobacillus jensenii SJ-7A-US]
 gi|282931540|ref|ZP_06337039.1| ribosomal protein S18 [Lactobacillus jensenii 208-1]
 gi|282934234|ref|ZP_06339511.1| ribosomal protein S18 [Lactobacillus jensenii 208-1]
 gi|297205291|ref|ZP_06922687.1| 30S ribosomal protein S18 [Lactobacillus jensenii JV-V16]
 gi|313472771|ref|ZP_07813259.1| ribosomal protein S18 [Lactobacillus jensenii 1153]
 gi|238831880|gb|EEQ24212.1| ribosomal protein S18 [Lactobacillus jensenii 269-3]
 gi|239529058|gb|EEQ68059.1| ribosomal protein S18 [Lactobacillus jensenii 1153]
 gi|256615640|gb|EEU20829.1| ribosomal protein S18 [Lactobacillus jensenii 27-2-CHN]
 gi|260547658|gb|EEX23636.1| ribosomal protein S18 [Lactobacillus jensenii 115-3-CHN]
 gi|260560955|gb|EEX26930.1| ribosomal protein S18 [Lactobacillus jensenii SJ-7A-US]
 gi|281301708|gb|EFA93975.1| ribosomal protein S18 [Lactobacillus jensenii 208-1]
 gi|281304347|gb|EFA96450.1| ribosomal protein S18 [Lactobacillus jensenii 208-1]
 gi|297149869|gb|EFH30166.1| 30S ribosomal protein S18 [Lactobacillus jensenii JV-V16]
          Length = 78

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 40/51 (78%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          +DYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+ +V
Sbjct: 25 VDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLLPFV 75


>gi|312958664|ref|ZP_07773184.1| 30S ribosomal protein S18 [Pseudomonas fluorescens WH6]
 gi|311287207|gb|EFQ65768.1| 30S ribosomal protein S18 [Pseudomonas fluorescens WH6]
          Length = 76

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/52 (55%), Positives = 39/52 (75%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRAR+L L+AY +
Sbjct: 21 IDYKDLNTLKAYVSETGKIVPSRITGTKARYQRQLATAIKRARFLALLAYTD 72


>gi|146319486|ref|YP_001199198.1| 30S ribosomal protein S18 [Streptococcus suis 05ZYH33]
 gi|146321678|ref|YP_001201389.1| 30S ribosomal protein S18 [Streptococcus suis 98HAH33]
 gi|223934218|ref|ZP_03626153.1| ribosomal protein S18 [Streptococcus suis 89/1591]
 gi|253752497|ref|YP_003025638.1| 30S ribosomal protein S18 [Streptococcus suis SC84]
 gi|253754323|ref|YP_003027464.1| 30S ribosomal protein S18 [Streptococcus suis P1/7]
 gi|253756257|ref|YP_003029397.1| 30S ribosomal protein S18 [Streptococcus suis BM407]
 gi|302024436|ref|ZP_07249647.1| 30S ribosomal protein S18 [Streptococcus suis 05HAS68]
 gi|330833440|ref|YP_004402265.1| 30S ribosomal protein S18 [Streptococcus suis ST3]
 gi|166222247|sp|A4W3Q0|RS18_STRS2 RecName: Full=30S ribosomal protein S18
 gi|166222249|sp|A4VXF9|RS18_STRSY RecName: Full=30S ribosomal protein S18
 gi|145690292|gb|ABP90798.1| 30S ribosomal protein S18 [Streptococcus suis 05ZYH33]
 gi|145692484|gb|ABP92989.1| 30S ribosomal protein S18 [Streptococcus suis 98HAH33]
 gi|223897115|gb|EEF63541.1| ribosomal protein S18 [Streptococcus suis 89/1591]
 gi|251816786|emb|CAZ52429.1| 30S ribosomal protein S18 [Streptococcus suis SC84]
 gi|251818721|emb|CAZ56557.1| 30S ribosomal protein S18 [Streptococcus suis BM407]
 gi|251820569|emb|CAR47325.1| 30S ribosomal protein S18 [Streptococcus suis P1/7]
 gi|292559103|gb|ADE32104.1| 30S ribosomal protein S18 [Streptococcus suis GZ1]
 gi|319758905|gb|ADV70847.1| 30S ribosomal protein S18 [Streptococcus suis JS14]
 gi|329307663|gb|AEB82079.1| 30S ribosomal protein S18 [Streptococcus suis ST3]
          Length = 79

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 11 RRNVSHRRKSCP-LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          RR    RRK    ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  AI
Sbjct: 5  RRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFISERGKILPRRVTGTSAKNQRKVTTAI 64

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ +VN
Sbjct: 65 KRARVMALLPFVN 77


>gi|254520716|ref|ZP_05132772.1| ribosomal protein S18 [Clostridium sp. 7_2_43FAA]
 gi|226914465|gb|EEH99666.1| ribosomal protein S18 [Clostridium sp. 7_2_43FAA]
          Length = 80

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK C    + A  IDYKDI  L +F+++RGKI+P RIS    K QREL  AIKR+R + 
Sbjct: 14 KRKVCAFCVEKAEAIDYKDITKLRKFVTERGKILPRRISGTCAKHQRELTTAIKRSRNIA 73

Query: 77 LIAYVN 82
          L+ +  
Sbjct: 74 LLPFTT 79


>gi|33861426|ref|NP_892987.1| 30S ribosomal protein S18 [Prochlorococcus marinus subsp.
          pastoris str. CCMP1986]
 gi|78779316|ref|YP_397428.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9312]
 gi|123966183|ref|YP_001011264.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9515]
 gi|123968526|ref|YP_001009384.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. AS9601]
 gi|126696329|ref|YP_001091215.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9301]
 gi|157413359|ref|YP_001484225.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9215]
 gi|254525976|ref|ZP_05138028.1| ribosomal protein S18 [Prochlorococcus marinus str. MIT 9202]
 gi|59798835|sp|Q7TUA0|RS18_PROMP RecName: Full=30S ribosomal protein S18
 gi|123741464|sp|Q31AV3|RS18_PROM9 RecName: Full=30S ribosomal protein S18
 gi|166220970|sp|A3PCY9|RS18_PROM0 RecName: Full=30S ribosomal protein S18
 gi|166220973|sp|A2BWJ6|RS18_PROM5 RecName: Full=30S ribosomal protein S18
 gi|166220974|sp|A2BR66|RS18_PROMS RecName: Full=30S ribosomal protein S18
 gi|167011192|sp|A8G4V8|RS18_PROM2 RecName: Full=30S ribosomal protein S18
 gi|33634003|emb|CAE19328.1| 30S Ribosomal protein S18 [Prochlorococcus marinus subsp.
          pastoris str. CCMP1986]
 gi|78712815|gb|ABB49992.1| SSU ribosomal protein S18P [Prochlorococcus marinus str. MIT
          9312]
 gi|123198636|gb|ABM70277.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. AS9601]
 gi|123200549|gb|ABM72157.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9515]
 gi|126543372|gb|ABO17614.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9301]
 gi|157387934|gb|ABV50639.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9215]
 gi|221537400|gb|EEE39853.1| ribosomal protein S18 [Prochlorococcus marinus str. MIT 9202]
          Length = 73

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 44/56 (78%), Gaps = 1/56 (1%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G P IDYKD+ LL +F+++RGKI+P R++ ++ K+QR+L  A+KRAR + L+ +VN
Sbjct: 16 GDP-IDYKDVELLKKFITERGKILPRRMTGLTSKQQRDLTLAVKRARIVALLPFVN 70


>gi|210624078|ref|ZP_03294178.1| hypothetical protein CLOHIR_02130 [Clostridium hiranonis DSM
          13275]
 gi|210153211|gb|EEA84217.1| hypothetical protein CLOHIR_02130 [Clostridium hiranonis DSM
          13275]
          Length = 74

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C        +IDYKD + L R++++RGKI+P RIS    K QREL KAIKRAR + L+ Y
Sbjct: 12 CQFCADKNAKIDYKDTQRLQRYVTERGKILPRRISGTCAKHQRELTKAIKRARNIALLPY 71

Query: 81 V 81
           
Sbjct: 72 T 72


>gi|33593750|ref|NP_881394.1| 30S ribosomal protein S18 [Bordetella pertussis Tohama I]
 gi|33597056|ref|NP_884699.1| 30S ribosomal protein S18 [Bordetella parapertussis 12822]
 gi|33600901|ref|NP_888461.1| 30S ribosomal protein S18 [Bordetella bronchiseptica RB50]
 gi|59798865|sp|Q7VV91|RS18_BORPE RecName: Full=30S ribosomal protein S18
 gi|59798870|sp|Q7W7P6|RS18_BORPA RecName: Full=30S ribosomal protein S18
 gi|59798872|sp|Q7WL33|RS18_BORBR RecName: Full=30S ribosomal protein S18
 gi|33563823|emb|CAE43067.1| 30s ribosomal protein s18 [Bordetella pertussis Tohama I]
 gi|33566507|emb|CAE37763.1| 30s ribosomal protein s18 [Bordetella parapertussis]
 gi|33568501|emb|CAE32413.1| 30s ribosomal protein s18 [Bordetella bronchiseptica RB50]
 gi|332383152|gb|AEE67999.1| 30S ribosomal protein S18 [Bordetella pertussis CS]
          Length = 90

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  +  G   IDYKD+  L  F+ + GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RRKFCRFTAAGVEEIDYKDLDTLRDFVQENGKIIPARLTGTRAIYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LLPYTD 87


>gi|197302887|ref|ZP_03167939.1| hypothetical protein RUMLAC_01616 [Ruminococcus lactaris ATCC
          29176]
 gi|197298124|gb|EDY32672.1| hypothetical protein RUMLAC_01616 [Ruminococcus lactaris ATCC
          29176]
          Length = 88

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 44/69 (63%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          V  R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AIKRAR
Sbjct: 19 VRRRKKVCVFCGKENNEIDYKDVAKLKKYVSERGKILPRRITGNCAKHQRALTVAIKRAR 78

Query: 74 YLGLIAYVN 82
          ++ L+ YV 
Sbjct: 79 HISLMPYVQ 87


>gi|332639079|ref|ZP_08417942.1| 30S ribosomal protein S18 [Weissella cibaria KACC 11862]
          Length = 80

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 39/51 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          +DYKD  LL RF+S+RGKI+P R++  S K QR++  AIKRAR +GL+ +V
Sbjct: 27 VDYKDTELLERFISERGKILPRRVTGTSAKNQRKVTTAIKRARVMGLLPFV 77


>gi|33865759|ref|NP_897318.1| 30S ribosomal protein S18 [Synechococcus sp. WH 8102]
 gi|78184710|ref|YP_377145.1| 30S ribosomal protein S18 [Synechococcus sp. CC9902]
 gi|78212867|ref|YP_381646.1| 30S ribosomal protein S18 [Synechococcus sp. CC9605]
 gi|87124491|ref|ZP_01080340.1| ribosomal protein S18 [Synechococcus sp. RS9917]
 gi|88808524|ref|ZP_01124034.1| 30S ribosomal protein S18 [Synechococcus sp. WH 7805]
 gi|113953413|ref|YP_730544.1| 30S ribosomal protein S18 [Synechococcus sp. CC9311]
 gi|116070581|ref|ZP_01467850.1| 30S ribosomal protein S18 [Synechococcus sp. BL107]
 gi|148239628|ref|YP_001225015.1| 30S ribosomal protein S18 [Synechococcus sp. WH 7803]
 gi|194476530|ref|YP_002048709.1| 30S ribosomal protein S18 [Paulinella chromatophora]
 gi|254430586|ref|ZP_05044289.1| ribosomal protein S18 [Cyanobium sp. PCC 7001]
 gi|260436039|ref|ZP_05790009.1| ribosomal protein S18 [Synechococcus sp. WH 8109]
 gi|59798843|sp|Q7U6W1|RS18_SYNPX RecName: Full=30S ribosomal protein S18
 gi|123327838|sp|Q0IAH8|RS18_SYNS3 RecName: Full=30S ribosomal protein S18
 gi|123743319|sp|Q3AJZ1|RS18_SYNSC RecName: Full=30S ribosomal protein S18
 gi|123743504|sp|Q3AVJ4|RS18_SYNS9 RecName: Full=30S ribosomal protein S18
 gi|166222251|sp|A5GLA3|RS18_SYNPW RecName: Full=30S ribosomal protein S18
 gi|205831408|sp|B1X3I0|RR18_PAUCH RecName: Full=30S ribosomal protein S18, organellar chromatophore
 gi|33632929|emb|CAE07740.1| 30S ribosomal protein S18 [Synechococcus sp. WH 8102]
 gi|78169004|gb|ABB26101.1| SSU ribosomal protein S18P [Synechococcus sp. CC9902]
 gi|78197326|gb|ABB35091.1| ribosomal protein S18 [Synechococcus sp. CC9605]
 gi|86168063|gb|EAQ69321.1| ribosomal protein S18 [Synechococcus sp. RS9917]
 gi|88787512|gb|EAR18669.1| 30S ribosomal protein S18 [Synechococcus sp. WH 7805]
 gi|113880764|gb|ABI45722.1| ribosomal protein S18 [Synechococcus sp. CC9311]
 gi|116065986|gb|EAU71743.1| 30S ribosomal protein S18 [Synechococcus sp. BL107]
 gi|147848167|emb|CAK23718.1| 30S ribosomal protein S18 [Synechococcus sp. WH 7803]
 gi|171191537|gb|ACB42499.1| 30S ribosomal protein S18 [Paulinella chromatophora]
 gi|197625039|gb|EDY37598.1| ribosomal protein S18 [Cyanobium sp. PCC 7001]
 gi|260413913|gb|EEX07209.1| ribosomal protein S18 [Synechococcus sp. WH 8109]
          Length = 73

 Score = 64.7 bits (156), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 44/56 (78%), Gaps = 1/56 (1%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G P IDYKD+ LL +F+++RGKI+P R++ ++ K+QR+L  A+KRAR + L+ +VN
Sbjct: 16 GDP-IDYKDVDLLKKFITERGKILPRRLTGLTAKQQRDLTNAVKRARIVALLPFVN 70


>gi|187478663|ref|YP_786687.1| 30S ribosomal protein S18 [Bordetella avium 197N]
 gi|123725072|sp|Q2KZ21|RS18_BORA1 RecName: Full=30S ribosomal protein S18
 gi|115423249|emb|CAJ49782.1| 30S ribosomal protein S18 [Bordetella avium 197N]
          Length = 90

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  +  G   IDYKD+  L  F+ + GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RRKFCRFTAAGVEEIDYKDLDTLRDFVQENGKIIPARLTGTRAIYQRQLDSAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LLPYTD 87


>gi|42520621|ref|NP_966536.1| 30S ribosomal protein S18 [Wolbachia endosymbiont of Drosophila
          melanogaster]
 gi|58698590|ref|ZP_00373488.1| ribosomal protein S18 [Wolbachia endosymbiont of Drosophila
          ananassae]
 gi|99034686|ref|ZP_01314626.1| hypothetical protein Wendoof_01000557 [Wolbachia endosymbiont of
          Drosophila willistoni TSC#14030-0811.24]
 gi|225630395|ref|YP_002727186.1| ribosomal protein S18 [Wolbachia sp. wRi]
 gi|59798787|sp|Q73GZ6|RS18_WOLPM RecName: Full=30S ribosomal protein S18
 gi|254812966|sp|C0R3A3|RS18_WOLWR RecName: Full=30S ribosomal protein S18
 gi|42410360|gb|AAS14470.1| ribosomal protein S18 [Wolbachia endosymbiont of Drosophila
          melanogaster]
 gi|58534886|gb|EAL58987.1| ribosomal protein S18 [Wolbachia endosymbiont of Drosophila
          ananassae]
 gi|225592376|gb|ACN95395.1| ribosomal protein S18 [Wolbachia sp. wRi]
          Length = 91

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 43/65 (66%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R K CPL+      IDYK+I LL++F S  G+I+P R++ V  KKQR+L  AI RAR+L 
Sbjct: 23 RSKVCPLAASKDEDIDYKNIDLLSKFTSDYGRILPRRLTGVCAKKQRKLRLAIIRARFLA 82

Query: 77 LIAYV 81
          LI Y 
Sbjct: 83 LIPYC 87


>gi|15901383|ref|NP_345987.1| 30S ribosomal protein S18 [Streptococcus pneumoniae TIGR4]
 gi|15903437|ref|NP_358987.1| 30S ribosomal protein S18 [Streptococcus pneumoniae R6]
 gi|24380218|ref|NP_722173.1| 30S ribosomal protein S18 [Streptococcus mutans UA159]
 gi|111658382|ref|ZP_01409069.1| hypothetical protein SpneT_02000461 [Streptococcus pneumoniae
          TIGR4]
 gi|116516750|ref|YP_816828.1| 30S ribosomal protein S18 [Streptococcus pneumoniae D39]
 gi|125717306|ref|YP_001034439.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK36]
 gi|148984887|ref|ZP_01818140.1| hypothetical protein CGSSp3BS71_09631 [Streptococcus pneumoniae
          SP3-BS71]
 gi|148988585|ref|ZP_01820018.1| hypothetical protein CGSSp6BS73_08674 [Streptococcus pneumoniae
          SP6-BS73]
 gi|148992571|ref|ZP_01822239.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP9-BS68]
 gi|148997397|ref|ZP_01825002.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP11-BS70]
 gi|149003239|ref|ZP_01828135.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP14-BS69]
 gi|149007548|ref|ZP_01831183.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP18-BS74]
 gi|149011777|ref|ZP_01832973.1| hypothetical protein CGSSp19BS75_07412 [Streptococcus pneumoniae
          SP19-BS75]
 gi|149021813|ref|ZP_01835820.1| hypothetical protein CGSSp23BS72_09623 [Streptococcus pneumoniae
          SP23-BS72]
 gi|157150434|ref|YP_001451145.1| 30S ribosomal protein S18 [Streptococcus gordonii str. Challis
          substr. CH1]
 gi|168484972|ref|ZP_02709917.1| ribosomal protein S18 [Streptococcus pneumoniae CDC1873-00]
 gi|168487509|ref|ZP_02712017.1| ribosomal protein S18 [Streptococcus pneumoniae CDC1087-00]
 gi|168488799|ref|ZP_02712998.1| ribosomal protein S18 [Streptococcus pneumoniae SP195]
 gi|168491569|ref|ZP_02715712.1| ribosomal protein S18 [Streptococcus pneumoniae CDC0288-04]
 gi|168493440|ref|ZP_02717583.1| ribosomal protein S18 [Streptococcus pneumoniae CDC3059-06]
 gi|168575265|ref|ZP_02721228.1| ribosomal protein S18 [Streptococcus pneumoniae MLV-016]
 gi|169832520|ref|YP_001694944.1| 30S ribosomal protein S18 [Streptococcus pneumoniae Hungary19A-6]
 gi|171779262|ref|ZP_02920233.1| hypothetical protein STRINF_01110 [Streptococcus infantarius
          subsp. infantarius ATCC BAA-102]
 gi|182684495|ref|YP_001836242.1| 30S ribosomal protein S18 [Streptococcus pneumoniae CGSP14]
 gi|221232250|ref|YP_002511403.1| 30S ribosomal protein S18 [Streptococcus pneumoniae ATCC 700669]
 gi|225854979|ref|YP_002736491.1| 30S ribosomal protein S18 [Streptococcus pneumoniae JJA]
 gi|225857165|ref|YP_002738676.1| 30S ribosomal protein S18 [Streptococcus pneumoniae P1031]
 gi|225859294|ref|YP_002740804.1| 30S ribosomal protein S18 [Streptococcus pneumoniae 70585]
 gi|225861370|ref|YP_002742879.1| 30S ribosomal protein S18 [Streptococcus pneumoniae Taiwan19F-14]
 gi|237650221|ref|ZP_04524473.1| 30S ribosomal protein S18 [Streptococcus pneumoniae CCRI 1974]
 gi|237820896|ref|ZP_04596741.1| 30S ribosomal protein S18 [Streptococcus pneumoniae CCRI 1974M2]
 gi|262283523|ref|ZP_06061289.1| ribosomal protein S18 [Streptococcus sp. 2_1_36FAA]
 gi|270292432|ref|ZP_06198643.1| ribosomal protein S18 [Streptococcus sp. M143]
 gi|288906099|ref|YP_003431321.1| ribosomal protein S18 [Streptococcus gallolyticus UCN34]
 gi|289168354|ref|YP_003446623.1| 30S ribosomal protein S18 [Streptococcus mitis B6]
 gi|290579807|ref|YP_003484199.1| 30S ribosomal protein S18 [Streptococcus mutans NN2025]
 gi|293365826|ref|ZP_06612531.1| 30S ribosomal protein S18 [Streptococcus oralis ATCC 35037]
 gi|296875865|ref|ZP_06899926.1| 30S ribosomal protein S18 [Streptococcus parasanguinis ATCC
          15912]
 gi|298230728|ref|ZP_06964409.1| 30S ribosomal protein S18 [Streptococcus pneumoniae str. Canada
          MDR_19F]
 gi|298254951|ref|ZP_06978537.1| 30S ribosomal protein S18 [Streptococcus pneumoniae str. Canada
          MDR_19A]
 gi|298503275|ref|YP_003725215.1| 30S ribosomal protein S18 [Streptococcus pneumoniae TCH8431/19A]
 gi|303255325|ref|ZP_07341395.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS455]
 gi|303260166|ref|ZP_07346138.1| 30S ribosomal protein S18 [Streptococcus pneumoniae SP-BS293]
 gi|303262556|ref|ZP_07348497.1| 30S ribosomal protein S18 [Streptococcus pneumoniae SP14-BS292]
 gi|303264958|ref|ZP_07350873.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS397]
 gi|303266421|ref|ZP_07352309.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS457]
 gi|303269403|ref|ZP_07355173.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS458]
 gi|306824869|ref|ZP_07458213.1| 30S ribosomal protein S18 [Streptococcus sp. oral taxon 071 str.
          73H25AP]
 gi|306829849|ref|ZP_07463036.1| 30S ribosomal protein S18 [Streptococcus mitis ATCC 6249]
 gi|306832138|ref|ZP_07465292.1| 30S ribosomal protein S18 [Streptococcus gallolyticus subsp.
          gallolyticus TX20005]
 gi|306834252|ref|ZP_07467371.1| 30S ribosomal protein S18 [Streptococcus bovis ATCC 700338]
 gi|307068183|ref|YP_003877149.1| hypothetical protein SPAP_1561 [Streptococcus pneumoniae AP200]
 gi|307127747|ref|YP_003879778.1| 30S ribosomal protein S18 [Streptococcus pneumoniae 670-6B]
 gi|307703305|ref|ZP_07640250.1| ribosomal protein S18 [Streptococcus oralis ATCC 35037]
 gi|307704416|ref|ZP_07641328.1| ribosomal protein S18 [Streptococcus mitis SK597]
 gi|307705993|ref|ZP_07642816.1| ribosomal protein S18 [Streptococcus mitis SK564]
 gi|307706202|ref|ZP_07643019.1| ribosomal protein S18 [Streptococcus mitis SK321]
 gi|307708378|ref|ZP_07644845.1| ribosomal protein S18 [Streptococcus mitis NCTC 12261]
 gi|309798591|ref|ZP_07692866.1| ribosomal protein S18 [Streptococcus infantis SK1302]
 gi|312864919|ref|ZP_07725149.1| ribosomal protein S18 [Streptococcus downei F0415]
 gi|312868477|ref|ZP_07728677.1| ribosomal protein S18 [Streptococcus parasanguinis F0405]
 gi|315222303|ref|ZP_07864209.1| ribosomal protein S18 [Streptococcus anginosus F0211]
 gi|315613509|ref|ZP_07888416.1| 30S ribosomal protein S18 [Streptococcus sanguinis ATCC 49296]
 gi|319939919|ref|ZP_08014274.1| 30S ribosomal protein S18 [Streptococcus anginosus 1_2_62CV]
 gi|319946353|ref|ZP_08020591.1| 30S ribosomal protein S18 [Streptococcus australis ATCC 700641]
 gi|320547485|ref|ZP_08041771.1| 30S ribosomal protein S18 [Streptococcus equinus ATCC 9812]
 gi|322373706|ref|ZP_08048242.1| ribosomal protein S18 [Streptococcus sp. C150]
 gi|322375590|ref|ZP_08050102.1| ribosomal protein S18 [Streptococcus sp. C300]
 gi|322377026|ref|ZP_08051519.1| ribosomal protein S18 [Streptococcus sp. M334]
 gi|322386752|ref|ZP_08060376.1| 30S ribosomal protein S18 [Streptococcus cristatus ATCC 51100]
 gi|322387422|ref|ZP_08061032.1| 30S ribosomal protein S18 [Streptococcus infantis ATCC 700779]
 gi|322390175|ref|ZP_08063707.1| 30S ribosomal protein S18 [Streptococcus parasanguinis ATCC 903]
 gi|322391659|ref|ZP_08065127.1| 30S ribosomal protein S18 [Streptococcus peroris ATCC 700780]
 gi|323353389|ref|ZP_08087922.1| 30S ribosomal protein S18 [Streptococcus sanguinis VMC66]
 gi|331266016|ref|YP_004325646.1| 30S ribosomal protein S18 [Streptococcus oralis Uo5]
 gi|54039416|sp|P66473|RS18_STRR6 RecName: Full=30S ribosomal protein S18
 gi|54039417|sp|P66474|RS18_STRMU RecName: Full=30S ribosomal protein S18
 gi|54042150|sp|P66472|RS18_STRPN RecName: Full=30S ribosomal protein S18
 gi|122278326|sp|Q04JL0|RS18_STRP2 RecName: Full=30S ribosomal protein S18
 gi|166222248|sp|A3CL34|RS18_STRSV RecName: Full=30S ribosomal protein S18
 gi|189029694|sp|A8AZD5|RS18_STRGC RecName: Full=30S ribosomal protein S18
 gi|229560071|sp|B1ICV9|RS18_STRPI RecName: Full=30S ribosomal protein S18
 gi|229560072|sp|B2IR58|RS18_STRPS RecName: Full=30S ribosomal protein S18
 gi|254812957|sp|C1C8C8|RS18_STRP7 RecName: Full=30S ribosomal protein S18
 gi|254812958|sp|B8ZLD9|RS18_STRPJ RecName: Full=30S ribosomal protein S18
 gi|254812960|sp|C1CFC0|RS18_STRZJ RecName: Full=30S ribosomal protein S18
 gi|254812961|sp|C1CLN8|RS18_STRZP RecName: Full=30S ribosomal protein S18
 gi|254812962|sp|C1CSF7|RS18_STRZT RecName: Full=30S ribosomal protein S18
 gi|24378225|gb|AAN59479.1|AE015012_8 30S ribosomal protein S18 [Streptococcus mutans UA159]
 gi|14973029|gb|AAK75627.1| ribosomal protein S18 [Streptococcus pneumoniae TIGR4]
 gi|15459045|gb|AAL00198.1| 30S Ribosomal protein S18 [Streptococcus pneumoniae R6]
 gi|116077326|gb|ABJ55046.1| ribosomal protein S18 [Streptococcus pneumoniae D39]
 gi|125497223|gb|ABN43889.1| 30S ribosomal protein S18, putative [Streptococcus sanguinis
          SK36]
 gi|147756452|gb|EDK63493.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP11-BS70]
 gi|147758699|gb|EDK65696.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP14-BS69]
 gi|147760907|gb|EDK67877.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP18-BS74]
 gi|147764208|gb|EDK71140.1| hypothetical protein CGSSp19BS75_07412 [Streptococcus pneumoniae
          SP19-BS75]
 gi|147922909|gb|EDK74025.1| hypothetical protein CGSSp3BS71_09631 [Streptococcus pneumoniae
          SP3-BS71]
 gi|147925786|gb|EDK76861.1| hypothetical protein CGSSp6BS73_08674 [Streptococcus pneumoniae
          SP6-BS73]
 gi|147928588|gb|EDK79602.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP9-BS68]
 gi|147930049|gb|EDK81036.1| hypothetical protein CGSSp23BS72_09623 [Streptococcus pneumoniae
          SP23-BS72]
 gi|157075228|gb|ABV09911.1| ribosomal protein S18 [Streptococcus gordonii str. Challis
          substr. CH1]
 gi|168995022|gb|ACA35634.1| ribosomal protein S18 [Streptococcus pneumoniae Hungary19A-6]
 gi|171282318|gb|EDT47745.1| hypothetical protein STRINF_01110 [Streptococcus infantarius
          subsp. infantarius ATCC BAA-102]
 gi|172041899|gb|EDT49945.1| ribosomal protein S18 [Streptococcus pneumoniae CDC1873-00]
 gi|182629829|gb|ACB90777.1| 30S ribosomal protein S18 [Streptococcus pneumoniae CGSP14]
 gi|183569672|gb|EDT90200.1| ribosomal protein S18 [Streptococcus pneumoniae CDC1087-00]
 gi|183572611|gb|EDT93139.1| ribosomal protein S18 [Streptococcus pneumoniae SP195]
 gi|183574282|gb|EDT94810.1| ribosomal protein S18 [Streptococcus pneumoniae CDC0288-04]
 gi|183576411|gb|EDT96939.1| ribosomal protein S18 [Streptococcus pneumoniae CDC3059-06]
 gi|183578889|gb|EDT99417.1| ribosomal protein S18 [Streptococcus pneumoniae MLV-016]
 gi|220674711|emb|CAR69284.1| 30S ribosomal protein S18 [Streptococcus pneumoniae ATCC 700669]
 gi|225721900|gb|ACO17754.1| ribosomal protein S18 [Streptococcus pneumoniae 70585]
 gi|225723663|gb|ACO19516.1| ribosomal protein S18 [Streptococcus pneumoniae JJA]
 gi|225724494|gb|ACO20346.1| ribosomal protein S18 [Streptococcus pneumoniae P1031]
 gi|225728310|gb|ACO24161.1| ribosomal protein S18 [Streptococcus pneumoniae Taiwan19F-14]
 gi|254996706|dbj|BAH87307.1| 30S ribosomal protein S18 [Streptococcus mutans NN2025]
 gi|262261014|gb|EEY79714.1| ribosomal protein S18 [Streptococcus sp. 2_1_36FAA]
 gi|270278411|gb|EFA24257.1| ribosomal protein S18 [Streptococcus sp. M143]
 gi|288732825|emb|CBI14401.1| ribosomal protein S18 [Streptococcus gallolyticus UCN34]
 gi|288907921|emb|CBJ22761.1| 30S ribosomal protein S18 [Streptococcus mitis B6]
 gi|291315650|gb|EFE56098.1| 30S ribosomal protein S18 [Streptococcus oralis ATCC 35037]
 gi|296433106|gb|EFH18892.1| 30S ribosomal protein S18 [Streptococcus parasanguinis ATCC
          15912]
 gi|298238870|gb|ADI70001.1| 30S ribosomal protein S18 [Streptococcus pneumoniae TCH8431/19A]
 gi|301794548|emb|CBW36992.1| 30S ribosomal protein S18 [Streptococcus pneumoniae INV104]
 gi|301800372|emb|CBW33003.1| 30S ribosomal protein S18 [Streptococcus pneumoniae OXC141]
 gi|301802257|emb|CBW35009.1| 30S ribosomal protein S18 [Streptococcus pneumoniae INV200]
 gi|302597693|gb|EFL64769.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS455]
 gi|302636273|gb|EFL66767.1| 30S ribosomal protein S18 [Streptococcus pneumoniae SP14-BS292]
 gi|302638663|gb|EFL69126.1| 30S ribosomal protein S18 [Streptococcus pneumoniae SP-BS293]
 gi|302641071|gb|EFL71448.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS458]
 gi|302643999|gb|EFL74258.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS457]
 gi|302645477|gb|EFL75709.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS397]
 gi|304423601|gb|EFM26748.1| 30S ribosomal protein S18 [Streptococcus bovis ATCC 700338]
 gi|304425577|gb|EFM28695.1| 30S ribosomal protein S18 [Streptococcus gallolyticus subsp.
          gallolyticus TX20005]
 gi|304427860|gb|EFM30953.1| 30S ribosomal protein S18 [Streptococcus mitis ATCC 6249]
 gi|304433080|gb|EFM36052.1| 30S ribosomal protein S18 [Streptococcus sp. oral taxon 071 str.
          73H25AP]
 gi|306409720|gb|ADM85147.1| hypothetical protein SPAP_1561 [Streptococcus pneumoniae AP200]
 gi|306484809|gb|ADM91678.1| ribosomal protein S18 [Streptococcus pneumoniae 670-6B]
 gi|307615824|gb|EFN95030.1| ribosomal protein S18 [Streptococcus mitis NCTC 12261]
 gi|307618392|gb|EFN97542.1| ribosomal protein S18 [Streptococcus mitis SK321]
 gi|307620412|gb|EFN99525.1| ribosomal protein S18 [Streptococcus mitis SK564]
 gi|307622029|gb|EFO01054.1| ribosomal protein S18 [Streptococcus mitis SK597]
 gi|307623171|gb|EFO02163.1| ribosomal protein S18 [Streptococcus oralis ATCC 35037]
 gi|308117827|gb|EFO55228.1| ribosomal protein S18 [Streptococcus infantis SK1302]
 gi|311096222|gb|EFQ54466.1| ribosomal protein S18 [Streptococcus parasanguinis F0405]
 gi|311099539|gb|EFQ57753.1| ribosomal protein S18 [Streptococcus downei F0415]
 gi|315188636|gb|EFU22345.1| ribosomal protein S18 [Streptococcus anginosus F0211]
 gi|315314200|gb|EFU62245.1| 30S ribosomal protein S18 [Streptococcus sanguinis ATCC 49296]
 gi|319747506|gb|EFV99761.1| 30S ribosomal protein S18 [Streptococcus australis ATCC 700641]
 gi|319810930|gb|EFW07249.1| 30S ribosomal protein S18 [Streptococcus anginosus 1_2_62CV]
 gi|320447830|gb|EFW88587.1| 30S ribosomal protein S18 [Streptococcus equinus ATCC 9812]
 gi|321141951|gb|EFX37446.1| 30S ribosomal protein S18 [Streptococcus infantis ATCC 700779]
 gi|321143135|gb|EFX38581.1| 30S ribosomal protein S18 [Streptococcus parasanguinis ATCC 903]
 gi|321145470|gb|EFX40863.1| 30S ribosomal protein S18 [Streptococcus peroris ATCC 700780]
 gi|321269034|gb|EFX51970.1| 30S ribosomal protein S18 [Streptococcus cristatus ATCC 51100]
 gi|321278748|gb|EFX55817.1| ribosomal protein S18 [Streptococcus sp. C150]
 gi|321279298|gb|EFX56339.1| ribosomal protein S18 [Streptococcus sp. C300]
 gi|321282833|gb|EFX59840.1| ribosomal protein S18 [Streptococcus sp. M334]
 gi|322121335|gb|EFX93098.1| 30S ribosomal protein S18 [Streptococcus sanguinis VMC66]
 gi|324990242|gb|EGC22180.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK353]
 gi|324992066|gb|EGC23988.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK405]
 gi|324994159|gb|EGC26073.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK678]
 gi|325688012|gb|EGD30031.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK72]
 gi|325690403|gb|EGD32407.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK115]
 gi|325693669|gb|EGD35588.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK150]
 gi|325697625|gb|EGD39510.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK160]
 gi|326682688|emb|CBZ00305.1| 30S ribosomal protein S18 [Streptococcus oralis Uo5]
 gi|327389725|gb|EGE88070.1| ribosomal protein S18 [Streptococcus pneumoniae GA04375]
 gi|327458971|gb|EGF05319.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK1057]
 gi|327459368|gb|EGF05714.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK1]
 gi|327469240|gb|EGF14712.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK330]
 gi|327472789|gb|EGF18216.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK408]
 gi|327490584|gb|EGF22365.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK1058]
 gi|328945789|gb|EGG39940.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK1087]
 gi|332072332|gb|EGI82815.1| ribosomal protein S18 [Streptococcus pneumoniae GA17570]
 gi|332073877|gb|EGI84355.1| ribosomal protein S18 [Streptococcus pneumoniae GA41301]
 gi|332074294|gb|EGI84771.1| ribosomal protein S18 [Streptococcus pneumoniae GA17545]
 gi|332199584|gb|EGJ13659.1| ribosomal protein S18 [Streptococcus pneumoniae GA41317]
 gi|332200101|gb|EGJ14174.1| ribosomal protein S18 [Streptococcus pneumoniae GA47368]
 gi|332200980|gb|EGJ15051.1| ribosomal protein S18 [Streptococcus pneumoniae GA47901]
 gi|332357976|gb|EGJ35809.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK1056]
 gi|332363248|gb|EGJ41033.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK49]
 gi|332363798|gb|EGJ41577.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK355]
 gi|332364668|gb|EGJ42437.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK1059]
          Length = 79

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 11 RRNVSHRRKSCP-LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          RR    RRK    ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  AI
Sbjct: 5  RRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAI 64

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ +VN
Sbjct: 65 KRARVMALMPFVN 77


>gi|134295902|ref|YP_001119637.1| 30S ribosomal protein S18 [Burkholderia vietnamiensis G4]
 gi|166220935|sp|A4JEU9|RS18_BURVG RecName: Full=30S ribosomal protein S18
 gi|134139059|gb|ABO54802.1| SSU ribosomal protein S18P [Burkholderia vietnamiensis G4]
          Length = 91

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G  +IDYKD   L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RKKFCRFTAAGVDQIDYKDTETLKDFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LLPYTD 87


>gi|320528729|ref|ZP_08029881.1| ribosomal protein S18 [Solobacterium moorei F0204]
 gi|320130939|gb|EFW23517.1| ribosomal protein S18 [Solobacterium moorei F0204]
          Length = 76

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 42/73 (57%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R+    RRK C  +      IDYKD+ LL +F+S  GKI P R++    K QR LA AI
Sbjct: 3  FRKQRMGRRKVCYFTKNNITYIDYKDVELLKKFVSANGKITPRRVTGTRAKYQRMLAIAI 62

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ YV 
Sbjct: 63 KRARQMALLPYVE 75


>gi|88704449|ref|ZP_01102163.1| 30S ribosomal protein S18 [Congregibacter litoralis KT71]
 gi|88701500|gb|EAQ98605.1| 30S ribosomal protein S18 [Congregibacter litoralis KT71]
          Length = 75

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++S+ GKIVPSRI+    K QR+L+ A+KRAR+L L+ Y +
Sbjct: 14 TAEGVKEIDYKDLDTLKAYISETGKIVPSRITGTKAKYQRQLSTAVKRARFLALLPYTD 72


>gi|186685032|ref|YP_001868228.1| 30S ribosomal protein S18 [Nostoc punctiforme PCC 73102]
 gi|229560047|sp|B2J0D3|RS18_NOSP7 RecName: Full=30S ribosomal protein S18
 gi|186467484|gb|ACC83285.1| ribosomal protein S18 [Nostoc punctiforme PCC 73102]
          Length = 71

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 49/67 (73%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RR+  P+   G P IDYKD+ LL +F+++RGKI+P RI+ ++ ++QREL  AIKR+R +
Sbjct: 4  FRRRLSPIK-PGEP-IDYKDVDLLRKFVTERGKILPRRITGLTSQQQRELTLAIKRSRIV 61

Query: 76 GLIAYVN 82
           L+ ++N
Sbjct: 62 ALLPFIN 68


>gi|317503266|ref|ZP_07961321.1| 30S ribosomal protein S18 [Prevotella salivae DSM 15606]
 gi|315665623|gb|EFV05235.1| 30S ribosomal protein S18 [Prevotella salivae DSM 15606]
          Length = 90

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 44/68 (64%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + ++K C     G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+AIKRAR 
Sbjct: 19 TRKKKYCRFKKSGIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAIKRARQ 78

Query: 75 LGLIAYVN 82
          + L+ YV 
Sbjct: 79 IALLPYVT 86


>gi|53719096|ref|YP_108082.1| 30S ribosomal protein S18 [Burkholderia pseudomallei K96243]
 gi|53723579|ref|YP_103058.1| 30S ribosomal protein S18 [Burkholderia mallei ATCC 23344]
 gi|67640202|ref|ZP_00439017.1| 30S ribosomal protein S18 [Burkholderia mallei GB8 horse 4]
 gi|76812240|ref|YP_333809.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1710b]
 gi|83719433|ref|YP_442702.1| 30S ribosomal protein S18 [Burkholderia thailandensis E264]
 gi|107028949|ref|YP_626044.1| 30S ribosomal protein S18 [Burkholderia cenocepacia AU 1054]
 gi|116689893|ref|YP_835516.1| 30S ribosomal protein S18 [Burkholderia cenocepacia HI2424]
 gi|121598687|ref|YP_993212.1| 30S ribosomal protein S18 [Burkholderia mallei SAVP1]
 gi|124384536|ref|YP_001026013.1| 30S ribosomal protein S18 [Burkholderia mallei NCTC 10229]
 gi|126438832|ref|YP_001059285.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 668]
 gi|126448650|ref|YP_001080720.1| 30S ribosomal protein S18 [Burkholderia mallei NCTC 10247]
 gi|126454887|ref|YP_001066553.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1106a]
 gi|134278013|ref|ZP_01764728.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 305]
 gi|161524575|ref|YP_001579587.1| 30S ribosomal protein S18 [Burkholderia multivorans ATCC 17616]
 gi|167002902|ref|ZP_02268692.1| 30S ribosomal protein S18 [Burkholderia mallei PRL-20]
 gi|167562481|ref|ZP_02355397.1| ribosomal protein S18 [Burkholderia oklahomensis EO147]
 gi|167569665|ref|ZP_02362539.1| ribosomal protein S18 [Burkholderia oklahomensis C6786]
 gi|167581641|ref|ZP_02374515.1| ribosomal protein S18 [Burkholderia thailandensis TXDOH]
 gi|167586988|ref|ZP_02379376.1| ribosomal protein S18 [Burkholderia ubonensis Bu]
 gi|167619761|ref|ZP_02388392.1| ribosomal protein S18 [Burkholderia thailandensis Bt4]
 gi|167719192|ref|ZP_02402428.1| ribosomal protein S18 [Burkholderia pseudomallei DM98]
 gi|167738194|ref|ZP_02410968.1| ribosomal protein S18 [Burkholderia pseudomallei 14]
 gi|167815383|ref|ZP_02447063.1| ribosomal protein S18 [Burkholderia pseudomallei 91]
 gi|167823791|ref|ZP_02455262.1| ribosomal protein S18 [Burkholderia pseudomallei 9]
 gi|167836331|ref|ZP_02463214.1| ribosomal protein S18 [Burkholderia thailandensis MSMB43]
 gi|167845334|ref|ZP_02470842.1| ribosomal protein S18 [Burkholderia pseudomallei B7210]
 gi|167893876|ref|ZP_02481278.1| ribosomal protein S18 [Burkholderia pseudomallei 7894]
 gi|167902330|ref|ZP_02489535.1| ribosomal protein S18 [Burkholderia pseudomallei NCTC 13177]
 gi|167910568|ref|ZP_02497659.1| ribosomal protein S18 [Burkholderia pseudomallei 112]
 gi|167918594|ref|ZP_02505685.1| ribosomal protein S18 [Burkholderia pseudomallei BCC215]
 gi|189350669|ref|YP_001946297.1| 30S ribosomal protein S18 [Burkholderia multivorans ATCC 17616]
 gi|217421371|ref|ZP_03452875.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 576]
 gi|221198144|ref|ZP_03571190.1| 30S ribosomal protein S18 [Burkholderia multivorans CGD2M]
 gi|221208365|ref|ZP_03581368.1| 30S ribosomal protein S18 [Burkholderia multivorans CGD2]
 gi|221215116|ref|ZP_03588083.1| 30S ribosomal protein S18 [Burkholderia multivorans CGD1]
 gi|226197276|ref|ZP_03792853.1| 30S ribosomal protein S18 [Burkholderia pseudomallei Pakistan 9]
 gi|237812611|ref|YP_002897062.1| ribosomal protein S18 [Burkholderia pseudomallei MSHR346]
 gi|242316691|ref|ZP_04815707.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1106b]
 gi|254178433|ref|ZP_04885088.1| 30S ribosomal protein S18 [Burkholderia mallei ATCC 10399]
 gi|254179492|ref|ZP_04886091.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1655]
 gi|254189116|ref|ZP_04895627.1| 30S ribosomal protein S18 [Burkholderia pseudomallei Pasteur
          52237]
 gi|254197494|ref|ZP_04903916.1| 30S ribosomal protein S18 [Burkholderia pseudomallei S13]
 gi|254200004|ref|ZP_04906370.1| 30S ribosomal protein S18 [Burkholderia mallei FMH]
 gi|254206337|ref|ZP_04912689.1| 30S ribosomal protein S18 [Burkholderia mallei JHU]
 gi|254248017|ref|ZP_04941338.1| Ribosomal protein S18 [Burkholderia cenocepacia PC184]
 gi|254261784|ref|ZP_04952838.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1710a]
 gi|254297374|ref|ZP_04964827.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 406e]
 gi|254358248|ref|ZP_04974521.1| 30S ribosomal protein S18 [Burkholderia mallei 2002721280]
 gi|257138914|ref|ZP_05587176.1| 30S ribosomal protein S18 [Burkholderia thailandensis E264]
 gi|59798633|sp|Q62JR1|RS18_BURMA RecName: Full=30S ribosomal protein S18
 gi|59798645|sp|Q63UY4|RS18_BURPS RecName: Full=30S ribosomal protein S18
 gi|123179948|sp|Q1BH34|RS18_BURCA RecName: Full=30S ribosomal protein S18
 gi|123598874|sp|Q3JRJ4|RS18_BURP1 RecName: Full=30S ribosomal protein S18
 gi|123753784|sp|Q2SWJ7|RS18_BURTA RecName: Full=30S ribosomal protein S18
 gi|166220929|sp|A0K7Z6|RS18_BURCH RecName: Full=30S ribosomal protein S18
 gi|166220930|sp|A3MKD4|RS18_BURM7 RecName: Full=30S ribosomal protein S18
 gi|166220931|sp|A2S244|RS18_BURM9 RecName: Full=30S ribosomal protein S18
 gi|166220932|sp|A1V4Q9|RS18_BURMS RecName: Full=30S ribosomal protein S18
 gi|166220933|sp|A3NW32|RS18_BURP0 RecName: Full=30S ribosomal protein S18
 gi|166220934|sp|A3NAB4|RS18_BURP6 RecName: Full=30S ribosomal protein S18
 gi|229559971|sp|A9AJW3|RS18_BURM1 RecName: Full=30S ribosomal protein S18
 gi|52209510|emb|CAH35462.1| 30S ribosomal protein S18 [Burkholderia pseudomallei K96243]
 gi|52427002|gb|AAU47595.1| ribosomal protein S18 [Burkholderia mallei ATCC 23344]
 gi|76581693|gb|ABA51168.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1710b]
 gi|83653258|gb|ABC37321.1| ribosomal protein S18 [Burkholderia thailandensis E264]
 gi|105898113|gb|ABF81071.1| SSU ribosomal protein S18P [Burkholderia cenocepacia AU 1054]
 gi|116647982|gb|ABK08623.1| SSU ribosomal protein S18P [Burkholderia cenocepacia HI2424]
 gi|121227497|gb|ABM50015.1| 30S ribosomal protein S18 [Burkholderia mallei SAVP1]
 gi|124292556|gb|ABN01825.1| 30S ribosomal protein S18 [Burkholderia mallei NCTC 10229]
 gi|124872793|gb|EAY64509.1| Ribosomal protein S18 [Burkholderia cenocepacia PC184]
 gi|126218325|gb|ABN81831.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 668]
 gi|126228529|gb|ABN92069.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1106a]
 gi|126241520|gb|ABO04613.1| 30S ribosomal protein S18 [Burkholderia mallei NCTC 10247]
 gi|134251663|gb|EBA51742.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 305]
 gi|147749600|gb|EDK56674.1| 30S ribosomal protein S18 [Burkholderia mallei FMH]
 gi|147753780|gb|EDK60845.1| 30S ribosomal protein S18 [Burkholderia mallei JHU]
 gi|148027375|gb|EDK85396.1| 30S ribosomal protein S18 [Burkholderia mallei 2002721280]
 gi|157807650|gb|EDO84820.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 406e]
 gi|157936795|gb|EDO92465.1| 30S ribosomal protein S18 [Burkholderia pseudomallei Pasteur
          52237]
 gi|160342004|gb|ABX15090.1| ribosomal protein S18 [Burkholderia multivorans ATCC 17616]
 gi|160699472|gb|EDP89442.1| 30S ribosomal protein S18 [Burkholderia mallei ATCC 10399]
 gi|169654235|gb|EDS86928.1| 30S ribosomal protein S18 [Burkholderia pseudomallei S13]
 gi|184210032|gb|EDU07075.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1655]
 gi|189334691|dbj|BAG43761.1| small subunit ribosomal protein S18 [Burkholderia multivorans
          ATCC 17616]
 gi|217395113|gb|EEC35131.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 576]
 gi|221165052|gb|EED97531.1| 30S ribosomal protein S18 [Burkholderia multivorans CGD1]
 gi|221171778|gb|EEE04222.1| 30S ribosomal protein S18 [Burkholderia multivorans CGD2]
 gi|221182076|gb|EEE14477.1| 30S ribosomal protein S18 [Burkholderia multivorans CGD2M]
 gi|225930655|gb|EEH26665.1| 30S ribosomal protein S18 [Burkholderia pseudomallei Pakistan 9]
 gi|237506129|gb|ACQ98447.1| ribosomal protein S18 [Burkholderia pseudomallei MSHR346]
 gi|238520888|gb|EEP84344.1| 30S ribosomal protein S18 [Burkholderia mallei GB8 horse 4]
 gi|242139930|gb|EES26332.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1106b]
 gi|243061456|gb|EES43642.1| 30S ribosomal protein S18 [Burkholderia mallei PRL-20]
 gi|254220473|gb|EET09857.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1710a]
 gi|325522549|gb|EGD01101.1| 30S ribosomal protein S18 [Burkholderia sp. TJI49]
          Length = 91

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G  +IDYKD   L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RKKFCRFTAAGVEQIDYKDTETLKDFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LLPYTD 87


>gi|229496127|ref|ZP_04389848.1| ribosomal protein S18 [Porphyromonas endodontalis ATCC 35406]
 gi|229316958|gb|EEN82870.1| ribosomal protein S18 [Porphyromonas endodontalis ATCC 35406]
          Length = 90

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (67%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S+++K C     G   IDYKD   L +FL+++G+I+P RI+  S K QR +A+A+KRAR+
Sbjct: 19 SNKKKYCRFKKSGIKYIDYKDPEFLKKFLNEQGRILPRRITGTSLKFQRRIARAVKRARH 78

Query: 75 LGLIAYVN 82
          L L+ +V 
Sbjct: 79 LALLPFVT 86


>gi|33240418|ref|NP_875360.1| 30S ribosomal protein S18 [Prochlorococcus marinus subsp. marinus
          str. CCMP1375]
 gi|59798853|sp|Q7VBX4|RS18_PROMA RecName: Full=30S ribosomal protein S18
 gi|33237945|gb|AAQ00013.1| Ribosomal protein S18 [Prochlorococcus marinus subsp. marinus
          str. CCMP1375]
          Length = 73

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 49/70 (70%), Gaps = 2/70 (2%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
          N   ++K  P+   G P IDYKD+  L +F+++RGKI+P R++ ++ K+QR+L  A+KRA
Sbjct: 3  NSLFKKKLSPIK-PGDP-IDYKDVETLKKFITERGKILPRRLTGLTAKQQRDLTTAVKRA 60

Query: 73 RYLGLIAYVN 82
          R + L+ +VN
Sbjct: 61 RIIALLPFVN 70


>gi|241895860|ref|ZP_04783156.1| 30S ribosomal protein S18 [Weissella paramesenteroides ATCC
          33313]
 gi|241870903|gb|EER74654.1| 30S ribosomal protein S18 [Weissella paramesenteroides ATCC
          33313]
          Length = 80

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 39/51 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          +DYKD  LL RF+S+RGKI+P R++  S K QR++  AIKRAR +GL+ +V
Sbjct: 27 VDYKDTELLERFISERGKILPRRVTGTSAKNQRKVTTAIKRARIMGLLPFV 77


>gi|313674400|ref|YP_004052396.1| SSU ribosomal protein s18p [Marivirga tractuosa DSM 4126]
 gi|312941098|gb|ADR20288.1| SSU ribosomal protein S18P [Marivirga tractuosa DSM 4126]
          Length = 85

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 51/74 (68%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P+ ++   +++K C     G   IDYKD   L +F++++GK++PSRI+  S K Q+++A+
Sbjct: 7  PINQKKQDNQKKYCRFKRYGIKYIDYKDPNFLLKFVNEQGKLLPSRITGTSAKYQKKVAQ 66

Query: 68 AIKRARYLGLIAYV 81
          A+KRAR++ L+ YV
Sbjct: 67 AVKRARHIALLPYV 80


>gi|217967743|ref|YP_002353249.1| ribosomal protein S18 [Dictyoglomus turgidum DSM 6724]
 gi|254765428|sp|B8E0J0|RS18_DICTD RecName: Full=30S ribosomal protein S18
 gi|217336842|gb|ACK42635.1| ribosomal protein S18 [Dictyoglomus turgidum DSM 6724]
          Length = 84

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 44/65 (67%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K C    +    IDYK++  L RF++++GKI+P RIS    + QR+L+ AIKRARY+ 
Sbjct: 18 KKKYCIFCSEKIDYIDYKNVERLKRFMTEKGKIIPRRISGNCARHQRQLSTAIKRARYMA 77

Query: 77 LIAYV 81
          L+ YV
Sbjct: 78 LLPYV 82


>gi|194396735|ref|YP_002038171.1| 30S ribosomal protein S18 [Streptococcus pneumoniae G54]
 gi|229560070|sp|B5E6A4|RS18_STRP4 RecName: Full=30S ribosomal protein S18
 gi|194356402|gb|ACF54850.1| ribosomal protein S18 [Streptococcus pneumoniae G54]
          Length = 79

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 11 RRNVSHRRKSCP-LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          RR    RRK    ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  AI
Sbjct: 5  RRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTXAI 64

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ +VN
Sbjct: 65 KRARVMALMPFVN 77


>gi|78066641|ref|YP_369410.1| 30S ribosomal protein S18 [Burkholderia sp. 383]
 gi|170703446|ref|ZP_02894217.1| ribosomal protein S18 [Burkholderia ambifaria IOP40-10]
 gi|170733231|ref|YP_001765178.1| 30S ribosomal protein S18 [Burkholderia cenocepacia MC0-3]
 gi|171321592|ref|ZP_02910523.1| ribosomal protein S18 [Burkholderia ambifaria MEX-5]
 gi|206560307|ref|YP_002231071.1| 30S ribosomal protein S18 [Burkholderia cenocepacia J2315]
 gi|238027018|ref|YP_002911249.1| 30S ribosomal protein S18 [Burkholderia glumae BGR1]
 gi|254252204|ref|ZP_04945522.1| Ribosomal protein S18 [Burkholderia dolosa AUO158]
 gi|330817223|ref|YP_004360928.1| 30S ribosomal protein S18 [Burkholderia gladioli BSR3]
 gi|123742574|sp|Q39FK0|RS18_BURS3 RecName: Full=30S ribosomal protein S18
 gi|229559969|sp|B1JTF1|RS18_BURCC RecName: Full=30S ribosomal protein S18
 gi|229559970|sp|B4EBH1|RS18_BURCJ RecName: Full=30S ribosomal protein S18
 gi|77967386|gb|ABB08766.1| SSU ribosomal protein S18P [Burkholderia sp. 383]
 gi|124894813|gb|EAY68693.1| Ribosomal protein S18 [Burkholderia dolosa AUO158]
 gi|169816473|gb|ACA91056.1| ribosomal protein S18 [Burkholderia cenocepacia MC0-3]
 gi|170131644|gb|EDT00201.1| ribosomal protein S18 [Burkholderia ambifaria IOP40-10]
 gi|171093125|gb|EDT38342.1| ribosomal protein S18 [Burkholderia ambifaria MEX-5]
 gi|198036348|emb|CAR52244.1| 30S ribosomal protein S18 [Burkholderia cenocepacia J2315]
 gi|237876212|gb|ACR28545.1| 30S ribosomal protein S18 [Burkholderia glumae BGR1]
 gi|327369616|gb|AEA60972.1| 30S ribosomal protein S18 [Burkholderia gladioli BSR3]
          Length = 91

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G  +IDYKD   L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RKKFCRFTAAGVEQIDYKDTETLKDFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LLPYTD 87


>gi|37522628|ref|NP_926005.1| 30S ribosomal protein S18 [Gloeobacter violaceus PCC 7421]
 gi|59798825|sp|Q7NCC0|RS18_GLOVI RecName: Full=30S ribosomal protein S18
 gi|35213629|dbj|BAC91000.1| 30S ribosomal protein S18 [Gloeobacter violaceus PCC 7421]
          Length = 74

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 43/53 (81%)

Query: 30 RIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          +IDYK++ LL +F+++RGKI+P RI+ ++ K+QR+L  AIKRAR L L+ +VN
Sbjct: 19 KIDYKEVDLLRKFITERGKILPRRITGLTAKQQRDLTVAIKRARLLALLPFVN 71


>gi|33863012|ref|NP_894572.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9313]
 gi|124023182|ref|YP_001017489.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9303]
 gi|59798838|sp|Q7TUZ8|RS18_PROMM RecName: Full=30S ribosomal protein S18
 gi|166220972|sp|A2C9R4|RS18_PROM3 RecName: Full=30S ribosomal protein S18
 gi|33634929|emb|CAE20915.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9313]
 gi|123963468|gb|ABM78224.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9303]
          Length = 73

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 43/56 (76%), Gaps = 1/56 (1%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G P IDYKD+ LL +F++ RGKI+P R++ ++ K+QR+L  A+KRAR + L+ +VN
Sbjct: 16 GDP-IDYKDVDLLKKFITDRGKILPRRLTGLTSKQQRDLTNAVKRARIIALLPFVN 70


>gi|81427625|ref|YP_394622.1| 30S ribosomal protein S18 [Lactobacillus sakei subsp. sakei 23K]
 gi|123742279|sp|Q38ZR6|RS18_LACSS RecName: Full=30S ribosomal protein S18
 gi|78609264|emb|CAI54311.1| 30S Ribosomal protein S18 [Lactobacillus sakei subsp. sakei 23K]
          Length = 79

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/52 (59%), Positives = 38/52 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD  LL RF+S+RGKI+P R+S  S K QR L  AIKRAR +GL+ +V 
Sbjct: 26 IDYKDTDLLKRFISERGKILPRRVSGTSAKNQRRLTIAIKRARIMGLLPFVT 77


>gi|15829080|ref|NP_326440.1| 30S ribosomal protein S18 [Mycoplasma pulmonis UAB CTIP]
 gi|20978725|sp|Q98PW0|RS18_MYCPU RecName: Full=30S ribosomal protein S18
 gi|14090024|emb|CAC13782.1| 30S RIBOSOMAL PROTEIN S18 [Mycoplasma pulmonis]
          Length = 105

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (72%)

Query: 23 LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          L  +G   IDYKD+ LL++F++  GKI+PS+I+ VS K+QR L +AIKRAR + L+ + 
Sbjct: 20 LDEQGINYIDYKDVELLSKFINSHGKILPSKITDVSAKRQRMLTRAIKRARNMALLPFT 78


>gi|115351860|ref|YP_773699.1| 30S ribosomal protein S18 [Burkholderia ambifaria AMMD]
 gi|172060830|ref|YP_001808482.1| 30S ribosomal protein S18 [Burkholderia ambifaria MC40-6]
 gi|122323038|sp|Q0BEQ8|RS18_BURCM RecName: Full=30S ribosomal protein S18
 gi|229559968|sp|B1YRJ2|RS18_BURA4 RecName: Full=30S ribosomal protein S18
 gi|115281848|gb|ABI87365.1| SSU ribosomal protein S18P [Burkholderia ambifaria AMMD]
 gi|171993347|gb|ACB64266.1| ribosomal protein S18 [Burkholderia ambifaria MC40-6]
          Length = 91

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G  +IDYKD   L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RKKFCRFTAAGVDQIDYKDTETLKDFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LLPYTD 87


>gi|237809238|ref|YP_002893678.1| 30S ribosomal protein S18 [Tolumonas auensis DSM 9187]
 gi|259494821|sp|C4LAB7|RS18_TOLAT RecName: Full=30S ribosomal protein S18
 gi|237501499|gb|ACQ94092.1| ribosomal protein S18 [Tolumonas auensis DSM 9187]
          Length = 76

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 39/53 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          IDYKD   L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL L+ Y +L
Sbjct: 21 IDYKDTVTLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLALLPYTDL 73


>gi|149377616|ref|ZP_01895354.1| ribosomal protein S18 [Marinobacter algicola DG893]
 gi|149358089|gb|EDM46573.1| ribosomal protein S18 [Marinobacter algicola DG893]
 gi|311693517|gb|ADP96390.1| ribosomal protein S18 [marine bacterium HP15]
          Length = 76

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLDTLKGYITETGKIVPSRITGTKARYQRQLATAIKRARYLALLPYSD 72


>gi|116491827|ref|YP_803562.1| SSU ribosomal protein S18P [Pediococcus pentosaceus ATCC 25745]
 gi|122266709|sp|Q03I52|RS18_PEDPA RecName: Full=30S ribosomal protein S18
 gi|116101977|gb|ABJ67120.1| SSU ribosomal protein S18P [Pediococcus pentosaceus ATCC 25745]
          Length = 78

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/51 (60%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD  LL RF+S+RGKI+P R+S  S K QR L  AIKRAR +GL+ +V
Sbjct: 25 IDYKDTELLKRFISERGKILPRRVSGTSAKNQRRLTIAIKRARIMGLLPFV 75


>gi|323341109|ref|ZP_08081357.1| 30S ribosomal protein S18 [Lactobacillus ruminis ATCC 25644]
 gi|323091530|gb|EFZ34154.1| 30S ribosomal protein S18 [Lactobacillus ruminis ATCC 25644]
          Length = 78

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 39/51 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD  LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+ +V
Sbjct: 25 IDYKDTDLLKRFISERGKILPRRVTGTSAKNQRKLTVAIKRARIMGLLPFV 75


>gi|326796491|ref|YP_004314311.1| 30S ribosomal protein S18 [Marinomonas mediterranea MMB-1]
 gi|326547255|gb|ADZ92475.1| 30S ribosomal protein S18 [Marinomonas mediterranea MMB-1]
          Length = 76

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRARY+ L+ Y +
Sbjct: 14 TAEGVKEIDYKDLDTLKGYITETGKIVPSRITGTKARYQRQLATAIKRARYIALLPYTD 72


>gi|87119507|ref|ZP_01075404.1| 30S ribosomal protein S18 [Marinomonas sp. MED121]
 gi|86164983|gb|EAQ66251.1| 30S ribosomal protein S18 [Marinomonas sp. MED121]
          Length = 76

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRARY+ L+ Y +
Sbjct: 14 TAEGTVEIDYKDLDTLKGYVTETGKIVPSRITGTKARYQRQLATAIKRARYIALLPYTD 72


>gi|307152099|ref|YP_003887483.1| 30S ribosomal protein S18 [Cyanothece sp. PCC 7822]
 gi|306982327|gb|ADN14208.1| ribosomal protein S18 [Cyanothece sp. PCC 7822]
          Length = 71

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 42/52 (80%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKDI LL +F+++RGKI+P RI+ ++ ++QR+L  A+KRAR + L+ ++N
Sbjct: 17 IDYKDIELLRKFITERGKILPRRITGLTAQQQRDLTAAVKRARLIALLPFIN 68


>gi|154503456|ref|ZP_02040516.1| hypothetical protein RUMGNA_01280 [Ruminococcus gnavus ATCC
          29149]
 gi|153795556|gb|EDN77976.1| hypothetical protein RUMGNA_01280 [Ruminococcus gnavus ATCC
          29149]
          Length = 90

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AIKRAR++ 
Sbjct: 24 RKKVCVFCGKENNEIDYKDVAKLKKYVSERGKILPRRITGNCAKHQRALTVAIKRARHIA 83

Query: 77 LIAYVN 82
          L+ YV 
Sbjct: 84 LMPYVQ 89


>gi|110638978|ref|YP_679187.1| 30S ribosomal protein S18 [Cytophaga hutchinsonii ATCC 33406]
 gi|122966648|sp|Q11RW9|RS18_CYTH3 RecName: Full=30S ribosomal protein S18
 gi|110281659|gb|ABG59845.1| SSU ribosomal protein S18P [Cytophaga hutchinsonii ATCC 33406]
          Length = 83

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 47/68 (69%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          V +R+K C     G   IDYKD   L +F++++GKI+P R++  S K QR++++A+KRAR
Sbjct: 11 VENRKKYCRFKKMGIFYIDYKDPNFLLKFVNEQGKILPRRLTGTSLKYQRKVSQAVKRAR 70

Query: 74 YLGLIAYV 81
           +GL+ YV
Sbjct: 71 LIGLLPYV 78


>gi|270289884|ref|ZP_06196110.1| 30S ribosomal protein S18 [Pediococcus acidilactici 7_4]
 gi|304385863|ref|ZP_07368207.1| 30S ribosomal protein S18 [Pediococcus acidilactici DSM 20284]
 gi|270281421|gb|EFA27253.1| 30S ribosomal protein S18 [Pediococcus acidilactici 7_4]
 gi|304328367|gb|EFL95589.1| 30S ribosomal protein S18 [Pediococcus acidilactici DSM 20284]
          Length = 78

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/51 (60%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD  LL RF+S+RGKI+P R+S  S K QR L  AIKRAR +GL+ +V
Sbjct: 25 IDYKDTELLKRFISERGKILPRRVSGTSAKNQRRLTIAIKRARIMGLLPFV 75


>gi|119509768|ref|ZP_01628913.1| 30S ribosomal protein S18 [Nodularia spumigena CCY9414]
 gi|119465634|gb|EAW46526.1| 30S ribosomal protein S18 [Nodularia spumigena CCY9414]
          Length = 71

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 50/67 (74%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +RR+  P+   G P IDYKD+ LL +++++RGKI+P RI+ ++ K+QR+L  AIKRAR +
Sbjct: 4  YRRRLSPIK-PGDP-IDYKDVDLLRKYITERGKILPRRITGLTCKQQRDLTLAIKRARIV 61

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 62 ALLPFVN 68


>gi|209559923|ref|YP_002286395.1| 30S ribosomal protein S18 [Streptococcus pyogenes NZ131]
 gi|238058158|sp|B5XI38|RS18_STRPZ RecName: Full=30S ribosomal protein S18
 gi|209541124|gb|ACI61700.1| SSU ribosomal protein S18p [Streptococcus pyogenes NZ131]
          Length = 79

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/52 (55%), Positives = 39/52 (75%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          +DYKD  LL+RF+S+RGKI+P R+   S K QR++  AIKRAR + L+ YVN
Sbjct: 26 VDYKDTELLSRFVSERGKILPRRVPGTSAKNQRKVTTAIKRARVMALMPYVN 77


>gi|331091911|ref|ZP_08340743.1| hypothetical protein HMPREF9477_01386 [Lachnospiraceae bacterium
          2_1_46FAA]
 gi|330402810|gb|EGG82377.1| hypothetical protein HMPREF9477_01386 [Lachnospiraceae bacterium
          2_1_46FAA]
          Length = 87

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (63%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          A +P+ RR    R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR 
Sbjct: 9  ADSPMKRRGGRRRKKVCVFCGKENNEIDYKDVAKLRKYISERGKILPRRITGNCAKHQRA 68

Query: 65 LAKAIKRARYLGLIAYV 81
          L  AIKRAR+L L+ YV
Sbjct: 69 LTVAIKRARHLALMPYV 85


>gi|268316170|ref|YP_003289889.1| 30S ribosomal protein S18 [Rhodothermus marinus DSM 4252]
 gi|262333704|gb|ACY47501.1| ribosomal protein S18 [Rhodothermus marinus DSM 4252]
          Length = 65

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 42/51 (82%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          +DYKD+  L +F++++GKI+P RI+ VS K QR++A+AIKRAR+L L+ +V
Sbjct: 10 VDYKDVEFLKQFINEQGKILPRRITGVSAKTQRQIARAIKRARHLALLPFV 60


>gi|85859721|ref|YP_461923.1| 30S ribosomal protein S18P [Syntrophus aciditrophicus SB]
 gi|123725273|sp|Q2LUJ7|RS18_SYNAS RecName: Full=30S ribosomal protein S18
 gi|85722812|gb|ABC77755.1| SSU ribosomal protein S18P [Syntrophus aciditrophicus SB]
          Length = 88

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 45/71 (63%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          R+   HRRK C        +IDYK   +L+ ++++RGKI+P RI+    K QREL +AIK
Sbjct: 13 RKKFFHRRKYCKFCSDSTIKIDYKRPDILHDYITERGKIMPRRITGSCSKHQRELTQAIK 72

Query: 71 RARYLGLIAYV 81
          RAR + L+ +V
Sbjct: 73 RARSIALLPFV 83


>gi|319941486|ref|ZP_08015814.1| 30S ribosomal protein S18 [Sutterella wadsworthensis 3_1_45B]
 gi|319805106|gb|EFW01936.1| 30S ribosomal protein S18 [Sutterella wadsworthensis 3_1_45B]
          Length = 90

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +   +IDYKD+  L  F+ + GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 23 RRKFCRFTAEHVEQIDYKDVDTLRDFIQENGKIMPARLTGTQAHYQRQLDTAIKRARFLA 82

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 83 LLPYTD 88


>gi|312796133|ref|YP_004029055.1| SSU ribosomal protein S18P [Burkholderia rhizoxinica HKI 454]
 gi|312167908|emb|CBW74911.1| SSU ribosomal protein S18P [Burkholderia rhizoxinica HKI 454]
          Length = 91

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (59%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +      IDYKDI  L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RKKFCRFTAASVEYIDYKDIETLKDFIGENGKITPARLTGTKAHYQRQLDTAIKRARFLA 81

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 82 LLPYTDL 88


>gi|119474660|ref|ZP_01615013.1| ribosomal protein S18 [marine gamma proteobacterium HTCC2143]
 gi|119450863|gb|EAW32096.1| ribosomal protein S18 [marine gamma proteobacterium HTCC2143]
          Length = 75

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  +IDYKD+  L  ++S+ GKIVPSRI+    K QR+L+  IKRAR+L L+ Y +
Sbjct: 14 TAEGVDQIDYKDLDTLKAYVSETGKIVPSRITGTKAKYQRQLSTCIKRARFLALLPYTD 72


>gi|330718016|ref|ZP_08312616.1| 30S ribosomal protein S18 [Leuconostoc fallax KCTC 3537]
          Length = 93

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 40/52 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYK++ LL RF+S+RGKI+P R++  S K QR++  A+KRAR +GL+ +V 
Sbjct: 40 IDYKNVELLERFISERGKILPRRVTGTSAKNQRKVTTAVKRARIMGLLPFVT 91


>gi|317502276|ref|ZP_07960447.1| ribosomal protein S18 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|316896321|gb|EFV18421.1| ribosomal protein S18 [Lachnospiraceae bacterium 8_1_57FAA]
          Length = 88

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AIKRAR++ 
Sbjct: 22 RKKVCVFCGKENNEIDYKDVAKLKKYVSERGKILPRRITGNCAKHQRALTVAIKRARHIA 81

Query: 77 LIAYVN 82
          L+ YV 
Sbjct: 82 LMPYVQ 87


>gi|116513237|ref|YP_812143.1| 30S ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus ATCC BAA-365]
 gi|122275992|sp|Q04CW7|RS18_LACDB RecName: Full=30S ribosomal protein S18
 gi|116092552|gb|ABJ57705.1| SSU ribosomal protein S18P [Lactobacillus delbrueckii subsp.
          bulgaricus ATCC BAA-365]
 gi|325124864|gb|ADY84194.1| 30S Ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus 2038]
          Length = 78

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 40/51 (78%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          +DYKD+ LL  F+S+RGKI+P R++  S K QR++A AIKRAR +GL+ +V
Sbjct: 25 VDYKDVDLLKHFISERGKILPRRVTGTSAKNQRKVANAIKRARIMGLLPFV 75


>gi|69246714|ref|ZP_00604082.1| Ribosomal protein S18 [Enterococcus faecium DO]
 gi|227550648|ref|ZP_03980697.1| ribosomal protein S18 [Enterococcus faecium TX1330]
 gi|257878654|ref|ZP_05658307.1| ribosomal protein S18 [Enterococcus faecium 1,230,933]
 gi|257881320|ref|ZP_05660973.1| ribosomal protein S18 [Enterococcus faecium 1,231,502]
 gi|257885595|ref|ZP_05665248.1| ribosomal protein S18 [Enterococcus faecium 1,231,501]
 gi|257888087|ref|ZP_05667740.1| ribosomal protein S18 [Enterococcus faecium 1,141,733]
 gi|257890537|ref|ZP_05670190.1| ribosomal protein S18 [Enterococcus faecium 1,231,410]
 gi|257893112|ref|ZP_05672765.1| ribosomal protein S18 [Enterococcus faecium 1,231,408]
 gi|257896295|ref|ZP_05675948.1| ribosomal protein S18 [Enterococcus faecium Com12]
 gi|257899279|ref|ZP_05678932.1| ribosomal protein S18 [Enterococcus faecium Com15]
 gi|258615262|ref|ZP_05713032.1| 30S ribosomal protein S18 [Enterococcus faecium DO]
 gi|260558235|ref|ZP_05830431.1| ribosomal protein S18 [Enterococcus faecium C68]
 gi|261206925|ref|ZP_05921614.1| ribosomal protein S18 [Enterococcus faecium TC 6]
 gi|289566498|ref|ZP_06446922.1| 30S ribosomal protein S18 [Enterococcus faecium D344SRF]
 gi|293379376|ref|ZP_06625520.1| ribosomal protein S18 [Enterococcus faecium PC4.1]
 gi|293557087|ref|ZP_06675645.1| ribosomal protein S18 [Enterococcus faecium E1039]
 gi|293563259|ref|ZP_06677711.1| ribosomal protein S18 [Enterococcus faecium E1162]
 gi|293569151|ref|ZP_06680457.1| ribosomal protein S18 [Enterococcus faecium E1071]
 gi|293572726|ref|ZP_06683690.1| ribosomal protein S18 [Enterococcus faecium E980]
 gi|294616651|ref|ZP_06696422.1| ribosomal protein S18 [Enterococcus faecium E1636]
 gi|294619753|ref|ZP_06699158.1| ribosomal protein S18 [Enterococcus faecium E1679]
 gi|294623767|ref|ZP_06702595.1| ribosomal protein S18 [Enterococcus faecium U0317]
 gi|314940123|ref|ZP_07847303.1| ribosomal protein S18 [Enterococcus faecium TX0133a04]
 gi|314943046|ref|ZP_07849850.1| ribosomal protein S18 [Enterococcus faecium TX0133C]
 gi|314948164|ref|ZP_07851560.1| ribosomal protein S18 [Enterococcus faecium TX0082]
 gi|314953422|ref|ZP_07856340.1| ribosomal protein S18 [Enterococcus faecium TX0133A]
 gi|314993839|ref|ZP_07859175.1| ribosomal protein S18 [Enterococcus faecium TX0133B]
 gi|314998136|ref|ZP_07863018.1| ribosomal protein S18 [Enterococcus faecium TX0133a01]
 gi|68195128|gb|EAN09587.1| Ribosomal protein S18 [Enterococcus faecium DO]
 gi|227180214|gb|EEI61186.1| ribosomal protein S18 [Enterococcus faecium TX1330]
 gi|257812882|gb|EEV41640.1| ribosomal protein S18 [Enterococcus faecium 1,230,933]
 gi|257816978|gb|EEV44306.1| ribosomal protein S18 [Enterococcus faecium 1,231,502]
 gi|257821451|gb|EEV48581.1| ribosomal protein S18 [Enterococcus faecium 1,231,501]
 gi|257824141|gb|EEV51073.1| ribosomal protein S18 [Enterococcus faecium 1,141,733]
 gi|257826897|gb|EEV53523.1| ribosomal protein S18 [Enterococcus faecium 1,231,410]
 gi|257829491|gb|EEV56098.1| ribosomal protein S18 [Enterococcus faecium 1,231,408]
 gi|257832860|gb|EEV59281.1| ribosomal protein S18 [Enterococcus faecium Com12]
 gi|257837191|gb|EEV62265.1| ribosomal protein S18 [Enterococcus faecium Com15]
 gi|260075409|gb|EEW63715.1| ribosomal protein S18 [Enterococcus faecium C68]
 gi|260078553|gb|EEW66255.1| ribosomal protein S18 [Enterococcus faecium TC 6]
 gi|289161707|gb|EFD09583.1| 30S ribosomal protein S18 [Enterococcus faecium D344SRF]
 gi|291588120|gb|EFF19962.1| ribosomal protein S18 [Enterococcus faecium E1071]
 gi|291590471|gb|EFF22209.1| ribosomal protein S18 [Enterococcus faecium E1636]
 gi|291594023|gb|EFF25492.1| ribosomal protein S18 [Enterococcus faecium E1679]
 gi|291596721|gb|EFF27944.1| ribosomal protein S18 [Enterococcus faecium U0317]
 gi|291600750|gb|EFF31044.1| ribosomal protein S18 [Enterococcus faecium E1039]
 gi|291604798|gb|EFF34280.1| ribosomal protein S18 [Enterococcus faecium E1162]
 gi|291607218|gb|EFF36576.1| ribosomal protein S18 [Enterococcus faecium E980]
 gi|292641899|gb|EFF60065.1| ribosomal protein S18 [Enterococcus faecium PC4.1]
 gi|313587848|gb|EFR66693.1| ribosomal protein S18 [Enterococcus faecium TX0133a01]
 gi|313591730|gb|EFR70575.1| ribosomal protein S18 [Enterococcus faecium TX0133B]
 gi|313594525|gb|EFR73370.1| ribosomal protein S18 [Enterococcus faecium TX0133A]
 gi|313598246|gb|EFR77091.1| ribosomal protein S18 [Enterococcus faecium TX0133C]
 gi|313640628|gb|EFS05208.1| ribosomal protein S18 [Enterococcus faecium TX0133a04]
 gi|313645418|gb|EFS09998.1| ribosomal protein S18 [Enterococcus faecium TX0082]
          Length = 78

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/52 (55%), Positives = 40/52 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKDI LL RF+S+RGKI+P R++    K QR++  AIKRAR +GL+ +V+
Sbjct: 25 IDYKDIELLKRFISERGKILPRRVTGTGAKNQRKITVAIKRARIMGLLPFVS 76


>gi|259047889|ref|ZP_05738290.1| 30S ribosomal protein S18 [Granulicatella adiacens ATCC 49175]
 gi|259035566|gb|EEW36821.1| 30S ribosomal protein S18 [Granulicatella adiacens ATCC 49175]
          Length = 80

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C         IDYKD+ LL R++S++GKI+P R++    K QR L  AIKRAR +GL
Sbjct: 14 KKVCYFCANHVDYIDYKDVELLKRYISEKGKILPRRVTGTCAKHQRTLTVAIKRARIMGL 73

Query: 78 IAYVNL 83
          + +  +
Sbjct: 74 LPFTTV 79


>gi|224534030|ref|ZP_03674614.1| ribosomal protein S18 [Borrelia burgdorferi CA-11.2a]
 gi|225549263|ref|ZP_03770236.1| ribosomal protein S18 [Borrelia burgdorferi 94a]
 gi|224512866|gb|EEF83233.1| ribosomal protein S18 [Borrelia burgdorferi CA-11.2a]
 gi|225370121|gb|EEG99561.1| ribosomal protein S18 [Borrelia burgdorferi 94a]
 gi|312148403|gb|ADQ31062.1| ribosomal protein S18 [Borrelia burgdorferi JD1]
          Length = 96

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 42/65 (64%), Gaps = 1/65 (1%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RKSC     G    DYKD   L +F++++GKI+P RI+  S K QR LA  IKRARY+ 
Sbjct: 31 KRKSCKFCDSGK-HPDYKDFEFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRARYMA 89

Query: 77 LIAYV 81
          L+ +V
Sbjct: 90 LLPFV 94


>gi|332283720|ref|YP_004415631.1| 30S ribosomal protein S18 [Pusillimonas sp. T7-7]
 gi|330427673|gb|AEC19007.1| 30S ribosomal protein S18 [Pusillimonas sp. T7-7]
          Length = 90

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  +      IDYKD+  L  F+ + GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RRKFCRFTAANVDEIDYKDLDTLRDFIQENGKIIPARLTGTKAHYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LLPYTD 87


>gi|281424416|ref|ZP_06255329.1| ribosomal protein S18 [Prevotella oris F0302]
 gi|299140845|ref|ZP_07033983.1| ribosomal protein S18 [Prevotella oris C735]
 gi|281401685|gb|EFB32516.1| ribosomal protein S18 [Prevotella oris F0302]
 gi|298577811|gb|EFI49679.1| ribosomal protein S18 [Prevotella oris C735]
          Length = 90

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (64%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + ++K C     G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR 
Sbjct: 19 TRKKKYCRFKKSGIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQ 78

Query: 75 LGLIAYVN 82
          + L+ YV 
Sbjct: 79 IALLPYVT 86


>gi|116074877|ref|ZP_01472138.1| 30S ribosomal protein S18 [Synechococcus sp. RS9916]
 gi|116068099|gb|EAU73852.1| 30S ribosomal protein S18 [Synechococcus sp. RS9916]
          Length = 73

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 44/56 (78%), Gaps = 1/56 (1%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G P IDYKD+ LL +F+++RGKI+P R++ ++ K+QR+L  A+KRAR + ++ +VN
Sbjct: 16 GDP-IDYKDVDLLKKFITERGKILPRRLTGLTAKQQRDLTNAVKRARIVAMLPFVN 70


>gi|11467563|ref|NP_043709.1| ribosomal protein S18 [Odontella sinensis]
 gi|1350880|sp|P49505|RR18_ODOSI RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|1185258|emb|CAA91741.1| 30S ribosomal protein S18 [Odontella sinensis]
          Length = 72

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 50/68 (73%), Gaps = 2/68 (2%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          ++ ++K  P+S     +IDYKDI LL  F++++GKI+P R + V+ ++QR++AKAIKRAR
Sbjct: 2  LAQKQKLSPISVNQ--KIDYKDIDLLKLFITEQGKILPRRATGVTVQQQRQIAKAIKRAR 59

Query: 74 YLGLIAYV 81
           L L+ +V
Sbjct: 60 VLSLLPFV 67


>gi|224510719|pdb|3FIH|R Chain R, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
          Consists Of The 30s Subunit, Trnas And The Ternary
          Complex.
 gi|251837152|pdb|3IY8|R Chain R, Leishmania Tarentolae Mitonchondrial Ribosome Small
          Subunit
 gi|294662234|pdb|2WWL|R Chain R, E.Coli 70s Ribosome Stalled During Translation Of Tnac
          Leader Peptide. This File Contains The 30s, The P-Site
          Trna And The Tnac Leader Peptide (Part 1 Of 2).
 gi|308387982|pdb|3OFO|R Chain R, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 30s Subunit Of The
          First 70s Ribosome.
 gi|308388003|pdb|3OFP|R Chain R, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 30s Subunit Of The
          Second 70s Ribosome.
 gi|309320040|pdb|3OFA|R Chain R, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 30s Subunit Of
          The First 70s Ribosome.
 gi|309320061|pdb|3OFB|R Chain R, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 30s Subunit Of
          The Second 70s Ribosome.
 gi|309320144|pdb|3OFX|R Chain R, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 30s Subunit Of The
          First 70s Ribosome.
 gi|309320165|pdb|3OFY|R Chain R, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 30s Subunit Of The
          Second 70s Ribosome
 gi|315113629|pdb|3OAQ|R Chain R, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 30s Subunit Of
          The First 70s Ribosome.
 gi|315113650|pdb|3OAR|R Chain R, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 30s Subunit Of
          The Second 70s Ribosome
          Length = 55

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 39/52 (75%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL L+ Y +
Sbjct: 2  IDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTD 53


>gi|328956357|ref|YP_004373690.1| SSU ribosomal protein S18P [Coriobacterium glomerans PW2]
 gi|328456681|gb|AEB07875.1| SSU ribosomal protein S18P [Coriobacterium glomerans PW2]
          Length = 88

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C    +    IDYKDI+LL ++++ RGKI P R++    + Q ++A AIKRAR + 
Sbjct: 11 RRKYCQFCKENTEHIDYKDIQLLRKYMTDRGKIKPRRVTGTCTQHQHDIANAIKRAREMA 70

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 71 LLPYT 75


>gi|255530652|ref|YP_003091024.1| 30S ribosomal protein S18 [Pedobacter heparinus DSM 2366]
 gi|255343636|gb|ACU02962.1| ribosomal protein S18 [Pedobacter heparinus DSM 2366]
          Length = 87

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (68%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
           +R+K C     G   IDYKD   L +F++ +GKI+P R++  S K QR++A+A+KRAR+
Sbjct: 16 DNRKKYCRFRKNGIKYIDYKDANFLLKFINDQGKILPRRLTGTSLKFQRKVAQAVKRARH 75

Query: 75 LGLIAYV 81
          +GL+ +V
Sbjct: 76 IGLLPFV 82


>gi|169830183|ref|YP_001700341.1| 30S ribosomal protein S18 [Lysinibacillus sphaericus C3-41]
 gi|168994671|gb|ACA42211.1| 30S ribosomal protein S18 [Lysinibacillus sphaericus C3-41]
          Length = 78

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIK +R +GL+ +
Sbjct: 14 CYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTSAIKVSRIMGLLPF 73

Query: 81 V 81
          V
Sbjct: 74 V 74


>gi|291548589|emb|CBL24851.1| SSU ribosomal protein S18P [Ruminococcus torques L2-14]
          Length = 88

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AIKRAR++ 
Sbjct: 22 RKKVCVFCGKENNEIDYKDVAKLKKYVSERGKILPRRITGNCAKHQRALTVAIKRARHIS 81

Query: 77 LIAYVN 82
          L+ YV 
Sbjct: 82 LMPYVQ 87


>gi|291542457|emb|CBL15567.1| SSU ribosomal protein S18P [Ruminococcus bromii L2-63]
          Length = 79

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C         IDYKDI  L R++S+RGKI+P R++    + QREL  AIKRAR+L 
Sbjct: 13 RKKVCGFCVDKVENIDYKDIARLRRYMSERGKILPRRVTGTCARHQRELTVAIKRARHLA 72

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 73 LLPYT 77


>gi|303257677|ref|ZP_07343689.1| ribosomal protein S18 [Burkholderiales bacterium 1_1_47]
 gi|331000769|ref|ZP_08324418.1| ribosomal protein S18 [Parasutterella excrementihominis YIT
          11859]
 gi|302859647|gb|EFL82726.1| ribosomal protein S18 [Burkholderiales bacterium 1_1_47]
 gi|329570501|gb|EGG52226.1| ribosomal protein S18 [Parasutterella excrementihominis YIT
          11859]
          Length = 90

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +     +IDYKDI  L  F+ + GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 23 RKKFCRFTVDHVDQIDYKDIDTLRDFIQENGKIMPARLTGTKAHYQRQLDTAIKRARFLA 82

Query: 77 LIAYVN 82
          L+AY +
Sbjct: 83 LLAYTD 88


>gi|90960999|ref|YP_534915.1| 30S ribosomal protein S18 [Lactobacillus salivarius UCC118]
 gi|227891677|ref|ZP_04009482.1| 30S ribosomal protein S18 [Lactobacillus salivarius ATCC 11741]
 gi|301300480|ref|ZP_07206679.1| ribosomal protein S18 [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|123270037|sp|Q1WVN7|RS18_LACS1 RecName: Full=30S ribosomal protein S18
 gi|90820193|gb|ABD98832.1| SSU ribosomal protein S18P [Lactobacillus salivarius UCC118]
 gi|227866480|gb|EEJ73901.1| 30S ribosomal protein S18 [Lactobacillus salivarius ATCC 11741]
 gi|300851927|gb|EFK79612.1| ribosomal protein S18 [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 78

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 39/51 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD  LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+ +V
Sbjct: 25 IDYKDTDLLRRFISERGKILPRRVTGTSAKNQRKLTVAIKRARIMGLLPFV 75


>gi|328954270|ref|YP_004371604.1| 30S ribosomal protein S18 [Desulfobacca acetoxidans DSM 11109]
 gi|328454594|gb|AEB10423.1| 30S ribosomal protein S18 [Desulfobacca acetoxidans DSM 11109]
          Length = 85

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 44/70 (62%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR + HRRK C         ID+KD+  L  F+++RGKI+P RIS    + QR++  AIK
Sbjct: 9  RRPIFHRRKVCRFCVDSKLVIDHKDVNTLRHFITERGKIIPRRISGNCARHQRKVTLAIK 68

Query: 71 RARYLGLIAY 80
          RAR+L L+ Y
Sbjct: 69 RARHLALMPY 78


>gi|118411014|ref|YP_874409.1| 30S ribosomal protein S18 [Phaeodactylum tricornutum]
 gi|125987696|sp|A0T0D4|RR18_PHATC RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|116739761|gb|ABK20632.1| 30S ribosomal protein S18 [Phaeodactylum tricornutum]
          Length = 72

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 2/68 (2%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          VS ++K  P+S      IDYKDI LL  F++++GKI+P R + V+ ++QR LAKAIKRAR
Sbjct: 2  VSKKQKLSPISLNQ--NIDYKDIDLLTLFVTEQGKILPRRATGVTVQQQRRLAKAIKRAR 59

Query: 74 YLGLIAYV 81
           L L  +V
Sbjct: 60 VLSLFPFV 67


>gi|95930451|ref|ZP_01313187.1| ribosomal protein S18 [Desulfuromonas acetoxidans DSM 684]
 gi|95133491|gb|EAT15154.1| ribosomal protein S18 [Desulfuromonas acetoxidans DSM 684]
          Length = 85

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (66%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C      + +IDYK++R L  F+S+RGKIVP RIS      QR++ +AIKRAR + 
Sbjct: 15 RRKGCRFCADSSLKIDYKEVRTLRYFISERGKIVPRRISGNCATHQRKVTEAIKRARNIA 74

Query: 77 LIAYVN 82
          L+++ +
Sbjct: 75 LLSFTS 80


>gi|126651975|ref|ZP_01724167.1| ribosomal protein S18 [Bacillus sp. B14905]
 gi|299541785|ref|ZP_07052108.1| 30S ribosomal protein S18 [Lysinibacillus fusiformis ZC1]
 gi|126591244|gb|EAZ85353.1| ribosomal protein S18 [Bacillus sp. B14905]
 gi|298725523|gb|EFI66164.1| 30S ribosomal protein S18 [Lysinibacillus fusiformis ZC1]
          Length = 78

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIK +R +GL+ +
Sbjct: 14 CYFTSNNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTSAIKVSRIMGLLPF 73

Query: 81 V 81
          V
Sbjct: 74 V 74


>gi|311742122|ref|ZP_07715932.1| 30S ribosomal protein S18 [Aeromicrobium marinum DSM 15272]
 gi|311314615|gb|EFQ84522.1| 30S ribosomal protein S18 [Aeromicrobium marinum DSM 15272]
          Length = 78

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P++R+    ++KS PL+  G   IDYKD  LL +F+S RGKI   R++ VS ++QR +AK
Sbjct: 4  PVIRK---PKKKSNPLAVAGVTTIDYKDTALLRKFISDRGKIRARRVTGVSVQEQRLIAK 60

Query: 68 AIKRARYLGLIAYVN 82
          AIK AR + L+ Y +
Sbjct: 61 AIKNAREMALLPYTS 75


>gi|149926828|ref|ZP_01915087.1| 30S ribosomal protein S18 [Limnobacter sp. MED105]
 gi|149824380|gb|EDM83598.1| 30S ribosomal protein S18 [Limnobacter sp. MED105]
          Length = 89

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +     +IDYKDI  L  F+S+ GKI+P+RI+      QR+L  AIKRAR+L 
Sbjct: 22 RKKFCRFTVGKVEQIDYKDIDTLKDFISENGKIMPARITGTKANYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LLPYTD 87


>gi|148543252|ref|YP_001270622.1| 30S ribosomal protein S18 [Lactobacillus reuteri DSM 20016]
 gi|184152664|ref|YP_001841005.1| 30S ribosomal protein S18 [Lactobacillus reuteri JCM 1112]
 gi|194467411|ref|ZP_03073398.1| ribosomal protein S18 [Lactobacillus reuteri 100-23]
 gi|227364315|ref|ZP_03848408.1| 30S ribosomal protein S18 [Lactobacillus reuteri MM2-3]
 gi|227543727|ref|ZP_03973776.1| 30S ribosomal protein S18 [Lactobacillus reuteri CF48-3A]
 gi|259502122|ref|ZP_05745024.1| 30S ribosomal protein S18 [Lactobacillus antri DSM 16041]
 gi|300908792|ref|ZP_07126255.1| 30S ribosomal protein S18 [Lactobacillus reuteri SD2112]
 gi|312869248|ref|ZP_07729420.1| ribosomal protein S18 [Lactobacillus oris PB013-T2-3]
 gi|325683514|ref|ZP_08163030.1| 30S ribosomal protein S18 [Lactobacillus reuteri MM4-1A]
 gi|167011191|sp|A5VHG1|RS18_LACRD RecName: Full=30S ribosomal protein S18
 gi|229560043|sp|B2G4Z3|RS18_LACRJ RecName: Full=30S ribosomal protein S18
 gi|148530286|gb|ABQ82285.1| SSU ribosomal protein S18P [Lactobacillus reuteri DSM 20016]
 gi|183224008|dbj|BAG24525.1| 30S ribosomal protein S18 [Lactobacillus reuteri JCM 1112]
 gi|194454447|gb|EDX43344.1| ribosomal protein S18 [Lactobacillus reuteri 100-23]
 gi|227070628|gb|EEI08958.1| 30S ribosomal protein S18 [Lactobacillus reuteri MM2-3]
 gi|227186295|gb|EEI66366.1| 30S ribosomal protein S18 [Lactobacillus reuteri CF48-3A]
 gi|259169935|gb|EEW54430.1| 30S ribosomal protein S18 [Lactobacillus antri DSM 16041]
 gi|300894199|gb|EFK87557.1| 30S ribosomal protein S18 [Lactobacillus reuteri SD2112]
 gi|311095269|gb|EFQ53541.1| ribosomal protein S18 [Lactobacillus oris PB013-T2-3]
 gi|324977864|gb|EGC14815.1| 30S ribosomal protein S18 [Lactobacillus reuteri MM4-1A]
          Length = 78

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 39/51 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD  LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+ +V
Sbjct: 25 IDYKDTDLLRRFISERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLLPFV 75


>gi|310818662|ref|YP_003951020.1| 30S ribosomal protein S18 [Stigmatella aurantiaca DW4/3-1]
 gi|309391734|gb|ADO69193.1| 30S ribosomal protein S18 [Stigmatella aurantiaca DW4/3-1]
          Length = 69

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 49/66 (74%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK  PL       +D+KD++LL  F+++RG+++P R++ V+ ++QR++AKA+KRAR LG
Sbjct: 3  RRKPNPLGN--VRTLDFKDVQLLKYFVTERGRLIPRRLTGVTAQQQRQIAKAVKRARLLG 60

Query: 77 LIAYVN 82
          L+ ++ 
Sbjct: 61 LLPFLQ 66


>gi|189501828|ref|YP_001957545.1| 30S ribosomal protein S18 [Candidatus Amoebophilus asiaticus 5a2]
 gi|189497269|gb|ACE05816.1| hypothetical protein Aasi_0398 [Candidatus Amoebophilus asiaticus
          5a2]
          Length = 83

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 46/65 (70%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K C     G   +DYK++  L RFL+++GKI+P RIS  S K Q+++A+AIKRAR+L 
Sbjct: 14 KKKYCRFKKLGIKYVDYKNLDFLFRFLNEQGKILPRRISGNSLKYQKKVAQAIKRARHLA 73

Query: 77 LIAYV 81
          L+ YV
Sbjct: 74 LLPYV 78


>gi|227529854|ref|ZP_03959903.1| 30S ribosomal protein S18 [Lactobacillus vaginalis ATCC 49540]
 gi|227350223|gb|EEJ40514.1| 30S ribosomal protein S18 [Lactobacillus vaginalis ATCC 49540]
          Length = 78

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 39/51 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD  LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+ +V
Sbjct: 25 IDYKDTDLLRRFISERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLLPFV 75


>gi|224534892|ref|ZP_03675461.1| ribosomal protein S18 [Borrelia spielmanii A14S]
 gi|224513832|gb|EEF84157.1| ribosomal protein S18 [Borrelia spielmanii A14S]
          Length = 96

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 42/65 (64%), Gaps = 1/65 (1%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RKSC     G    DYKD   L +F++++GKI+P RI+  S K QR LA  IKRARY+ 
Sbjct: 31 KRKSCKFCDSGK-HPDYKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRARYMA 89

Query: 77 LIAYV 81
          L+ +V
Sbjct: 90 LLPFV 94


>gi|257871397|ref|ZP_05651050.1| ribosomal protein S18 [Enterococcus gallinarum EG2]
 gi|257805561|gb|EEV34383.1| ribosomal protein S18 [Enterococcus gallinarum EG2]
          Length = 78

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/52 (55%), Positives = 38/52 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD  LL RF+S+RGKI+P R++    K QR+L  AIKRAR +GL+ +V 
Sbjct: 25 IDYKDTELLKRFISERGKILPRRVTGTGAKNQRKLTVAIKRARIMGLLPFVG 76


>gi|260072537|gb|ACX30437.1| ribosomal protein S18 [uncultured SUP05 cluster bacterium]
 gi|269468495|gb|EEZ80153.1| ribosomal protein S18 [uncultured SUP05 cluster bacterium]
          Length = 84

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (64%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ +L + + + GKI PSR++  + K QR+L  AIKRAR+L LI Y
Sbjct: 19 CRFTAAGVKEIDYKDVDVLLKNIDESGKITPSRMTGTTAKFQRQLTTAIKRARFLALIPY 78

Query: 81 VN 82
           +
Sbjct: 79 TD 80


>gi|15594459|ref|NP_212247.1| 30S ribosomal protein S18 [Borrelia burgdorferi B31]
 gi|216264194|ref|ZP_03436186.1| ribosomal protein S18 [Borrelia burgdorferi 156a]
 gi|218249765|ref|YP_002374641.1| ribosomal protein S18 [Borrelia burgdorferi ZS7]
 gi|221217474|ref|ZP_03588945.1| ribosomal protein S18 [Borrelia burgdorferi 72a]
 gi|224532934|ref|ZP_03673544.1| ribosomal protein S18 [Borrelia burgdorferi WI91-23]
 gi|225549865|ref|ZP_03770827.1| ribosomal protein S18 [Borrelia burgdorferi 118a]
 gi|225552003|ref|ZP_03772943.1| ribosomal protein S18 [Borrelia sp. SV1]
 gi|226320695|ref|ZP_03796253.1| ribosomal protein S18 [Borrelia burgdorferi 29805]
 gi|226321976|ref|ZP_03797501.1| ribosomal protein S18 [Borrelia burgdorferi Bol26]
 gi|6226082|sp|O51140|RS18_BORBU RecName: Full=30S ribosomal protein S18
 gi|226735111|sp|B7J146|RS18_BORBZ RecName: Full=30S ribosomal protein S18
 gi|2687990|gb|AAC66493.1| ribosomal protein S18 (rpsR) [Borrelia burgdorferi B31]
 gi|215980667|gb|EEC21474.1| ribosomal protein S18 [Borrelia burgdorferi 156a]
 gi|218164953|gb|ACK75014.1| ribosomal protein S18 [Borrelia burgdorferi ZS7]
 gi|221192752|gb|EEE18968.1| ribosomal protein S18 [Borrelia burgdorferi 72a]
 gi|224512133|gb|EEF82524.1| ribosomal protein S18 [Borrelia burgdorferi WI91-23]
 gi|225369556|gb|EEG99007.1| ribosomal protein S18 [Borrelia burgdorferi 118a]
 gi|225371001|gb|EEH00431.1| ribosomal protein S18 [Borrelia sp. SV1]
 gi|226232566|gb|EEH31320.1| ribosomal protein S18 [Borrelia burgdorferi Bol26]
 gi|226233911|gb|EEH32634.1| ribosomal protein S18 [Borrelia burgdorferi 29805]
 gi|312149769|gb|ADQ29840.1| ribosomal protein S18 [Borrelia burgdorferi N40]
          Length = 96

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 42/65 (64%), Gaps = 1/65 (1%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RKSC     G    DYKD   L +F++++GKI+P RI+  S K QR LA  IKRARY+ 
Sbjct: 31 KRKSCKFCDSGK-HPDYKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRARYMA 89

Query: 77 LIAYV 81
          L+ +V
Sbjct: 90 LLPFV 94


>gi|302543826|ref|ZP_07296168.1| ribosomal protein S18 [Streptomyces hygroscopicus ATCC 53653]
 gi|302461444|gb|EFL24537.1| ribosomal protein S18 [Streptomyces himastatinicus ATCC 53653]
          Length = 80

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 44/64 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR++ PL   G   +DYKD  LL +F+S RGKI   R++ V+ ++QR++A+AIK AR + 
Sbjct: 14 RRRANPLDAAGITYVDYKDTDLLRKFISDRGKIRSRRVTHVTRRQQRQIARAIKNAREMA 73

Query: 77 LIAY 80
          LI Y
Sbjct: 74 LIPY 77


>gi|289523469|ref|ZP_06440323.1| ribosomal protein S18 [Anaerobaculum hydrogeniformans ATCC
          BAA-1850]
 gi|289503161|gb|EFD24325.1| ribosomal protein S18 [Anaerobaculum hydrogeniformans ATCC
          BAA-1850]
          Length = 76

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R K C         +DYK++  L RFL++RGKI+P R++    K QR+LA+AIKRAR++ 
Sbjct: 10 RPKVCTFCSNKIEYVDYKNVEQLKRFLTERGKILPHRVTGNCAKHQRQLARAIKRARFMA 69

Query: 77 LIAYV 81
          L+ + 
Sbjct: 70 LLPFT 74


>gi|124009489|ref|ZP_01694165.1| ribosomal protein S18 [Microscilla marina ATCC 23134]
 gi|123984938|gb|EAY24901.1| ribosomal protein S18 [Microscilla marina ATCC 23134]
          Length = 83

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 45/67 (67%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
           +R+K C     G   IDYKD   L +F++ +GKI+P RI+  S K QR++++A+KRAR+
Sbjct: 12 ENRKKYCRFKKNGIKYIDYKDPNFLLKFVNDQGKILPRRITGTSLKYQRKVSQAVKRARH 71

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 72 LALLPYV 78


>gi|219684867|ref|ZP_03539809.1| ribosomal protein S18 [Borrelia garinii PBr]
 gi|219685376|ref|ZP_03540195.1| ribosomal protein S18 [Borrelia garinii Far04]
 gi|224532127|ref|ZP_03672759.1| ribosomal protein S18 [Borrelia valaisiana VS116]
 gi|219671812|gb|EED28867.1| ribosomal protein S18 [Borrelia garinii PBr]
 gi|219673149|gb|EED30169.1| ribosomal protein S18 [Borrelia garinii Far04]
 gi|224511592|gb|EEF81998.1| ribosomal protein S18 [Borrelia valaisiana VS116]
          Length = 96

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 42/65 (64%), Gaps = 1/65 (1%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RKSC     G    DYKD   L +F++++GKI+P RI+  S K QR LA  IKRARY+ 
Sbjct: 31 KRKSCKFCDSGK-HPDYKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRARYMA 89

Query: 77 LIAYV 81
          L+ +V
Sbjct: 90 LLPFV 94


>gi|299143652|ref|ZP_07036732.1| ribosomal protein S18 [Peptoniphilus sp. oral taxon 386 str.
          F0131]
 gi|298518137|gb|EFI41876.1| ribosomal protein S18 [Peptoniphilus sp. oral taxon 386 str.
          F0131]
          Length = 74

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++R    R+K  P       +IDYKDI LL  ++S+RGKI+P RI+ +S K QR +  AI
Sbjct: 1  MQRRFRPRKKVDPFEKDKTKKIDYKDIALLRNYISERGKILPRRITGLSAKHQRAITTAI 60

Query: 70 KRARYLGLIAY 80
          KRAR + L+ Y
Sbjct: 61 KRARQVALLPY 71


>gi|170077198|ref|YP_001733836.1| 30S ribosomal protein S18 [Synechococcus sp. PCC 7002]
 gi|169884867|gb|ACA98580.1| ribosomal protein S18 [Synechococcus sp. PCC 7002]
          Length = 71

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 42/52 (80%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD+ LL +F+++RGKI+P RI+ ++ ++QR++  AIKRAR L L+ ++N
Sbjct: 17 IDYKDVELLRKFITERGKILPRRITGLTARQQRDVNTAIKRARMLALLPFIN 68


>gi|118411132|ref|YP_874526.1| 30S ribosomal protein S18 [Thalassiosira pseudonana]
 gi|224015780|ref|XP_002297538.1| RR18, ribosomal protein 18 30S small ribosomal subunit,
          chloroplast, translation, protein biosynthesis
          [Thalassiosira pseudonana CCMP1335]
 gi|125987698|sp|A0T0R4|RR18_THAPS RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|116739879|gb|ABK20749.1| 30S ribosomal protein S18 [Thalassiosira pseudonana]
 gi|220967802|gb|EED86178.1| RR18, ribosomal protein 18 30S small ribosomal subunit,
          chloroplast, translation, protein biosynthesis
          [Thalassiosira pseudonana CCMP1335]
          Length = 72

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 49/68 (72%), Gaps = 2/68 (2%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          ++ ++K  P+      +IDYKDI LL  F++++GKI+P R + V+ ++QR+LAKAIKRAR
Sbjct: 2  LAQKQKLAPIGIN--QKIDYKDIDLLKLFITEQGKILPRRATGVTVQQQRQLAKAIKRAR 59

Query: 74 YLGLIAYV 81
           L L+ +V
Sbjct: 60 ILSLLPFV 67


>gi|313888625|ref|ZP_07822290.1| ribosomal protein S18 [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845354|gb|EFR32750.1| ribosomal protein S18 [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 74

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++R    R+K  P       +IDYKD+  L  ++S RGKI+P RI+ ++ K QRE+  AI
Sbjct: 1  MQRRFGRRKKVDPFEKDKTKKIDYKDVETLRNYISDRGKILPRRITGLNAKHQREMTVAI 60

Query: 70 KRARYLGLIAY 80
          KRAR + L+ Y
Sbjct: 61 KRARQIALLPY 71


>gi|16331711|ref|NP_442439.1| 30S ribosomal protein S18 [Synechocystis sp. PCC 6803]
 gi|1350950|sp|P48946|RS18_SYNY3 RecName: Full=30S ribosomal protein S18
 gi|1001265|dbj|BAA10509.1| 30S ribosomal protein S18 [Synechocystis sp. PCC 6803]
          Length = 71

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 47/67 (70%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R++  PL       IDYKD  LL +F+++RGKI+P RI+ ++ K+QR+L  A+KR+R +
Sbjct: 4  YRKRLSPLPPNQP--IDYKDTELLRKFITERGKILPRRITGLTAKQQRDLTTAVKRSRLV 61

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 62 ALLPFVN 68


>gi|312889160|ref|ZP_07748717.1| SSU ribosomal protein S18P [Mucilaginibacter paludis DSM 18603]
 gi|311298322|gb|EFQ75434.1| SSU ribosomal protein S18P [Mucilaginibacter paludis DSM 18603]
          Length = 87

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 46/68 (67%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
           +R+K C     G   IDYKD   L +F++ +GK++P R++  S K QR++A+A+KR+R+
Sbjct: 16 DNRKKYCRFKKNGIKYIDYKDANFLLKFINDQGKLLPRRLTGTSLKFQRKVAQAVKRSRH 75

Query: 75 LGLIAYVN 82
          +GL+ YV 
Sbjct: 76 IGLLPYVT 83


>gi|227486388|ref|ZP_03916704.1| possible ribosomal protein S18 [Anaerococcus lactolyticus ATCC
          51172]
 gi|227235569|gb|EEI85584.1| possible ribosomal protein S18 [Anaerococcus lactolyticus ATCC
          51172]
          Length = 74

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 44/69 (63%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    R+K  P     +  IDYKDI  L RF++ RGKI+P R++ ++ K QRE+ +AIKR
Sbjct: 3  RRFKPRKKVDPFVKDPSKVIDYKDIETLKRFVTDRGKILPRRVTGLNAKHQREITRAIKR 62

Query: 72 ARYLGLIAY 80
          AR + L+ Y
Sbjct: 63 ARQVALLPY 71


>gi|152997467|ref|YP_001342302.1| 30S ribosomal protein S18 [Marinomonas sp. MWYL1]
 gi|189029680|sp|A6W0Y8|RS18_MARMS RecName: Full=30S ribosomal protein S18
 gi|150838391|gb|ABR72367.1| ribosomal protein S18 [Marinomonas sp. MWYL1]
          Length = 76

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRARY+ ++ Y +
Sbjct: 14 TAEGVKEIDYKDLDTLKGYITETGKIVPSRITGTKARYQRQLATAIKRARYIAILPYTD 72


>gi|315640348|ref|ZP_07895464.1| 30S ribosomal protein S18 [Enterococcus italicus DSM 15952]
 gi|315483884|gb|EFU74364.1| 30S ribosomal protein S18 [Enterococcus italicus DSM 15952]
          Length = 78

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (66%)

Query: 23 LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          L+      +DYKDI LL RF+S+RGKI+P R++    K QR+L  AIKRAR +GL+ +  
Sbjct: 17 LAANHIEHVDYKDIELLKRFISERGKILPRRVTGTGAKNQRKLTIAIKRARIMGLLPFAT 76


>gi|153803832|ref|ZP_01958418.1| ribosomal protein S18 [Vibrio cholerae MZO-3]
 gi|124120630|gb|EAY39373.1| ribosomal protein S18 [Vibrio cholerae MZO-3]
          Length = 64

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 38/51 (74%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + +G   IDYKD+  L  ++++ GKIVPSRI+  S K QR+LA+AIKRARY
Sbjct: 14 TAEGVQEIDYKDVATLKNYITEAGKIVPSRITGTSAKYQRQLARAIKRARY 64


>gi|58584758|ref|YP_198331.1| 30S ribosomal protein S18 [Wolbachia endosymbiont strain TRS of
          Brugia malayi]
 gi|75507965|sp|Q5GSD5|RS18_WOLTR RecName: Full=30S ribosomal protein S18
 gi|58419074|gb|AAW71089.1| Ribosomal protein S18 [Wolbachia endosymbiont strain TRS of
          Brugia malayi]
          Length = 91

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R K CPL+      IDYK+  LL+RF S  G+I+P R++ V  KKQR+L  AI RAR+L 
Sbjct: 23 RSKVCPLATSQDEDIDYKNTDLLSRFTSDYGRILPRRLTGVCAKKQRKLRLAIIRARFLA 82

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 83 LVPYC 87


>gi|311070629|ref|YP_003975552.1| 30S ribosomal protein S18 [Bacillus atrophaeus 1942]
 gi|310871146|gb|ADP34621.1| 30S ribosomal protein S18 [Bacillus atrophaeus 1942]
          Length = 79

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIK +R + L+ Y
Sbjct: 16 CYFTSNGITHIDYKDVDLLRKFVSERGKILPRRVTGTNAKYQRKLTAAIKLSRQMALLPY 75

Query: 81 VN 82
          V 
Sbjct: 76 VT 77


>gi|325261132|ref|ZP_08127870.1| ribosomal protein S18 [Clostridium sp. D5]
 gi|324032586|gb|EGB93863.1| ribosomal protein S18 [Clostridium sp. D5]
          Length = 88

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AIKRAR++ 
Sbjct: 22 RKKVCVFCGKENNDIDYKDVVKLKKYISERGKILPRRITGNCAKHQRALTVAIKRARHIA 81

Query: 77 LIAYVN 82
          L+ YV 
Sbjct: 82 LMPYVQ 87


>gi|194246576|ref|YP_002004215.1| 30S ribosomal protein S18 [Candidatus Phytoplasma mali]
 gi|193806933|emb|CAP18365.1| SSU ribosomal protein S18P [Candidatus Phytoplasma mali]
          Length = 78

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 42/61 (68%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +     +ID+KDI LL +F++++GKI+P RI+  S   QR LA AIKRAR++ L+ +
Sbjct: 16 CYFTDNKITKIDFKDIELLKKFITEQGKIIPKRITGTSAIWQRRLAIAIKRARHMALLPF 75

Query: 81 V 81
          +
Sbjct: 76 I 76


>gi|210634873|ref|ZP_03298348.1| hypothetical protein COLSTE_02277 [Collinsella stercoris DSM
          13279]
 gi|210158588|gb|EEA89559.1| hypothetical protein COLSTE_02277 [Collinsella stercoris DSM
          13279]
          Length = 88

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C    +G   IDYKD +LL ++++ RGKI P R++    + Q ++A AIKRAR + 
Sbjct: 11 RRKYCQFCKEGTEYIDYKDTQLLRKYMTDRGKIKPRRVTGACTQHQHDIANAIKRAREMA 70

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 71 LLPYA 75


>gi|73539550|ref|YP_299917.1| 30S ribosomal protein S18 [Ralstonia eutropha JMP134]
 gi|123773854|sp|Q46P61|RS182_RALEJ RecName: Full=30S ribosomal protein S18 2
 gi|72122887|gb|AAZ65073.1| SSU ribosomal protein S18P [Ralstonia eutropha JMP134]
          Length = 92

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G  +IDYKD+  L  F+   GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 23 RKRYCRFTVAGVEQIDYKDLDTLKDFIGDNGKITPARLTGTKAHYQRQLNTAIKRARFLA 82

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 83 LLPYTDL 89


>gi|54310417|ref|YP_131437.1| putative ribosomal protein S18 [Photobacterium profundum SS9]
 gi|90414462|ref|ZP_01222438.1| putative ribosomal protein S18 [Photobacterium profundum 3TCK]
 gi|59798724|sp|Q6LM43|RS18_PHOPR RecName: Full=30S ribosomal protein S18
 gi|46914858|emb|CAG21635.1| putative ribosomal protein S18 [Photobacterium profundum SS9]
 gi|90324467|gb|EAS41026.1| putative ribosomal protein S18 [Photobacterium profundum 3TCK]
          Length = 75

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +    IDYKD+  L  ++++ GKIVPSRI+    K QR+LA+AIKR+RYL L+ Y +
Sbjct: 14 TAEDVQEIDYKDVVTLKNYITEAGKIVPSRITGTRAKYQRQLARAIKRSRYLALLPYTD 72


>gi|210613749|ref|ZP_03289863.1| hypothetical protein CLONEX_02070 [Clostridium nexile DSM 1787]
 gi|210150958|gb|EEA81966.1| hypothetical protein CLONEX_02070 [Clostridium nexile DSM 1787]
          Length = 87

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 49/77 (63%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          A +P+ RR    R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR 
Sbjct: 9  ADSPMKRRGGRRRKKVCVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQRA 68

Query: 65 LAKAIKRARYLGLIAYV 81
          L  AIKRAR++ L+ YV
Sbjct: 69 LTVAIKRARHIALMPYV 85


>gi|83749657|ref|ZP_00946638.1| SSU ribosomal protein S18P [Ralstonia solanacearum UW551]
 gi|207723263|ref|YP_002253662.1| 30s ribosomal protein s18 [Ralstonia solanacearum MolK2]
 gi|207743342|ref|YP_002259734.1| 30s ribosomal protein s18 [Ralstonia solanacearum IPO1609]
 gi|83723659|gb|EAP70856.1| SSU ribosomal protein S18P [Ralstonia solanacearum UW551]
 gi|206588461|emb|CAQ35424.1| 30s ribosomal protein s18 [Ralstonia solanacearum MolK2]
 gi|206594739|emb|CAQ61666.1| 30s ribosomal protein s18 [Ralstonia solanacearum IPO1609]
          Length = 95

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G  +IDYKD+  L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 26 RKKFCRFTVAGVEQIDYKDLDTLKDFIGENGKITPARLTGTRSHYQRQLDTAIKRARFLA 85

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 86 LMPYTD 91


>gi|325662894|ref|ZP_08151463.1| 30S ribosomal protein S18 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|331086618|ref|ZP_08335696.1| 30S ribosomal protein S18 [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|325470946|gb|EGC74175.1| 30S ribosomal protein S18 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|330410451|gb|EGG89883.1| 30S ribosomal protein S18 [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 87

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 49/77 (63%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          A +P+ RR    R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR 
Sbjct: 9  ADSPMKRRGGRRRKKVCVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQRA 68

Query: 65 LAKAIKRARYLGLIAYV 81
          L  AIKRAR++ L+ YV
Sbjct: 69 LTVAIKRARHIALMPYV 85


>gi|260584271|ref|ZP_05852018.1| 30S ribosomal protein S18 [Granulicatella elegans ATCC 700633]
 gi|260157789|gb|EEW92858.1| 30S ribosomal protein S18 [Granulicatella elegans ATCC 700633]
          Length = 80

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +      IDYKD+ LL R++S++GKI+P R++    K QR L  AIKRAR +GL
Sbjct: 14 KKVCYFTANHITYIDYKDVELLKRYISEKGKILPRRVTGTCAKYQRLLTVAIKRARIMGL 73

Query: 78 IAYVNL 83
          + +  +
Sbjct: 74 LPFTTV 79


>gi|213962614|ref|ZP_03390875.1| ribosomal protein S18 [Capnocytophaga sputigena Capno]
 gi|256820494|ref|YP_003141773.1| 30S ribosomal protein S18 [Capnocytophaga ochracea DSM 7271]
 gi|315223595|ref|ZP_07865450.1| 30S ribosomal protein S18 [Capnocytophaga ochracea F0287]
 gi|213954609|gb|EEB65930.1| ribosomal protein S18 [Capnocytophaga sputigena Capno]
 gi|256582077|gb|ACU93212.1| ribosomal protein S18 [Capnocytophaga ochracea DSM 7271]
 gi|314946511|gb|EFS98505.1| 30S ribosomal protein S18 [Capnocytophaga ochracea F0287]
          Length = 92

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL   + S ++K C     G   IDYKD   L +F++++GK++P R++  S K QR++A
Sbjct: 14 TPL-NIDTSKQKKYCRFKKSGIKYIDYKDADFLLKFVNEQGKLLPRRLTGTSLKFQRKVA 72

Query: 67 KAIKRARYLGLIAYV 81
           A+KRAR+L L+ YV
Sbjct: 73 TAVKRARHLALMPYV 87


>gi|237748617|ref|ZP_04579097.1| 30S ribosomal protein S18 [Oxalobacter formigenes OXCC13]
 gi|229379979|gb|EEO30070.1| 30S ribosomal protein S18 [Oxalobacter formigenes OXCC13]
          Length = 94

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 42/67 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G  +IDYKDI  L  F+ +  KI+P+R++      QR++  AIKRAR+L 
Sbjct: 25 RKKFCRFTAAGVEQIDYKDIDTLKDFIQENCKIMPARLTGTKAHYQRQVDTAIKRARFLA 84

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 85 LLPYTSL 91


>gi|89094156|ref|ZP_01167099.1| 30S ribosomal protein S18 [Oceanospirillum sp. MED92]
 gi|89081631|gb|EAR60860.1| 30S ribosomal protein S18 [Oceanospirillum sp. MED92]
          Length = 75

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRAR++ L+ Y +
Sbjct: 14 TAEGVQEIDYKDLDTLKGYITETGKIVPSRITGTKARYQRQLATAIKRARFVALLPYTD 72


>gi|258647410|ref|ZP_05734879.1| ribosomal protein S18 [Prevotella tannerae ATCC 51259]
 gi|260852778|gb|EEX72647.1| ribosomal protein S18 [Prevotella tannerae ATCC 51259]
          Length = 88

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C     G   IDYKD   L +FL+++GKI+P R++  S K QR +A+A+KRAR L 
Sbjct: 19 RKKYCRFKKSGIKYIDYKDPEFLKKFLNEQGKILPRRLTGTSLKYQRRVAQAVKRARQLA 78

Query: 77 LIAYVN 82
          L+ +V 
Sbjct: 79 LLPFVT 84


>gi|184154485|ref|YP_001842825.1| 30S ribosomal protein S18 [Lactobacillus fermentum IFO 3956]
 gi|227514127|ref|ZP_03944176.1| ribosomal protein S18 [Lactobacillus fermentum ATCC 14931]
 gi|256848498|ref|ZP_05553940.1| ribosomal protein S18 [Lactobacillus coleohominis 101-4-CHN]
 gi|260662546|ref|ZP_05863441.1| 30S ribosomal protein S18 [Lactobacillus fermentum 28-3-CHN]
 gi|229560042|sp|B2GEV6|RS18_LACF3 RecName: Full=30S ribosomal protein S18
 gi|183225829|dbj|BAG26345.1| 30S ribosomal protein S18 [Lactobacillus fermentum IFO 3956]
 gi|227087498|gb|EEI22810.1| ribosomal protein S18 [Lactobacillus fermentum ATCC 14931]
 gi|256714765|gb|EEU29744.1| ribosomal protein S18 [Lactobacillus coleohominis 101-4-CHN]
 gi|260553237|gb|EEX26180.1| 30S ribosomal protein S18 [Lactobacillus fermentum 28-3-CHN]
          Length = 78

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR +GL+ +V
Sbjct: 25 IDYKDTDLLRRFISERGKILPRRVTGTSAKNQRRLTIAIKRARIMGLLPFV 75


>gi|149279559|ref|ZP_01885688.1| 30S ribosomal protein S18 [Pedobacter sp. BAL39]
 gi|149229595|gb|EDM34985.1| 30S ribosomal protein S18 [Pedobacter sp. BAL39]
          Length = 87

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 46/67 (68%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
           +R+K C     G   IDYKD   L +F++ +GKI+P R++  S K QR++A+A+KR+R+
Sbjct: 16 DNRKKYCRFKKNGIKYIDYKDANFLLKFINDQGKILPRRLTGTSLKFQRKVAQAVKRSRH 75

Query: 75 LGLIAYV 81
          +GL+ +V
Sbjct: 76 IGLLPFV 82


>gi|194289921|ref|YP_002005828.1| 30S ribosomal protein s18 [Cupriavidus taiwanensis LMG 19424]
 gi|229559981|sp|B3R2P5|RS18_CUPTR RecName: Full=30S ribosomal protein S18
 gi|193223756|emb|CAQ69763.1| 30S ribosomal protein S18 [Cupriavidus taiwanensis LMG 19424]
          Length = 92

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G  +IDYKD+  L  F+   GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 23 RKRFCRFTVAGVEQIDYKDLDTLKDFIGDNGKITPARLTGTKAHYQRQLDTAIKRARFLA 82

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 83 LLPYTDL 89


>gi|256618519|ref|ZP_05475365.1| ribosomal protein S18 [Enterococcus faecalis ATCC 4200]
 gi|256598046|gb|EEU17222.1| ribosomal protein S18 [Enterococcus faecalis ATCC 4200]
          Length = 79

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/52 (55%), Positives = 39/52 (75%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD  LL RF+S+RGKI+P R++    K QR+L  AIKRAR +GL+ +V+
Sbjct: 25 IDYKDTELLKRFISERGKILPRRVTGTGAKNQRKLTIAIKRARIMGLLPFVS 76


>gi|29374670|ref|NP_813822.1| 30S ribosomal protein S18 [Enterococcus faecalis V583]
 gi|227518100|ref|ZP_03948149.1| 30S ribosomal protein S18 [Enterococcus faecalis TX0104]
 gi|227555693|ref|ZP_03985740.1| 30S ribosomal protein S18 [Enterococcus faecalis HH22]
 gi|229547121|ref|ZP_04435846.1| 30S ribosomal protein S18 [Enterococcus faecalis TX1322]
 gi|229550691|ref|ZP_04439416.1| 30S ribosomal protein S18 [Enterococcus faecalis ATCC 29200]
 gi|255971557|ref|ZP_05422143.1| ribosomal protein S18 [Enterococcus faecalis T1]
 gi|255974530|ref|ZP_05425116.1| ribosomal protein S18 [Enterococcus faecalis T2]
 gi|256761862|ref|ZP_05502442.1| ribosomal protein S18 [Enterococcus faecalis T3]
 gi|256854989|ref|ZP_05560350.1| ribosomal protein S18 [Enterococcus faecalis T8]
 gi|256957007|ref|ZP_05561178.1| ribosomal protein S18 [Enterococcus faecalis DS5]
 gi|256960816|ref|ZP_05564987.1| 30S ribosomal protein S18 [Enterococcus faecalis Merz96]
 gi|256963991|ref|ZP_05568162.1| 30S ribosomal protein S18 [Enterococcus faecalis HIP11704]
 gi|257078684|ref|ZP_05573045.1| 30S ribosomal protein S18 [Enterococcus faecalis JH1]
 gi|257081355|ref|ZP_05575716.1| 30S ribosomal protein S18 [Enterococcus faecalis E1Sol]
 gi|257084012|ref|ZP_05578373.1| 30S ribosomal protein S18 [Enterococcus faecalis Fly1]
 gi|257087842|ref|ZP_05582203.1| ribosomal protein S18 [Enterococcus faecalis D6]
 gi|257088494|ref|ZP_05582855.1| 30S ribosomal protein S18 [Enterococcus faecalis CH188]
 gi|257417434|ref|ZP_05594428.1| ribosomal protein S18 [Enterococcus faecalis AR01/DG]
 gi|257418834|ref|ZP_05595828.1| 30S ribosomal protein S18 [Enterococcus faecalis T11]
 gi|257421351|ref|ZP_05598341.1| 30S ribosomal protein S18 [Enterococcus faecalis X98]
 gi|293382654|ref|ZP_06628582.1| ribosomal protein S18 [Enterococcus faecalis R712]
 gi|293387934|ref|ZP_06632470.1| ribosomal protein S18 [Enterococcus faecalis S613]
 gi|294780772|ref|ZP_06746130.1| ribosomal protein S18 [Enterococcus faecalis PC1.1]
 gi|300861749|ref|ZP_07107829.1| ribosomal protein S18 [Enterococcus faecalis TUSoD Ef11]
 gi|307268925|ref|ZP_07550289.1| ribosomal protein S18 [Enterococcus faecalis TX4248]
 gi|307274020|ref|ZP_07555230.1| ribosomal protein S18 [Enterococcus faecalis TX0855]
 gi|307276491|ref|ZP_07557611.1| ribosomal protein S18 [Enterococcus faecalis TX2134]
 gi|307284067|ref|ZP_07564237.1| ribosomal protein S18 [Enterococcus faecalis TX0860]
 gi|307287173|ref|ZP_07567244.1| ribosomal protein S18 [Enterococcus faecalis TX0109]
 gi|307296598|ref|ZP_07576418.1| ribosomal protein S18 [Enterococcus faecalis TX0411]
 gi|312901288|ref|ZP_07760571.1| ribosomal protein S18 [Enterococcus faecalis TX0470]
 gi|312903115|ref|ZP_07762296.1| ribosomal protein S18 [Enterococcus faecalis TX0635]
 gi|312908806|ref|ZP_07767745.1| ribosomal protein S18 [Enterococcus faecalis DAPTO 512]
 gi|312951712|ref|ZP_07770606.1| ribosomal protein S18 [Enterococcus faecalis TX0102]
 gi|312979552|ref|ZP_07791234.1| ribosomal protein S18 [Enterococcus faecalis DAPTO 516]
 gi|59798885|sp|Q839Y8|RS18_ENTFA RecName: Full=30S ribosomal protein S18
 gi|29342128|gb|AAO79894.1| ribosomal protein S18 [Enterococcus faecalis V583]
 gi|227074448|gb|EEI12411.1| 30S ribosomal protein S18 [Enterococcus faecalis TX0104]
 gi|227175151|gb|EEI56123.1| 30S ribosomal protein S18 [Enterococcus faecalis HH22]
 gi|229304192|gb|EEN70188.1| 30S ribosomal protein S18 [Enterococcus faecalis ATCC 29200]
 gi|229307777|gb|EEN73764.1| 30S ribosomal protein S18 [Enterococcus faecalis TX1322]
 gi|255962575|gb|EET95051.1| ribosomal protein S18 [Enterococcus faecalis T1]
 gi|255967402|gb|EET98024.1| ribosomal protein S18 [Enterococcus faecalis T2]
 gi|256683113|gb|EEU22808.1| ribosomal protein S18 [Enterococcus faecalis T3]
 gi|256709502|gb|EEU24549.1| ribosomal protein S18 [Enterococcus faecalis T8]
 gi|256947503|gb|EEU64135.1| ribosomal protein S18 [Enterococcus faecalis DS5]
 gi|256951312|gb|EEU67944.1| 30S ribosomal protein S18 [Enterococcus faecalis Merz96]
 gi|256954487|gb|EEU71119.1| 30S ribosomal protein S18 [Enterococcus faecalis HIP11704]
 gi|256986714|gb|EEU74016.1| 30S ribosomal protein S18 [Enterococcus faecalis JH1]
 gi|256989385|gb|EEU76687.1| 30S ribosomal protein S18 [Enterococcus faecalis E1Sol]
 gi|256992042|gb|EEU79344.1| 30S ribosomal protein S18 [Enterococcus faecalis Fly1]
 gi|256995872|gb|EEU83174.1| ribosomal protein S18 [Enterococcus faecalis D6]
 gi|256997306|gb|EEU83826.1| 30S ribosomal protein S18 [Enterococcus faecalis CH188]
 gi|257159262|gb|EEU89222.1| ribosomal protein S18 [Enterococcus faecalis ARO1/DG]
 gi|257160662|gb|EEU90622.1| 30S ribosomal protein S18 [Enterococcus faecalis T11]
 gi|257163175|gb|EEU93135.1| 30S ribosomal protein S18 [Enterococcus faecalis X98]
 gi|291079960|gb|EFE17324.1| ribosomal protein S18 [Enterococcus faecalis R712]
 gi|291082671|gb|EFE19634.1| ribosomal protein S18 [Enterococcus faecalis S613]
 gi|294452134|gb|EFG20578.1| ribosomal protein S18 [Enterococcus faecalis PC1.1]
 gi|295112348|emb|CBL30985.1| SSU ribosomal protein S18P [Enterococcus sp. 7L76]
 gi|300848274|gb|EFK76031.1| ribosomal protein S18 [Enterococcus faecalis TUSoD Ef11]
 gi|306495934|gb|EFM65522.1| ribosomal protein S18 [Enterococcus faecalis TX0411]
 gi|306501771|gb|EFM71062.1| ribosomal protein S18 [Enterococcus faecalis TX0109]
 gi|306503438|gb|EFM72687.1| ribosomal protein S18 [Enterococcus faecalis TX0860]
 gi|306506818|gb|EFM75968.1| ribosomal protein S18 [Enterococcus faecalis TX2134]
 gi|306509328|gb|EFM78388.1| ribosomal protein S18 [Enterococcus faecalis TX0855]
 gi|306514733|gb|EFM83284.1| ribosomal protein S18 [Enterococcus faecalis TX4248]
 gi|310625244|gb|EFQ08527.1| ribosomal protein S18 [Enterococcus faecalis DAPTO 512]
 gi|310630285|gb|EFQ13568.1| ribosomal protein S18 [Enterococcus faecalis TX0102]
 gi|310633506|gb|EFQ16789.1| ribosomal protein S18 [Enterococcus faecalis TX0635]
 gi|311287734|gb|EFQ66290.1| ribosomal protein S18 [Enterococcus faecalis DAPTO 516]
 gi|311291665|gb|EFQ70221.1| ribosomal protein S18 [Enterococcus faecalis TX0470]
 gi|315026669|gb|EFT38601.1| ribosomal protein S18 [Enterococcus faecalis TX2137]
 gi|315030114|gb|EFT42046.1| ribosomal protein S18 [Enterococcus faecalis TX4000]
 gi|315033548|gb|EFT45480.1| ribosomal protein S18 [Enterococcus faecalis TX0017]
 gi|315036371|gb|EFT48303.1| ribosomal protein S18 [Enterococcus faecalis TX0027]
 gi|315143587|gb|EFT87603.1| ribosomal protein S18 [Enterococcus faecalis TX2141]
 gi|315148275|gb|EFT92291.1| ribosomal protein S18 [Enterococcus faecalis TX4244]
 gi|315151299|gb|EFT95315.1| ribosomal protein S18 [Enterococcus faecalis TX0012]
 gi|315153725|gb|EFT97741.1| ribosomal protein S18 [Enterococcus faecalis TX0031]
 gi|315155115|gb|EFT99131.1| ribosomal protein S18 [Enterococcus faecalis TX0043]
 gi|315158755|gb|EFU02772.1| ribosomal protein S18 [Enterococcus faecalis TX0312]
 gi|315163339|gb|EFU07356.1| ribosomal protein S18 [Enterococcus faecalis TX0645]
 gi|315165719|gb|EFU09736.1| ribosomal protein S18 [Enterococcus faecalis TX1302]
 gi|315168228|gb|EFU12245.1| ribosomal protein S18 [Enterococcus faecalis TX1341]
 gi|315170504|gb|EFU14521.1| ribosomal protein S18 [Enterococcus faecalis TX1342]
 gi|315174174|gb|EFU18191.1| ribosomal protein S18 [Enterococcus faecalis TX1346]
 gi|315573983|gb|EFU86174.1| ribosomal protein S18 [Enterococcus faecalis TX0309B]
 gi|315578847|gb|EFU91038.1| ribosomal protein S18 [Enterococcus faecalis TX0630]
 gi|315581934|gb|EFU94125.1| ribosomal protein S18 [Enterococcus faecalis TX0309A]
 gi|323479248|gb|ADX78687.1| ribosomal protein S18 [Enterococcus faecalis 62]
 gi|327533862|gb|AEA92696.1| 30S ribosomal protein S18 [Enterococcus faecalis OG1RF]
 gi|329576169|gb|EGG57687.1| ribosomal protein S18 [Enterococcus faecalis TX1467]
          Length = 79

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/52 (55%), Positives = 39/52 (75%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD  LL RF+S+RGKI+P R++    K QR+L  AIKRAR +GL+ +V+
Sbjct: 25 IDYKDTELLKRFISERGKILPRRVTGTGAKNQRKLTIAIKRARIMGLLPFVS 76


>gi|332295125|ref|YP_004437048.1| 30S ribosomal protein S18 [Thermodesulfobium narugense DSM 14796]
 gi|332178228|gb|AEE13917.1| 30S ribosomal protein S18 [Thermodesulfobium narugense DSM 14796]
          Length = 77

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK+C    +    IDYKD+  L ++LS RGKI+P R + +  K QR+L  AIKRAR + 
Sbjct: 11 RRKACSFCAEKVKYIDYKDVNRLKKYLSDRGKILPKRATGLCAKHQRQLTTAIKRARMIA 70

Query: 77 LIAYV 81
          L+ + 
Sbjct: 71 LLPFT 75


>gi|218440037|ref|YP_002378366.1| 30S ribosomal protein S18 [Cyanothece sp. PCC 7424]
 gi|218172765|gb|ACK71498.1| ribosomal protein S18 [Cyanothece sp. PCC 7424]
          Length = 71

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 42/52 (80%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          I+YKDI LL +F+++RGKI+P RI+ ++ K+QR+L  A+K+AR L L+ ++N
Sbjct: 17 INYKDIELLRKFITERGKILPRRITGLTAKQQRDLTTAVKQARILALLPFIN 68


>gi|299830553|ref|YP_003735001.1| 30S ribosomal protein S18 [Durinskia baltica]
 gi|297384917|gb|ADI40216.1| 30S ribosomal protein S18 [Durinskia baltica]
          Length = 72

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 2/65 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK  P+S     +IDYKDI LL  F++++GKI+P R + V+ ++QR+L+KAIKRAR L 
Sbjct: 5  KRKVSPISFNQ--KIDYKDIDLLTLFVTEQGKILPRRATGVTVQQQRKLSKAIKRARVLS 62

Query: 77 LIAYV 81
          L  +V
Sbjct: 63 LFPFV 67


>gi|302393056|ref|YP_003828876.1| 30S ribosomal protein S18P [Acetohalobium arabaticum DSM 5501]
 gi|302205133|gb|ADL13811.1| SSU ribosomal protein S18P [Acetohalobium arabaticum DSM 5501]
          Length = 71

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          RKSC         IDYK++  L+++L+ RGKIVP RIS    + QR+L KAIKRAR + L
Sbjct: 6  RKSCEFCANKIDHIDYKEVNKLDKYLTDRGKIVPRRISGNCARHQRQLTKAIKRARSIAL 65

Query: 78 IAYV 81
          + + 
Sbjct: 66 LPFT 69


>gi|256827566|ref|YP_003151525.1| 30S ribosomal protein S18P [Cryptobacterium curtum DSM 15641]
 gi|256583709|gb|ACU94843.1| SSU ribosomal protein S18P [Cryptobacterium curtum DSM 15641]
          Length = 87

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C    +G   IDYKD ++L ++++ RGKI P R++    + QR++A A+KRAR + 
Sbjct: 9  RRKYCQFCKEGTEYIDYKDTQMLRKYVTDRGKIKPRRVTGACTQHQRDIANAVKRAREMA 68

Query: 77 LIAY 80
          L+ Y
Sbjct: 69 LMPY 72


>gi|73541692|ref|YP_296212.1| 30S ribosomal protein S18 [Ralstonia eutropha JMP134]
 gi|123774065|sp|Q46ZR5|RS181_RALEJ RecName: Full=30S ribosomal protein S18 1
 gi|72119105|gb|AAZ61368.1| SSU ribosomal protein S18P [Ralstonia eutropha JMP134]
          Length = 92

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G  +IDYKD+  L  F+   GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 23 RKRFCRFTVAGVEQIDYKDLDTLKDFIGDNGKITPARLTGTKAHYQRQLDTAIKRARFLA 82

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 83 LMPYTDL 89


>gi|94310915|ref|YP_584125.1| 30S ribosomal protein S18 [Cupriavidus metallidurans CH34]
 gi|113868253|ref|YP_726742.1| 30S ribosomal protein S18 [Ralstonia eutropha H16]
 gi|122946776|sp|Q0K9E7|RS18_RALEH RecName: Full=30S ribosomal protein S18
 gi|122987924|sp|Q1LLX0|RS18_RALME RecName: Full=30S ribosomal protein S18
 gi|93354767|gb|ABF08856.1| SSU ribosomal protein S18 [Cupriavidus metallidurans CH34]
 gi|113527029|emb|CAJ93374.1| SSU ribosomal protein S18 [Ralstonia eutropha H16]
          Length = 92

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G  +IDYKD+  L  F+   GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 23 RKRFCRFTVAGVEQIDYKDLDTLKDFIGDNGKITPARLTGTKAHYQRQLDTAIKRARFLA 82

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 83 LMPYTDL 89


>gi|330850819|ref|YP_004376569.1| 30S ribosomal protein S18 [Fistulifera sp. JPCC DA0580]
 gi|328835639|dbj|BAK18935.1| 30S ribosomal protein S18 [Fistulifera sp. JPCC DA0580]
          Length = 70

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 49/67 (73%), Gaps = 2/67 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S ++ S P+S     +IDYKDI LL+ F++++GKI+P R + V+ ++QR+LAKAIKRAR 
Sbjct: 3  SKKQHSSPISL--TQKIDYKDIDLLSLFVTEQGKILPRRATGVTVQQQRKLAKAIKRARI 60

Query: 75 LGLIAYV 81
          L L  ++
Sbjct: 61 LSLFPFI 67


>gi|289449911|ref|YP_003475641.1| 30S ribosomal protein S18 [Clostridiales genomosp. BVAB3 str.
          UPII9-5]
 gi|289184458|gb|ADC90883.1| ribosomal protein S18 [Clostridiales genomosp. BVAB3 str.
          UPII9-5]
          Length = 90

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 40/64 (62%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD+  L +F+S+RGKI+P R+S    K QREL  AIKRAR+L L+
Sbjct: 25 KVCNFCADHIETIDYKDVVRLRKFVSERGKILPKRMSGTCAKHQRELTIAIKRARHLALL 84

Query: 79 AYVN 82
           ++ 
Sbjct: 85 PFIG 88


>gi|320353929|ref|YP_004195268.1| 30S ribosomal protein S18P [Desulfobulbus propionicus DSM 2032]
 gi|320122431|gb|ADW17977.1| SSU ribosomal protein S18P [Desulfobulbus propionicus DSM 2032]
          Length = 79

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 42/71 (59%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          + V  RR+ C         IDYKD + L  F+++RGKI+P RI     K QREL +A+KR
Sbjct: 5  KKVFSRRRVCRFCTDKDVTIDYKDPKTLKNFVTERGKIIPRRIYGTCAKHQRELTEAVKR 64

Query: 72 ARYLGLIAYVN 82
          AR L L+ Y+ 
Sbjct: 65 ARQLALLPYMG 75


>gi|115372930|ref|ZP_01460234.1| conserved domain protein [Stigmatella aurantiaca DW4/3-1]
 gi|115370008|gb|EAU68939.1| conserved domain protein [Stigmatella aurantiaca DW4/3-1]
          Length = 109

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 49/66 (74%), Gaps = 2/66 (3%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           RRK  PL       +D+KD++LL  F+++RG+++P R++ V+ ++QR++AKA+KRAR LG
Sbjct: 43  RRKPNPLGN--VRTLDFKDVQLLKYFVTERGRLIPRRLTGVTAQQQRQIAKAVKRARLLG 100

Query: 77  LIAYVN 82
           L+ ++ 
Sbjct: 101 LLPFLQ 106


>gi|225574408|ref|ZP_03783018.1| hypothetical protein RUMHYD_02477 [Blautia hydrogenotrophica DSM
          10507]
 gi|225038376|gb|EEG48622.1| hypothetical protein RUMHYD_02477 [Blautia hydrogenotrophica DSM
          10507]
          Length = 87

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (65%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   GK    IDYKD+  L R++S+RGKI+P RI+    K QR L  AIKRAR++ ++ Y
Sbjct: 25 CVFCGKENNEIDYKDVAKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHMAMMPY 84

Query: 81 V 81
          V
Sbjct: 85 V 85


>gi|297569121|ref|YP_003690465.1| ribosomal protein S18 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925036|gb|ADH85846.1| ribosomal protein S18 [Desulfurivibrio alkaliphilus AHT2]
          Length = 79

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          R+    RRK C      +  IDYKD++ L  FL++RGKI+P RI     K QR+L++AIK
Sbjct: 4  RKKYFGRRKVCRFCSDKSLAIDYKDVKTLRGFLTERGKIIPRRIYGNCAKHQRQLSEAIK 63

Query: 71 RARYLGLIAYVN 82
          RAR + L+ Y  
Sbjct: 64 RARQIALLPYTG 75


>gi|226315507|ref|YP_002775403.1| 30S ribosomal protein S18 [Brevibacillus brevis NBRC 100599]
 gi|254765413|sp|C0ZA45|RS18_BREBN RecName: Full=30S ribosomal protein S18
 gi|226098457|dbj|BAH46899.1| 30S ribosomal protein S18 [Brevibacillus brevis NBRC 100599]
          Length = 76

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 42/67 (62%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + RRK C         IDYKDI LL +F+S+RGKI+P R++  S K QR L  AIKR+R 
Sbjct: 8  NKRRKVCFFKVNKIKHIDYKDIDLLKKFISERGKILPRRVTGTSAKYQRALTIAIKRSRQ 67

Query: 75 LGLIAYV 81
          + L+ Y 
Sbjct: 68 VALLPYT 74


>gi|17546028|ref|NP_519430.1| 30S ribosomal protein S18 [Ralstonia solanacearum GMI1000]
 gi|300691703|ref|YP_003752698.1| 30S ribosomal protein S18 [Ralstonia solanacearum PSI07]
 gi|300704316|ref|YP_003745919.1| 30S ribosomal protein S18 [Ralstonia solanacearum CFBP2957]
 gi|20978684|sp|Q8XZT6|RS18_RALSO RecName: Full=30S ribosomal protein S18
 gi|17428323|emb|CAD15011.1| probable 30s ribosomal protein s18 [Ralstonia solanacearum
          GMI1000]
 gi|299067361|emb|CBJ38560.1| 30S ribosomal protein S18 [Ralstonia solanacearum CMR15]
 gi|299071980|emb|CBJ43310.1| 30S ribosomal protein S18 [Ralstonia solanacearum CFBP2957]
 gi|299078763|emb|CBJ51423.1| 30S ribosomal protein S18 [Ralstonia solanacearum PSI07]
          Length = 92

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G  +IDYKD+  L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 23 RKKFCRFTVAGVEQIDYKDLDTLKDFIGENGKITPARLTGTRSHYQRQLDTAIKRARFLA 82

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 83 LMPYTD 88


>gi|71891875|ref|YP_277604.1| 30S ribosomal protein S18 [Candidatus Blochmannia pennsylvanicus
          str. BPEN]
 gi|123761484|sp|Q493V4|RS18_BLOPB RecName: Full=30S ribosomal protein S18
 gi|71795981|gb|AAZ40732.1| 30S ribosomal subunit protein S18 [Candidatus Blochmannia
          pennsylvanicus str. BPEN]
          Length = 79

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (63%), Gaps = 1/74 (1%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          ++ R V HR K C  + +    IDYKD+  +   + + GKI+PSRI+    + QR+LA+A
Sbjct: 4  IMARFVRHR-KFCRFTAEKCINIDYKDLVTIQHSIIESGKIIPSRITGTRARYQRQLARA 62

Query: 69 IKRARYLGLIAYVN 82
          IKRARYL L+ Y +
Sbjct: 63 IKRARYLSLLPYTD 76


>gi|51598376|ref|YP_072564.1| 30S ribosomal protein S18 [Borrelia garinii PBi]
 gi|59798661|sp|Q662P9|RS18_BORGA RecName: Full=30S ribosomal protein S18
 gi|51572947|gb|AAU06972.1| ribosomal protein S18 [Borrelia garinii PBi]
          Length = 96

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 1/65 (1%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RKSC     G    DYKD   L +F++++GKI+P RI+  S K QR LA  +KRARY+ 
Sbjct: 31 KRKSCKFCDSGK-HPDYKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEVKRARYMA 89

Query: 77 LIAYV 81
          L+ +V
Sbjct: 90 LLPFV 94


>gi|302343161|ref|YP_003807690.1| ribosomal protein S18 [Desulfarculus baarsii DSM 2075]
 gi|301639774|gb|ADK85096.1| ribosomal protein S18 [Desulfarculus baarsii DSM 2075]
          Length = 78

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C        +IDYKD R L  F ++RGKI+P RIS    K QREL  AIKR+R++ 
Sbjct: 10 RRKVCRFCADTTIKIDYKDPRTLRYFTTERGKIIPRRISGCCAKHQRELTLAIKRSRHIA 69

Query: 77 LIAY 80
          L+ +
Sbjct: 70 LLPF 73


>gi|227500388|ref|ZP_03930450.1| possible ribosomal protein S18 [Anaerococcus tetradius ATCC
          35098]
 gi|227217451|gb|EEI82770.1| possible ribosomal protein S18 [Anaerococcus tetradius ATCC
          35098]
          Length = 76

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K  P     +  IDYKDI  L RF++ RGKI+P R++ ++ K QRE+ +AIKRAR + 
Sbjct: 10 RKKVDPFVKDPSKVIDYKDIETLKRFVTDRGKILPRRVTGLNAKHQREITRAIKRARQVA 69

Query: 77 LIAY 80
          L+ Y
Sbjct: 70 LLPY 73


>gi|195941851|ref|ZP_03087233.1| 30S ribosomal protein S18 [Borrelia burgdorferi 80a]
 gi|223889129|ref|ZP_03623718.1| ribosomal protein S18 [Borrelia burgdorferi 64b]
 gi|223885378|gb|EEF56479.1| ribosomal protein S18 [Borrelia burgdorferi 64b]
          Length = 96

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 42/65 (64%), Gaps = 1/65 (1%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RKSC     G    DYKD   L +F++++GKI+P RI+  S K QR LA  IKRARY+ 
Sbjct: 31 KRKSCRFCDSGK-HPDYKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRARYMA 89

Query: 77 LIAYV 81
          L+ +V
Sbjct: 90 LLPFV 94


>gi|71906857|ref|YP_284444.1| SSU ribosomal protein S18P [Dechloromonas aromatica RCB]
 gi|71846478|gb|AAZ45974.1| SSU ribosomal protein S18P [Dechloromonas aromatica RCB]
          Length = 91

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +   +IDYKD+ +L  F+ +  KI+P+R++      QR+L  AIKRAR++ 
Sbjct: 23 RRKFCRFTAEKVEQIDYKDVDVLKEFIQENAKIMPARLTGTKAGYQRQLGTAIKRARFMA 82

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 83 LLPYTD 88


>gi|126665193|ref|ZP_01736176.1| ribosomal protein S18 [Marinobacter sp. ELB17]
 gi|126630563|gb|EBA01178.1| ribosomal protein S18 [Marinobacter sp. ELB17]
          Length = 76

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRAR+L L+ Y +
Sbjct: 14 TAEGVKEIDYKDLDTLKGYVTETGKIVPSRITGTKARYQRQLATAIKRARFLALLPYSD 72


>gi|116332690|ref|YP_794217.1| ribosomal protein S18 [Lactobacillus brevis ATCC 367]
 gi|122270614|sp|Q03UD6|RS18_LACBA RecName: Full=30S ribosomal protein S18
 gi|116098037|gb|ABJ63186.1| SSU ribosomal protein S18P [Lactobacillus brevis ATCC 367]
          Length = 78

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/52 (55%), Positives = 40/52 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD  LL RF+S+RGKI+P R++  S K QR+L  AIKR+R +GL+ +V+
Sbjct: 25 IDYKDTDLLRRFISERGKILPRRVTGTSAKNQRKLTIAIKRSRIMGLMPFVS 76


>gi|11465722|ref|NP_053866.1| ribosomal protein S18 [Porphyra purpurea]
 gi|1710698|sp|P51256|RR18_PORPU RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|1276722|gb|AAC08142.1| 30S ribosomal protein S18 [Porphyra purpurea]
          Length = 70

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 49/67 (73%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R+K  P+    A  +DYKDI LL +F++++GKI+P R + ++ K+Q++L KAIK+AR L
Sbjct: 4  YRKKISPIKPTEA--VDYKDIDLLRKFITEQGKILPKRSTGLTSKQQKKLTKAIKQARIL 61

Query: 76 GLIAYVN 82
           L+ ++N
Sbjct: 62 SLLPFLN 68


>gi|195536238|ref|ZP_03079245.1| ribosomal protein S18 [Francisella tularensis subsp. novicida
          FTE]
 gi|208779341|ref|ZP_03246687.1| ribosomal protein S18 [Francisella novicida FTG]
 gi|194372715|gb|EDX27426.1| ribosomal protein S18 [Francisella tularensis subsp. novicida
          FTE]
 gi|208745141|gb|EDZ91439.1| ribosomal protein S18 [Francisella novicida FTG]
          Length = 59

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 39/52 (75%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD+  L  ++++ GKIVPSR++  S K QR+LA AIKRAR+L L+ Y +
Sbjct: 4  IDYKDVNKLKAYITETGKIVPSRVTGTSAKYQRQLATAIKRARFLALLPYCD 55


>gi|257065997|ref|YP_003152253.1| 30S ribosomal protein S18 [Anaerococcus prevotii DSM 20548]
 gi|256797877|gb|ACV28532.1| ribosomal protein S18 [Anaerococcus prevotii DSM 20548]
          Length = 75

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K  P     +  IDYKDI  L RF++ RGKI+P R++ ++ K QRE+ +AIKRAR + 
Sbjct: 9  RKKVDPFVKDPSKVIDYKDIETLKRFVTDRGKILPRRVTGLNAKHQREITRAIKRARQVA 68

Query: 77 LIAY 80
          L+ Y
Sbjct: 69 LLPY 72


>gi|187923778|ref|YP_001895420.1| 30S ribosomal protein S18 [Burkholderia phytofirmans PsJN]
 gi|229559973|sp|B2T3N5|RS18_BURPP RecName: Full=30S ribosomal protein S18
 gi|187714972|gb|ACD16196.1| ribosomal protein S18 [Burkholderia phytofirmans PsJN]
          Length = 91

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 39/66 (59%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +      IDYKD+  L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 22 RKKFCRFTAANVDHIDYKDLETLKDFIGENGKITPARLTGTKSHYQRQLDTAIKRARFLA 81

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 82 LVPYTD 87


>gi|332529061|ref|ZP_08405026.1| 30S ribosomal protein S18 [Hylemonella gracilis ATCC 19624]
 gi|332041505|gb|EGI77866.1| 30S ribosomal protein S18 [Hylemonella gracilis ATCC 19624]
          Length = 93

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKDI  L  F+++ GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 24 RKRFCRFTVAGVEEIDYKDIDTLRDFIAENGKIIPARLTGTRAIYQRQLNTAIKRARFLA 83

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 84 LLPYTD 89


>gi|291520307|emb|CBK75528.1| SSU ribosomal protein S18P [Butyrivibrio fibrisolvens 16/4]
          Length = 84

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR +  R+K C   GK    IDYKD   L +++S+RGKI+P RI+    K QR L  AIK
Sbjct: 13 RRPMHRRKKVCVFCGKDNV-IDYKDTAKLKKYISERGKILPRRITGTCAKHQRALTVAIK 71

Query: 71 RARYLGLIAYV 81
          RAR++ L+ YV
Sbjct: 72 RARHVALMPYV 82


>gi|187932713|ref|YP_001887719.1| 30S ribosomal protein S18 [Clostridium botulinum B str. Eklund
          17B]
 gi|188587867|ref|YP_001922702.1| 30S ribosomal protein S18 [Clostridium botulinum E3 str. Alaska
          E43]
 gi|251778070|ref|ZP_04820990.1| 30S ribosomal protein S18 [Clostridium botulinum E1 str. 'BoNT E
          Beluga']
 gi|187720866|gb|ACD22087.1| 30S ribosomal protein S18 [Clostridium botulinum B str. Eklund
          17B]
 gi|188498148|gb|ACD51284.1| 30S ribosomal protein S18 [Clostridium botulinum E3 str. Alaska
          E43]
 gi|243082385|gb|EES48275.1| 30S ribosomal protein S18 [Clostridium botulinum E1 str. 'BoNT E
          Beluga']
          Length = 83

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK C      A  IDYKDI  L +++++RGKI+P RIS    K QR+L  AIKRAR + 
Sbjct: 17 KRKVCAFCVDKADSIDYKDINKLRKYVTERGKILPRRISGTCAKHQRQLTDAIKRARNIA 76

Query: 77 LIAYVN 82
          L+ +  
Sbjct: 77 LLPFTT 82


>gi|110003930|emb|CAK98270.1| 30s ribosomal protein s18 [Spiroplasma citri]
          Length = 74

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +      IDYKD+ LL +F+S  G+I+P R++  + K QR LA AIKRAR + L
Sbjct: 9  KKQCYFTKNKITYIDYKDVELLKKFISGNGQILPKRVTGTTAKNQRMLATAIKRARQMAL 68

Query: 78 IAYV 81
          + +V
Sbjct: 69 LPFV 72


>gi|239814826|ref|YP_002943736.1| 30S ribosomal protein S18 [Variovorax paradoxus S110]
 gi|319792759|ref|YP_004154399.1| ribosomal protein s18 [Variovorax paradoxus EPS]
 gi|259494822|sp|C5CUP2|RS18_VARPS RecName: Full=30S ribosomal protein S18
 gi|239801403|gb|ACS18470.1| ribosomal protein S18 [Variovorax paradoxus S110]
 gi|315595222|gb|ADU36288.1| ribosomal protein S18 [Variovorax paradoxus EPS]
          Length = 93

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKDI  L  F+S+ GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 24 RKRFCRFTVAGVEEIDYKDIDTLRDFISENGKIIPARLTGTRAIYQRQLNTAIKRARFLA 83

Query: 77 LIAYVN 82
          ++ Y +
Sbjct: 84 MVPYSD 89


>gi|325105010|ref|YP_004274664.1| SSU ribosomal protein S18P [Pedobacter saltans DSM 12145]
 gi|324973858|gb|ADY52842.1| SSU ribosomal protein S18P [Pedobacter saltans DSM 12145]
          Length = 87

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 45/68 (66%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
           +R+K C     G   IDYKD   L +F++ +GKI+P R++  S K QR++A+A+KRAR 
Sbjct: 16 DNRKKYCRFKKNGIKYIDYKDANFLLKFINDQGKILPRRLTGTSLKYQRKVAQAVKRARI 75

Query: 75 LGLIAYVN 82
          +G++ +V 
Sbjct: 76 IGILPFVT 83


>gi|296393674|ref|YP_003658558.1| 30S ribosomal protein S18 [Segniliparus rotundus DSM 44985]
 gi|296180821|gb|ADG97727.1| ribosomal protein S18 [Segniliparus rotundus DSM 44985]
          Length = 83

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 49/82 (59%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA   P   LR     + K  PL  +G  ++DYKD  LL  F+S+RGKI   R++ ++ +
Sbjct: 1  MARKPPVKKLRVAEIRKPKKNPLKAQGVEQVDYKDTNLLRTFISERGKIRSRRVTGLTPR 60

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
          +QR++A A+K AR + L+ + N
Sbjct: 61 QQRDVATAVKNAREMALLPFTN 82


>gi|108773338|ref|YP_635893.1| ribosomal protein S18 [Oltmannsiellopsis viridis]
 gi|122238313|sp|Q20EV2|RR18_OLTVI RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|82541920|gb|ABB81961.1| ribosomal protein S18 [Oltmannsiellopsis viridis]
          Length = 78

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 45/64 (70%), Gaps = 3/64 (4%)

Query: 23 LSGKGAP---RIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
          L   G P    +DYK+I LL +++S  GKI+P RI+ ++ K+QR +AKAIK AR +GL+ 
Sbjct: 12 LKSTGTPFQGTVDYKNIALLRKYISTEGKILPRRITGLTAKQQRAVAKAIKNARMVGLLP 71

Query: 80 YVNL 83
          ++NL
Sbjct: 72 FINL 75


>gi|325479860|gb|EGC82945.1| ribosomal protein S18 [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 75

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K  P     +  IDYKDI  L RF++ RGKI+P R++ ++ K QRE+ +AIKRAR + 
Sbjct: 9  RKKVDPFVKDPSKVIDYKDIETLKRFVTDRGKILPRRVTGLNAKHQREVTRAIKRARQVA 68

Query: 77 LIAY 80
          L+ Y
Sbjct: 69 LLPY 72


>gi|251800229|ref|YP_003014960.1| ribosomal protein S18 [Paenibacillus sp. JDR-2]
 gi|247547855|gb|ACT04874.1| ribosomal protein S18 [Paenibacillus sp. JDR-2]
          Length = 94

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (61%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + RRK C  +      IDYKD  LL +F+S+RGKI+P R++  S K QR L  AIKRAR 
Sbjct: 26 NKRRKVCFFTVNKITHIDYKDTDLLKKFISERGKILPRRVTGTSAKYQRLLTVAIKRART 85

Query: 75 LGLIAYVN 82
          + L+ Y  
Sbjct: 86 VALLPYTT 93


>gi|226968685|ref|YP_002808645.1| small subunit ribosomal protein S18 [Micromonas sp. RCC299]
 gi|226431163|gb|ACO55569.1| small subunit ribosomal protein S18 [Micromonas sp. RCC299]
          Length = 70

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 50/65 (76%), Gaps = 2/65 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+++ P++      I+YK++ LL RF++++GKI+P R++ V+ K+QR+LAKA+K+AR LG
Sbjct: 5  RQRTSPINA--GEIINYKNVDLLRRFITEQGKILPRRLTGVTAKQQRQLAKAVKQARILG 62

Query: 77 LIAYV 81
           + ++
Sbjct: 63 FLQFL 67


>gi|152983164|ref|YP_001352993.1| 30S ribosomal protein S18 [Janthinobacterium sp. Marseille]
 gi|151283241|gb|ABR91651.1| small subunit ribosomal protein S18 [Janthinobacterium sp.
          Marseille]
          Length = 94

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +     ++DYKD+  L  F+ + GKI+P+R++      QR++  AIKRARYL 
Sbjct: 25 RKKFCRFTAAHVEQVDYKDVDTLKDFVQENGKIMPARLTGTKAIYQRQVDTAIKRARYLA 84

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 85 LLPYTDL 91


>gi|149918391|ref|ZP_01906881.1| ribosomal protein S18 [Plesiocystis pacifica SIR-1]
 gi|149820691|gb|EDM80101.1| ribosomal protein S18 [Plesiocystis pacifica SIR-1]
          Length = 82

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 40/51 (78%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYK+ +LL  FL++RGK++P+RI+ VS ++QR + KAIKRAR L L+ Y 
Sbjct: 30 IDYKNPQLLKHFLTERGKVIPARITGVSARQQRAITKAIKRARQLALLPYT 80


>gi|255993995|ref|ZP_05427130.1| ribosomal protein S18 [Eubacterium saphenum ATCC 49989]
 gi|255993663|gb|EEU03752.1| ribosomal protein S18 [Eubacterium saphenum ATCC 49989]
          Length = 77

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 40/51 (78%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYK++ LL++F+S+RGKI+P R++  S   QRELAKAIK++R + L+ Y 
Sbjct: 25 IDYKNVDLLSKFVSERGKILPKRVTGASSAMQRELAKAIKKSRVMALMPYT 75


>gi|168335183|ref|ZP_02693288.1| 30S ribosomal protein S18 (BS21) [Epulopiscium sp. 'N.t.
          morphotype B']
          Length = 77

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 42/63 (66%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K    +G    +I+YKDI  L +F+S+RGKI+P RI+  S K QR+L  AIKRAR++ L+
Sbjct: 13 KVNQFAGDNIKKINYKDINTLKKFISERGKILPRRITGNSAKAQRKLTAAIKRARHIALL 72

Query: 79 AYV 81
           Y 
Sbjct: 73 PYT 75


>gi|332881934|ref|ZP_08449576.1| ribosomal protein S18 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
 gi|332680169|gb|EGJ53124.1| ribosomal protein S18 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
          Length = 92

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL   + S ++K C     G   IDYKD   L +F++++GK++P R++  S K QR++A
Sbjct: 14 TPL-NIDTSKQKKYCRFKKLGIKYIDYKDADFLLKFVNEQGKLLPRRLTGTSLKFQRKVA 72

Query: 67 KAIKRARYLGLIAYV 81
           A+KRAR+L L+ YV
Sbjct: 73 TAVKRARHLALMPYV 87


>gi|262065928|ref|ZP_06025540.1| ribosomal protein S18 [Fusobacterium periodonticum ATCC 33693]
 gi|291380408|gb|EFE87926.1| ribosomal protein S18 [Fusobacterium periodonticum ATCC 33693]
          Length = 72

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 1/69 (1%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RR+   L  K A  IDYK++ LL RF+S +GKI PSR++  + K QR++AKAIKRAR 
Sbjct: 3  EFRRRRAKLRVK-AEEIDYKNVELLKRFVSDKGKINPSRLTGANAKLQRKIAKAIKRARN 61

Query: 75 LGLIAYVNL 83
          + LI Y  +
Sbjct: 62 IALIPYTRI 70


>gi|315320484|ref|YP_004072540.1| 30S ribosomal protein S18 [Thalassiosira oceanica CCMP1005]
 gi|283568957|gb|ADB27494.1| 30S ribosomal protein S18 [Thalassiosira oceanica CCMP1005]
          Length = 72

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          +S + K  P+      +IDYKDI LL  F++++GKI+P R + V+ ++QR++AKAIKRAR
Sbjct: 2  LSQKHKLAPIGIN--QKIDYKDIDLLKLFITEQGKILPRRATGVTVQQQRQIAKAIKRAR 59

Query: 74 YLGLIAYV 81
           L L+ +V
Sbjct: 60 VLSLLPFV 67


>gi|78224039|ref|YP_385786.1| 30S ribosomal protein S18 [Geobacter metallireducens GS-15]
 gi|123742790|sp|Q39RR3|RS18_GEOMG RecName: Full=30S ribosomal protein S18
 gi|78195294|gb|ABB33061.1| SSU ribosomal protein S18P [Geobacter metallireducens GS-15]
          Length = 106

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK C         IDYKD R+L  F+++RGKIVP RIS    K QRE+ +AIKRAR +
Sbjct: 35 QRRKVCRFCADKDLVIDYKDPRVLRSFITERGKIVPRRISGNCSKHQREITEAIKRARNI 94

Query: 76 GLI 78
           LI
Sbjct: 95 ALI 97


>gi|125974670|ref|YP_001038580.1| 30S ribosomal protein S18 [Clostridium thermocellum ATCC 27405]
 gi|256004131|ref|ZP_05429115.1| ribosomal protein S18 [Clostridium thermocellum DSM 2360]
 gi|281418858|ref|ZP_06249877.1| ribosomal protein S18 [Clostridium thermocellum JW20]
 gi|166220948|sp|A3DHF8|RS18_CLOTH RecName: Full=30S ribosomal protein S18
 gi|125714895|gb|ABN53387.1| SSU ribosomal protein S18P [Clostridium thermocellum ATCC 27405]
 gi|255991879|gb|EEU01977.1| ribosomal protein S18 [Clostridium thermocellum DSM 2360]
 gi|281407942|gb|EFB38201.1| ribosomal protein S18 [Clostridium thermocellum JW20]
 gi|316941795|gb|ADU75829.1| ribosomal protein S18 [Clostridium thermocellum DSM 1313]
          Length = 94

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K C        RIDYKD+  L +++S+RGKI+P RIS    K QR+L  AIKRAR++ 
Sbjct: 28 KKKICAFCVDKVERIDYKDVAKLKKYISERGKILPRRISGNCAKHQRQLTVAIKRARHIA 87

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 88 LLPYT 92


>gi|206889919|ref|YP_002248636.1| ribosomal protein S18 [Thermodesulfovibrio yellowstonii DSM
          11347]
 gi|206741857|gb|ACI20914.1| ribosomal protein S18 [Thermodesulfovibrio yellowstonii DSM
          11347]
          Length = 77

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 44/67 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C    +    IDYK+++LL  F+++RGKI+  +++    K QREL KAIKRAR + 
Sbjct: 11 RKKYCRFCAEKIDFIDYKNVKLLRGFMTERGKILSRKLTGTCSKHQRELTKAIKRARAVA 70

Query: 77 LIAYVNL 83
          L+ Y+ +
Sbjct: 71 LLPYIEI 77


>gi|299830348|ref|YP_003734563.1| ribosomal protein S18 [Kryptoperidinium foliaceum]
 gi|297385050|gb|ADI40348.1| ribosomal protein S18 [Kryptoperidinium foliaceum]
          Length = 72

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 48/65 (73%), Gaps = 2/65 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK  P+S     +IDYKDI LL+ F++++GKI+P R + V+ ++QR+L+KAIKRAR L 
Sbjct: 5  KRKVSPISLNQ--KIDYKDIDLLSLFVTEQGKILPRRATGVTIQQQRKLSKAIKRARVLS 62

Query: 77 LIAYV 81
          L  +V
Sbjct: 63 LFPFV 67


>gi|237736139|ref|ZP_04566620.1| SSU ribosomal protein S18P [Fusobacterium mortiferum ATCC 9817]
 gi|229421692|gb|EEO36739.1| SSU ribosomal protein S18P [Fusobacterium mortiferum ATCC 9817]
          Length = 72

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 1/69 (1%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RR+   L  K A  IDYK++ LL RF+S +GKI PSR++  + K QR++AKAIKRAR 
Sbjct: 3  EFRRRRAKLRVK-AEEIDYKNVDLLKRFVSDKGKINPSRVTGANAKLQRKIAKAIKRARN 61

Query: 75 LGLIAYVNL 83
          + LI Y  +
Sbjct: 62 IALIPYTRI 70


>gi|51246448|ref|YP_066332.1| 30S ribosomal protein S18 [Desulfotalea psychrophila LSv54]
 gi|59798684|sp|Q6AK01|RS18_DESPS RecName: Full=30S ribosomal protein S18
 gi|50877485|emb|CAG37325.1| probable 30S ribosomal protein S18 [Desulfotalea psychrophila
          LSv54]
          Length = 81

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 2/77 (2%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +AP P  ++ +  R+K C         IDYKD+++L  F+S+RGKI+P RI       QR
Sbjct: 1  MAPRP--QKKLFTRKKVCRFCADKELVIDYKDVKVLRNFVSERGKIIPRRIVGTCASHQR 58

Query: 64 ELAKAIKRARYLGLIAY 80
          +L +A+KRAR + L+ Y
Sbjct: 59 QLCEAVKRARQIALLPY 75


>gi|11467346|ref|NP_043203.1| ribosomal protein S18 [Cyanophora paradoxa]
 gi|133835|sp|P15760|RR18_CYAPA RecName: Full=Cyanelle 30S ribosomal protein S18
 gi|11400|emb|CAA35533.1| S18 ribosomal protein [Cyanophora paradoxa]
 gi|1016147|gb|AAA81234.1| ribosomal protein S18 [Cyanophora paradoxa]
          Length = 71

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (68%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +RR+  PL       IDY+D+ LL  F++ +GKI+P R++ ++ K+QR + KAIK+AR L
Sbjct: 4  YRRRLSPLKPNQV--IDYQDVELLRTFITDQGKILPRRVTGLTAKQQRAVTKAIKQARVL 61

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 62 ALLPFVN 68


>gi|291297665|ref|YP_003508943.1| 30S ribosomal protein S18 [Stackebrandtia nassauensis DSM 44728]
 gi|290566885|gb|ADD39850.1| ribosomal protein S18 [Stackebrandtia nassauensis DSM 44728]
          Length = 79

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++KS PL  +G   ID+KD  LL +F+S RGKI   R++ V+ ++QR++A+A+K AR + 
Sbjct: 11 KKKSNPLDKEGITYIDFKDTALLRKFISDRGKIRARRVTGVTAQQQRQIARAVKNAREMA 70

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 71 LLPYTS 76


>gi|331089019|ref|ZP_08337926.1| hypothetical protein HMPREF1025_01509 [Lachnospiraceae bacterium
          3_1_46FAA]
 gi|330406471|gb|EGG85984.1| hypothetical protein HMPREF1025_01509 [Lachnospiraceae bacterium
          3_1_46FAA]
          Length = 88

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C   GK    I+YKD+  L +++S+RGKI+P RI+    K QR L  AIKRAR++ 
Sbjct: 22 RKKVCVFCGKENNEINYKDVAKLKKYVSERGKILPRRITGNCAKHQRALTVAIKRARHIA 81

Query: 77 LIAYVN 82
          L+ YV 
Sbjct: 82 LMPYVQ 87


>gi|307326229|ref|ZP_07605426.1| ribosomal protein S18 [Streptomyces violaceusniger Tu 4113]
 gi|306888172|gb|EFN19161.1| ribosomal protein S18 [Streptomyces violaceusniger Tu 4113]
          Length = 80

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 43/64 (67%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR+  PL   G   +DYKD  LL +F+S RGKI   R+S V+ ++QR++A+AIK AR + 
Sbjct: 14 RRRVNPLDAAGITYVDYKDTDLLRKFISDRGKIRSRRVSHVTRRQQRQIARAIKNAREMA 73

Query: 77 LIAY 80
          L+ Y
Sbjct: 74 LLPY 77


>gi|229829467|ref|ZP_04455536.1| hypothetical protein GCWU000342_01557 [Shuttleworthia satelles
          DSM 14600]
 gi|229791898|gb|EEP28012.1| hypothetical protein GCWU000342_01557 [Shuttleworthia satelles
          DSM 14600]
          Length = 76

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK C   G     IDYKD   L +++S+RGKI+P RI+    + QR L  AIK
Sbjct: 5  RRPAHRRRKVCVFCGSEVA-IDYKDANQLRKYVSERGKILPRRITGTCARHQRALTSAIK 63

Query: 71 RARYLGLIAYVN 82
          RAR+L ++ YV 
Sbjct: 64 RARHLAIMPYVE 75


>gi|256826412|ref|YP_003150372.1| 30S ribosomal protein S18 [Kytococcus sedentarius DSM 20547]
 gi|256689805|gb|ACV07607.1| SSU ribosomal protein S18P [Kytococcus sedentarius DSM 20547]
          Length = 81

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K+ PL      +IDYKD  LL +F+S RGKI   R++ VS ++QR++AKA+K AR + 
Sbjct: 13 KKKANPLKAAKVEKIDYKDTALLRKFISDRGKIRARRVTGVSVQEQRQIAKAVKNAREMA 72

Query: 77 LIAY 80
          L+ Y
Sbjct: 73 LLPY 76


>gi|304405909|ref|ZP_07387567.1| ribosomal protein S18 [Paenibacillus curdlanolyticus YK9]
 gi|304345152|gb|EFM10988.1| ribosomal protein S18 [Paenibacillus curdlanolyticus YK9]
          Length = 92

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          R+  + RRK C  +      IDYKD  LL +F+S+RGKI+P R++  S K QR L  AIK
Sbjct: 20 RKGRNKRRKVCFFTVNKIKHIDYKDTDLLRKFISERGKILPRRVTGTSAKYQRLLTVAIK 79

Query: 71 RARYLGLIAYVN 82
          R+R + L+ Y  
Sbjct: 80 RSRQIALLPYTT 91


>gi|257452936|ref|ZP_05618235.1| SSU ribosomal protein S18P [Fusobacterium sp. 3_1_5R]
 gi|257462524|ref|ZP_05626936.1| SSU ribosomal protein S18P [Fusobacterium sp. D12]
 gi|257466684|ref|ZP_05630995.1| SSU ribosomal protein S18P [Fusobacterium gonidiaformans ATCC
          25563]
 gi|315917837|ref|ZP_07914077.1| SSU ribosomal protein S18P [Fusobacterium gonidiaformans ATCC
          25563]
 gi|317059477|ref|ZP_07923962.1| SSU ribosomal protein S18P [Fusobacterium sp. 3_1_5R]
 gi|317060179|ref|ZP_07924664.1| SSU ribosomal protein S18P [Fusobacterium sp. D12]
 gi|313685153|gb|EFS21988.1| SSU ribosomal protein S18P [Fusobacterium sp. 3_1_5R]
 gi|313685855|gb|EFS22690.1| SSU ribosomal protein S18P [Fusobacterium sp. D12]
 gi|313691712|gb|EFS28547.1| SSU ribosomal protein S18P [Fusobacterium gonidiaformans ATCC
          25563]
          Length = 72

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 1/69 (1%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RR+   L  K A  IDYK++ LL RF+S +GKI PSR++  + K QR++AKAIKRAR 
Sbjct: 3  EFRRRRAKLRVK-AEEIDYKNVDLLKRFVSDKGKINPSRLTGANAKLQRKIAKAIKRARN 61

Query: 75 LGLIAYVNL 83
          + LI Y  +
Sbjct: 62 IALIPYTKI 70


>gi|218135342|ref|ZP_03464146.1| hypothetical protein BACPEC_03247 [Bacteroides pectinophilus ATCC
          43243]
 gi|217990727|gb|EEC56738.1| hypothetical protein BACPEC_03247 [Bacteroides pectinophilus ATCC
          43243]
          Length = 90

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C      +  IDYKD+ LL R++S+RGKI+P RI+    K QR L  A+KRAR++ L
Sbjct: 25 KKVCIFCADQSKAIDYKDVNLLKRYVSERGKILPRRITGNCAKHQRALTVAVKRARHIAL 84

Query: 78 IAY 80
          + Y
Sbjct: 85 MPY 87


>gi|104773266|ref|YP_618246.1| 30S ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus ATCC 11842]
 gi|123252027|sp|Q1GC35|RS18_LACDA RecName: Full=30S ribosomal protein S18
 gi|103422347|emb|CAI96855.1| 30S ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus ATCC 11842]
          Length = 78

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 39/51 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          +DYKD+ LL  F+S+RGKI+P  ++  S K QR++A AIKRAR +GL+ +V
Sbjct: 25 VDYKDVDLLKHFISERGKILPRSVTGTSAKNQRKVANAIKRARIMGLLPFV 75


>gi|187928273|ref|YP_001898760.1| 30S ribosomal protein S18 [Ralstonia pickettii 12J]
 gi|241662846|ref|YP_002981206.1| 30S ribosomal protein S18 [Ralstonia pickettii 12D]
 gi|309782228|ref|ZP_07676957.1| ribosomal protein S18 [Ralstonia sp. 5_7_47FAA]
 gi|187725163|gb|ACD26328.1| ribosomal protein S18 [Ralstonia pickettii 12J]
 gi|240864873|gb|ACS62534.1| ribosomal protein S18 [Ralstonia pickettii 12D]
 gi|308918999|gb|EFP64667.1| ribosomal protein S18 [Ralstonia sp. 5_7_47FAA]
          Length = 95

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +  G  +IDYKD+  L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 26 RKKFCRFTVAGVEQIDYKDLDTLKDFIGENGKITPARLTGTRAIYQRQLDTAIKRARFLA 85

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 86 LMPYTD 91


>gi|225016117|ref|ZP_03705350.1| hypothetical protein CLOSTMETH_00061 [Clostridium methylpentosum
          DSM 5476]
 gi|224951114|gb|EEG32323.1| hypothetical protein CLOSTMETH_00061 [Clostridium methylpentosum
          DSM 5476]
          Length = 77

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C         IDYKDI  L R++S+R KIVP R++    + QR+L  A+KRAR+L 
Sbjct: 11 RKKVCAFCVDKVENIDYKDIAKLRRYMSERAKIVPRRVTGTCARHQRQLTVAVKRARHLA 70

Query: 77 LIAYVN 82
          ++ Y++
Sbjct: 71 MLPYIS 76


>gi|15896953|ref|NP_350302.1| 30S ribosomal protein S18 [Clostridium acetobutylicum ATCC 824]
 gi|20978716|sp|Q97CX4|RS18_CLOAB RecName: Full=30S ribosomal protein S18
 gi|15026828|gb|AAK81642.1|AE007867_9 Ribosomal protein S18 [Clostridium acetobutylicum ATCC 824]
 gi|325511130|gb|ADZ22766.1| 30S ribosomal protein S18 [Clostridium acetobutylicum EA 2018]
          Length = 90

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 44/70 (62%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          RN   +RK C    + +  IDYKDI  L +++++RGKI+P RIS    K QREL  AIKR
Sbjct: 19 RNRKMKRKICSFCMEKSESIDYKDINKLRKYVTERGKILPRRISGNCAKHQRELTIAIKR 78

Query: 72 ARYLGLIAYV 81
          AR + L+ + 
Sbjct: 79 ARNIALLPFT 88


>gi|15674171|ref|NP_268346.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis
          Il1403]
 gi|116513137|ref|YP_812044.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris
          SK11]
 gi|125625229|ref|YP_001033712.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris
          MG1363]
 gi|281492845|ref|YP_003354825.1| 50S ribosomal protein S18P [Lactococcus lactis subsp. lactis
          KF147]
 gi|13878750|sp|Q9CDN0|RS18_LACLA RecName: Full=30S ribosomal protein S18
 gi|122939895|sp|Q02VU1|RS18_LACLS RecName: Full=30S ribosomal protein S18
 gi|166220956|sp|A2RNZ2|RS18_LACLM RecName: Full=30S ribosomal protein S18
 gi|12725253|gb|AAK06287.1|AE006448_5 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis
          Il1403]
 gi|116108791|gb|ABJ73931.1| SSU ribosomal protein S18P [Lactococcus lactis subsp. cremoris
          SK11]
 gi|124494037|emb|CAL99037.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris
          MG1363]
 gi|281376497|gb|ADA65983.1| SSU ribosomal protein S18P [Lactococcus lactis subsp. lactis
          KF147]
 gi|300072039|gb|ADJ61439.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris
          NZ9000]
 gi|326407763|gb|ADZ64834.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis CV56]
          Length = 81

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          +DYKD  LL RF+S+RGKI+P R++  S K QR++  AIKRAR + L+ +V
Sbjct: 26 VDYKDTELLKRFISERGKILPRRVTGTSAKNQRKVVNAIKRARVMALLPFV 76


>gi|295108217|emb|CBL22170.1| SSU ribosomal protein S18P [Ruminococcus obeum A2-162]
          Length = 87

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (65%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  A+KRAR+L L+ Y
Sbjct: 25 CVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQRALTVAVKRARHLSLMPY 84

Query: 81 V 81
          V
Sbjct: 85 V 85


>gi|19704977|ref|NP_602472.1| SSU ribosomal protein S18P [Fusobacterium nucleatum subsp.
          nucleatum ATCC 25586]
 gi|34763885|ref|ZP_00144789.1| SSU ribosomal protein S18P [Fusobacterium nucleatum subsp.
          vincentii ATCC 49256]
 gi|237742686|ref|ZP_04573167.1| SSU ribosomal protein S18P [Fusobacterium sp. 4_1_13]
 gi|237743347|ref|ZP_04573828.1| SSU ribosomal protein S18P [Fusobacterium sp. 7_1]
 gi|256028465|ref|ZP_05442299.1| SSU ribosomal protein S18P [Fusobacterium sp. D11]
 gi|256846081|ref|ZP_05551539.1| ribosomal protein S18 [Fusobacterium sp. 3_1_36A2]
 gi|260495033|ref|ZP_05815162.1| ribosomal protein S18 [Fusobacterium sp. 3_1_33]
 gi|289766386|ref|ZP_06525764.1| SSU ribosomal protein S18P [Fusobacterium sp. D11]
 gi|294784789|ref|ZP_06750077.1| ribosomal protein S18 [Fusobacterium sp. 3_1_27]
 gi|296329232|ref|ZP_06871733.1| 30S ribosomal protein S18 [Fusobacterium nucleatum subsp.
          nucleatum ATCC 23726]
 gi|22257028|sp|Q8RIE4|RS18_FUSNN RecName: Full=30S ribosomal protein S18
 gi|19712881|gb|AAL93771.1| SSU ribosomal protein S18P [Fusobacterium nucleatum subsp.
          nucleatum ATCC 25586]
 gi|27886348|gb|EAA23619.1| SSU ribosomal protein S18P [Fusobacterium nucleatum subsp.
          vincentii ATCC 49256]
 gi|229430334|gb|EEO40546.1| SSU ribosomal protein S18P [Fusobacterium sp. 4_1_13]
 gi|229433126|gb|EEO43338.1| SSU ribosomal protein S18P [Fusobacterium sp. 7_1]
 gi|256719640|gb|EEU33195.1| ribosomal protein S18 [Fusobacterium sp. 3_1_36A2]
 gi|260197476|gb|EEW94994.1| ribosomal protein S18 [Fusobacterium sp. 3_1_33]
 gi|289717941|gb|EFD81953.1| SSU ribosomal protein S18P [Fusobacterium sp. D11]
 gi|294486503|gb|EFG33865.1| ribosomal protein S18 [Fusobacterium sp. 3_1_27]
 gi|296153588|gb|EFG94405.1| 30S ribosomal protein S18 [Fusobacterium nucleatum subsp.
          nucleatum ATCC 23726]
          Length = 72

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 1/67 (1%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RR+   L  K A  IDYK++ LL RF+S +GKI PSR++  + K QR++AKA+KRAR 
Sbjct: 3  EFRRRRAKLRVK-AEEIDYKNVELLKRFVSDKGKINPSRLTGANAKLQRKIAKAVKRARN 61

Query: 75 LGLIAYV 81
          + LI Y 
Sbjct: 62 IALIPYT 68


>gi|167766039|ref|ZP_02438092.1| hypothetical protein CLOSS21_00532 [Clostridium sp. SS2/1]
 gi|317499404|ref|ZP_07957671.1| ribosomal protein S18 [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167712119|gb|EDS22698.1| hypothetical protein CLOSS21_00532 [Clostridium sp. SS2/1]
 gi|291559997|emb|CBL38797.1| SSU ribosomal protein S18P [butyrate-producing bacterium SSC/2]
 gi|316893276|gb|EFV15491.1| ribosomal protein S18 [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 84

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          +P+ RR    RRK C    +    IDYKD+  L +++S+RGKI+P RI+    K QR + 
Sbjct: 8  SPMRRRGGRRRRKVCAFCTEADAVIDYKDVATLKKYVSERGKILPRRITGTCAKHQRAVT 67

Query: 67 KAIKRARYLGLIAYV 81
           AIKRAR+L L+ Y 
Sbjct: 68 GAIKRARHLALMPYT 82


>gi|167773044|ref|ZP_02445097.1| hypothetical protein ANACOL_04433 [Anaerotruncus colihominis DSM
          17241]
 gi|167664977|gb|EDS09107.1| hypothetical protein ANACOL_04433 [Anaerotruncus colihominis DSM
          17241]
          Length = 86

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (62%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          R N   R+K C         IDYKD+  L R+LS+R KIVP R++    + QR+L  AIK
Sbjct: 14 RGNRKGRKKVCAFCVDKLGPIDYKDVPRLRRYLSERAKIVPRRVTGTCARHQRQLTLAIK 73

Query: 71 RARYLGLIAYVN 82
          RAR++GL+ Y++
Sbjct: 74 RARHIGLLPYIS 85


>gi|237739060|ref|ZP_04569541.1| SSU ribosomal protein S18P [Fusobacterium sp. 2_1_31]
 gi|254303426|ref|ZP_04970784.1| ribosomal protein S18 [Fusobacterium nucleatum subsp. polymorphum
          ATCC 10953]
 gi|294783934|ref|ZP_06749256.1| ribosomal protein S18 [Fusobacterium sp. 1_1_41FAA]
 gi|148323618|gb|EDK88868.1| ribosomal protein S18 [Fusobacterium nucleatum subsp. polymorphum
          ATCC 10953]
 gi|229423660|gb|EEO38707.1| SSU ribosomal protein S18P [Fusobacterium sp. 2_1_31]
 gi|294479746|gb|EFG27525.1| ribosomal protein S18 [Fusobacterium sp. 1_1_41FAA]
          Length = 72

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 1/69 (1%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RR+   L  K A  IDYK++ LL RF+S +GKI PSR++  + K QR++AKA+KRAR 
Sbjct: 3  EFRRRRAKLRVK-AEEIDYKNVELLKRFVSDKGKINPSRLTGANAKLQRKIAKAVKRARN 61

Query: 75 LGLIAYVNL 83
          + LI Y  +
Sbjct: 62 IALIPYTRI 70


>gi|189425664|ref|YP_001952841.1| 30S ribosomal protein S18 [Geobacter lovleyi SZ]
 gi|226735121|sp|B3E6H4|RS18_GEOLS RecName: Full=30S ribosomal protein S18
 gi|189421923|gb|ACD96321.1| ribosomal protein S18 [Geobacter lovleyi SZ]
          Length = 110

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 40/63 (63%)

Query: 16  HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
            RRK C    +    IDYKD R L  F+++RGKIVP RIS    K QRE+ +AIKRAR L
Sbjct: 39  QRRKVCRFCAEKDTTIDYKDPRTLRYFITERGKIVPRRISGNCSKHQREITEAIKRARNL 98

Query: 76  GLI 78
            L+
Sbjct: 99  ALL 101


>gi|253581412|ref|ZP_04858638.1| ribosomal protein S18 [Fusobacterium varium ATCC 27725]
 gi|257470800|ref|ZP_05634890.1| SSU ribosomal protein S18P [Fusobacterium ulcerans ATCC 49185]
 gi|317065004|ref|ZP_07929489.1| SSU ribosomal protein S18P [Fusobacterium ulcerans ATCC 49185]
 gi|251836776|gb|EES65310.1| ribosomal protein S18 [Fusobacterium varium ATCC 27725]
 gi|313690680|gb|EFS27515.1| SSU ribosomal protein S18P [Fusobacterium ulcerans ATCC 49185]
          Length = 72

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 1/69 (1%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RR+   L  K A  IDYK++ LL RF+S +GKI PSR++  + K QR +AKAIKRAR 
Sbjct: 3  EFRRRRAKLRVK-AEEIDYKNVDLLKRFVSDKGKINPSRVTGANAKLQRRIAKAIKRARN 61

Query: 75 LGLIAYVNL 83
          + LI Y  +
Sbjct: 62 IALIPYTRI 70


>gi|319943303|ref|ZP_08017586.1| 50S ribosomal protein L21 [Lautropia mirabilis ATCC 51599]
 gi|319743845|gb|EFV96249.1| 50S ribosomal protein L21 [Lautropia mirabilis ATCC 51599]
          Length = 91

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  + +    IDYKD+  L  F++++GKI+P+R++      QR+L  AI+RAR+L 
Sbjct: 24 RKKFCRFTAEKVEWIDYKDVDTLKDFVTEQGKIIPARLTGTRAHYQRQLGVAIRRARFLA 83

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 84 LMPYTD 89


>gi|329913487|ref|ZP_08275956.1| SSU ribosomal protein S18p [Oxalobacteraceae bacterium IMCC9480]
 gi|327545345|gb|EGF30580.1| SSU ribosomal protein S18p [Oxalobacteraceae bacterium IMCC9480]
          Length = 96

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 42/67 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +     ++DYKD+  L  F+ + GKI+P+R++      QR++  AIKRAR+L 
Sbjct: 27 RKKFCRFTAAHVEQVDYKDVDTLKDFVQENGKIMPARLTGTRAHYQRQVDTAIKRARFLA 86

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 87 LLPYTDL 93


>gi|307325551|ref|ZP_07604752.1| ribosomal protein S18 [Streptomyces violaceusniger Tu 4113]
 gi|306888679|gb|EFN19664.1| ribosomal protein S18 [Streptomyces violaceusniger Tu 4113]
          Length = 94

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 41/59 (69%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          PL   G+  IDYKD  LL +F+S RGKI   R++ VS ++QR+LA+AIK AR + L+ Y
Sbjct: 33 PLDKAGSTYIDYKDTELLRKFISDRGKIRGRRVTRVSAQQQRQLARAIKNAREMALLPY 91


>gi|159903436|ref|YP_001550780.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9211]
 gi|159888612|gb|ABX08826.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9211]
          Length = 73

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 43/56 (76%), Gaps = 1/56 (1%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G P IDYKD+  L +F+++RGKI+P R++ ++ ++QR+L  A+KRAR + L+ +VN
Sbjct: 16 GDP-IDYKDVETLKKFITERGKILPRRLTGLTAQQQRDLTVAVKRARIIALLPFVN 70


>gi|42560585|ref|NP_975036.1| 30S ribosomal protein S18 [Mycoplasma mycoides subsp. mycoides SC
          str. PG1]
 gi|331703042|ref|YP_004399729.1| 30S ribosomal protein S18 [Mycoplasma mycoides subsp. capri LC
          str. 95010]
 gi|59798739|sp|Q6MUK6|RS18_MYCMS RecName: Full=30S ribosomal protein S18
 gi|42492081|emb|CAE76678.1| 30S ribosomal protein S18 [Mycoplasma mycoides subsp. mycoides SC
          str. PG1]
 gi|256384267|gb|ACU78837.1| ribosomal protein S18 [Mycoplasma mycoides subsp. capri str.
          GM12]
 gi|256385100|gb|ACU79669.1| ribosomal protein S18 [Mycoplasma mycoides subsp. capri str.
          GM12]
 gi|296455226|gb|ADH21461.1| ribosomal protein S18 [synthetic Mycoplasma mycoides JCVI-syn1.0]
 gi|301320649|gb|ADK69292.1| ribosomal protein S18 [Mycoplasma mycoides subsp. mycoides SC
          str. Gladysdale]
 gi|328801597|emb|CBW53750.1| 30S ribosomal protein S18 [Mycoplasma mycoides subsp. capri LC
          str. 95010]
          Length = 75

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKDI LL +F+S  G+I+P RI+  S K QR+LA AIKRAR + L+ YV
Sbjct: 23 IDYKDIELLKKFISPNGQILPRRITGTSPKDQRQLALAIKRARQMALLPYV 73


>gi|269837478|ref|YP_003319706.1| 30S ribosomal protein S18 [Sphaerobacter thermophilus DSM 20745]
 gi|269786741|gb|ACZ38884.1| ribosomal protein S18 [Sphaerobacter thermophilus DSM 20745]
          Length = 128

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 40/66 (60%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           RRK C     G   +DYKDI  L R++S+RGKI P R +    K QR LA AIKRAR++ 
Sbjct: 63  RRKVCGFCMDGIGEVDYKDIGRLRRYISERGKIEPRRQTGTCAKHQRSLAVAIKRARHVA 122

Query: 77  LIAYVN 82
           L+ +  
Sbjct: 123 LLPFTQ 128


>gi|121607971|ref|YP_995778.1| 30S ribosomal protein S18 [Verminephrobacter eiseniae EF01-2]
 gi|241764689|ref|ZP_04762701.1| ribosomal protein S18 [Acidovorax delafieldii 2AN]
 gi|166222255|sp|A1WGK3|RS18_VEREI RecName: Full=30S ribosomal protein S18
 gi|121552611|gb|ABM56760.1| SSU ribosomal protein S18P [Verminephrobacter eiseniae EF01-2]
 gi|241365859|gb|EER60508.1| ribosomal protein S18 [Acidovorax delafieldii 2AN]
          Length = 93

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKD+  L  F+++ GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 24 RKRFCRFTVTGVEEIDYKDVDTLRDFIAENGKIIPARLTGTRAIFQRQLNTAIKRARFLA 83

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 84 LVPYSD 89


>gi|182416746|ref|ZP_02948143.1| ribosomal protein S18 [Clostridium butyricum 5521]
 gi|237669618|ref|ZP_04529596.1| ribosomal protein S18 [Clostridium butyricum E4 str. BoNT E
          BL5262]
 gi|182379403|gb|EDT76898.1| ribosomal protein S18 [Clostridium butyricum 5521]
 gi|237654852|gb|EEP52414.1| ribosomal protein S18 [Clostridium butyricum E4 str. BoNT E
          BL5262]
          Length = 85

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C      A  IDYKDI  L +++++RGKI+P RIS    K QREL  +IKRAR + 
Sbjct: 19 RKKVCAFCVDKAEFIDYKDINKLRKYVTERGKILPRRISGTCAKHQRELTTSIKRARNIA 78

Query: 77 LIAYV 81
          L+ + 
Sbjct: 79 LLPFT 83


>gi|167760811|ref|ZP_02432938.1| hypothetical protein CLOSCI_03196 [Clostridium scindens ATCC
          35704]
 gi|167661698|gb|EDS05828.1| hypothetical protein CLOSCI_03196 [Clostridium scindens ATCC
          35704]
          Length = 88

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (65%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AIKRAR++ L+ Y
Sbjct: 26 CVFCGKENNEIDYKDVAKLRKYISERGKILPRRITGNCAKHQRALTVAIKRARHVALMPY 85

Query: 81 V 81
          V
Sbjct: 86 V 86


>gi|24214377|ref|NP_711858.1| 30S ribosomal protein S18 [Leptospira interrogans serovar Lai str.
           56601]
 gi|304570496|ref|YP_002045.2| 30S ribosomal protein S18 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|24195312|gb|AAN48876.1| 30S ribosomal protein S18 [Leptospira interrogans serovar Lai str.
           56601]
          Length = 103

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 54/81 (66%), Gaps = 3/81 (3%)

Query: 2   AEVAPTPLLRRNVSHRRKSCPLSG--KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSH 59
           AE+   P  ++N  +++K C  +   + A +I+YK+I LL RF++ RGKI+P RI+  S 
Sbjct: 21  AEMEGKPQRKQN-KYKKKVCRFTADPELAKQINYKNIELLERFITNRGKIIPRRITGTSA 79

Query: 60  KKQRELAKAIKRARYLGLIAY 80
           + QR LA+ I++AR +GL+ Y
Sbjct: 80  RYQRVLAREIRKARSIGLLPY 100


>gi|298345837|ref|YP_003718524.1| putative 30S ribosomal protein S18 [Mobiluncus curtisii ATCC
          43063]
 gi|304390460|ref|ZP_07372413.1| 30S ribosomal protein S18 [Mobiluncus curtisii subsp. curtisii
          ATCC 35241]
 gi|315654410|ref|ZP_07907318.1| ribosomal protein S18 [Mobiluncus curtisii ATCC 51333]
 gi|315657668|ref|ZP_07910550.1| ribosomal protein S18 [Mobiluncus curtisii subsp. holmesii ATCC
          35242]
 gi|298235898|gb|ADI67030.1| possible 30S ribosomal protein S18 [Mobiluncus curtisii ATCC
          43063]
 gi|304326216|gb|EFL93461.1| 30S ribosomal protein S18 [Mobiluncus curtisii subsp. curtisii
          ATCC 35241]
 gi|315491445|gb|EFU81062.1| ribosomal protein S18 [Mobiluncus curtisii ATCC 51333]
 gi|315492140|gb|EFU81749.1| ribosomal protein S18 [Mobiluncus curtisii subsp. holmesii ATCC
          35242]
          Length = 81

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K+ PL  +    IDYKD  LL +F+S RGKI   R++ VS ++QR++AKA+K AR + 
Sbjct: 13 KKKTNPLKAQKVGNIDYKDTALLRKFISDRGKIRARRVTGVSVQEQRQIAKAVKNAREMA 72

Query: 77 LIAY 80
          L+ Y
Sbjct: 73 LLPY 76


>gi|145588609|ref|YP_001155206.1| ribosomal protein S18 [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
 gi|189029683|sp|A4SVX8|RS18_POLSQ RecName: Full=30S ribosomal protein S18
 gi|145047015|gb|ABP33642.1| SSU ribosomal protein S18P [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
          Length = 90

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          A  PL +R     ++ C  +  G  +IDYKD+  L  F+ +  KI P+R++    K QR+
Sbjct: 14 AQNPLFKR-----KRYCRFTVAGVEQIDYKDVDTLKDFIGENAKITPARLTGTKAKYQRQ 68

Query: 65 LAKAIKRARYLGLIAYVN 82
          L  AIKRARYL L+ + +
Sbjct: 69 LDTAIKRARYLALLPFSD 86


>gi|120609917|ref|YP_969595.1| 30S ribosomal protein S18 [Acidovorax citrulli AAC00-1]
 gi|319763794|ref|YP_004127731.1| ribosomal protein s18 [Alicycliphilus denitrificans BC]
 gi|326316064|ref|YP_004233736.1| 30S ribosomal protein S18 [Acidovorax avenae subsp. avenae ATCC
          19860]
 gi|330823942|ref|YP_004387245.1| 30S ribosomal protein S18 [Alicycliphilus denitrificans K601]
 gi|166220916|sp|A1TLI3|RS18_ACIAC RecName: Full=30S ribosomal protein S18
 gi|120588381|gb|ABM31821.1| SSU ribosomal protein S18P [Acidovorax citrulli AAC00-1]
 gi|317118355|gb|ADV00844.1| ribosomal protein S18 [Alicycliphilus denitrificans BC]
 gi|323372900|gb|ADX45169.1| 30S ribosomal protein S18 [Acidovorax avenae subsp. avenae ATCC
          19860]
 gi|329309314|gb|AEB83729.1| 30S ribosomal protein S18 [Alicycliphilus denitrificans K601]
          Length = 93

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKD+  L  F+++ GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 24 RKRFCRFTVAGVEEIDYKDVDTLRDFIAENGKIIPARLTGTRAIYQRQLNTAIKRARFLA 83

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 84 LVPYSD 89


>gi|160940069|ref|ZP_02087414.1| hypothetical protein CLOBOL_04958 [Clostridium bolteae ATCC
          BAA-613]
 gi|239624860|ref|ZP_04667891.1| ribosomal protein S18 [Clostridiales bacterium 1_7_47_FAA]
 gi|158436649|gb|EDP14416.1| hypothetical protein CLOBOL_04958 [Clostridium bolteae ATCC
          BAA-613]
 gi|239521246|gb|EEQ61112.1| ribosomal protein S18 [Clostridiales bacterium 1_7_47FAA]
          Length = 89

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 40/64 (62%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C   G     IDYKD+  L R++S+RGKI+P RI+    K QR L  AIKRAR++ L
Sbjct: 24 KKVCVFCGDKNGTIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHIAL 83

Query: 78 IAYV 81
          + Y 
Sbjct: 84 MPYT 87


>gi|160900659|ref|YP_001566241.1| 30S ribosomal protein S18 [Delftia acidovorans SPH-1]
 gi|229559982|sp|A9BNG1|RS18_DELAS RecName: Full=30S ribosomal protein S18
 gi|160366243|gb|ABX37856.1| ribosomal protein S18 [Delftia acidovorans SPH-1]
          Length = 93

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKD+  L  F+ + GKIVP+R++      QR+L  AIKRAR+L 
Sbjct: 24 RKRFCRFTVAGVEEIDYKDVDTLRDFIGENGKIVPARLTGTRAIYQRQLNTAIKRARFLA 83

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 84 LVPYSD 89


>gi|111114935|ref|YP_709553.1| 30S ribosomal protein S18 [Borrelia afzelii PKo]
 gi|216263818|ref|ZP_03435812.1| ribosomal protein S18 [Borrelia afzelii ACA-1]
 gi|123047064|sp|Q0SP51|RS18_BORAP RecName: Full=30S ribosomal protein S18
 gi|110890209|gb|ABH01377.1| ribosomal protein S18 [Borrelia afzelii PKo]
 gi|215979862|gb|EEC20684.1| ribosomal protein S18 [Borrelia afzelii ACA-1]
          Length = 96

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 1/65 (1%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RKSC     G    DYK+   L +F++++GKI+P RI+  S K QR LA  IKRARY+ 
Sbjct: 31 KRKSCKFCDSGK-HPDYKEFDFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRARYMA 89

Query: 77 LIAYV 81
          L+ +V
Sbjct: 90 LLPFV 94


>gi|325298154|ref|YP_004258071.1| 30S ribosomal protein S18 [Bacteroides salanitronis DSM 18170]
 gi|324317707|gb|ADY35598.1| 30S ribosomal protein S18 [Bacteroides salanitronis DSM 18170]
          Length = 89

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPYVT 85


>gi|153808732|ref|ZP_01961400.1| hypothetical protein BACCAC_03031 [Bacteroides caccae ATCC 43185]
 gi|255691414|ref|ZP_05415089.1| ribosomal protein S18 [Bacteroides finegoldii DSM 17565]
 gi|293368836|ref|ZP_06615440.1| ribosomal protein S18 [Bacteroides ovatus SD CMC 3f]
 gi|298483612|ref|ZP_07001787.1| ribosomal protein S18 [Bacteroides sp. D22]
 gi|149128558|gb|EDM19776.1| hypothetical protein BACCAC_03031 [Bacteroides caccae ATCC 43185]
 gi|260623060|gb|EEX45931.1| ribosomal protein S18 [Bacteroides finegoldii DSM 17565]
 gi|292636141|gb|EFF54629.1| ribosomal protein S18 [Bacteroides ovatus SD CMC 3f]
 gi|298270182|gb|EFI11768.1| ribosomal protein S18 [Bacteroides sp. D22]
          Length = 90

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPYVT 86


>gi|325679786|ref|ZP_08159360.1| ribosomal protein S18 [Ruminococcus albus 8]
 gi|324108601|gb|EGC02843.1| ribosomal protein S18 [Ruminococcus albus 8]
          Length = 83

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C      A +IDYKDI  L + +++R KI+P R++      QREL KAIKRAR++ 
Sbjct: 17 RKKVCMFCVDRAEKIDYKDIAKLRKCMTERAKILPRRVTGTCAYHQRELTKAIKRARHVA 76

Query: 77 LIAYV 81
          L+ YV
Sbjct: 77 LLPYV 81


>gi|312144682|ref|YP_003996128.1| ribosomal protein S18 [Halanaerobium sp. 'sapolanicus']
 gi|311905333|gb|ADQ15774.1| ribosomal protein S18 [Halanaerobium sp. 'sapolanicus']
          Length = 70

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 41/65 (63%), Gaps = 1/65 (1%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R KSC   G     IDYKD+R L R+L+ RGKI+P R +    K QR++  A+KRAR + 
Sbjct: 5  RNKSCHFCGSDKT-IDYKDLRTLKRYLTDRGKIMPRRTTGNCSKHQRDITIAVKRARAIA 63

Query: 77 LIAYV 81
          L+ YV
Sbjct: 64 LLPYV 68


>gi|261855980|ref|YP_003263263.1| ribosomal protein S18 [Halothiobacillus neapolitanus c2]
 gi|261836449|gb|ACX96216.1| ribosomal protein S18 [Halothiobacillus neapolitanus c2]
          Length = 74

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +   +IDYKD+  L ++L++ GKIVP+R++  + + QR+L  AIKRAR+L L+ Y +
Sbjct: 14 TAENVKQIDYKDLDTLKQYLTETGKIVPARVTGTAARYQRQLQTAIKRARFLALLPYTD 72


>gi|213966078|ref|ZP_03394266.1| ribosomal protein S18 [Corynebacterium amycolatum SK46]
 gi|213951276|gb|EEB62670.1| ribosomal protein S18 [Corynebacterium amycolatum SK46]
          Length = 83

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 44/67 (65%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S R K  PL   G  ++DYKDI LL +F+S RGKI   R++ ++ ++QR++A A+K AR 
Sbjct: 15 SRRPKKNPLKAAGVEKVDYKDINLLRQFISDRGKIRSRRVTGLTPQQQRQVATAVKNARE 74

Query: 75 LGLIAYV 81
          + L+ + 
Sbjct: 75 MALLPFT 81


>gi|225386697|ref|ZP_03756461.1| hypothetical protein CLOSTASPAR_00445 [Clostridium asparagiforme
          DSM 15981]
 gi|225047224|gb|EEG57470.1| hypothetical protein CLOSTASPAR_00445 [Clostridium asparagiforme
          DSM 15981]
          Length = 89

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 40/64 (62%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C   G     IDYKD+  L R++S+RGKI+P RI+    K QR L  AIKRAR++ L
Sbjct: 24 KKVCVFCGDKNGTIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHIAL 83

Query: 78 IAYV 81
          + Y 
Sbjct: 84 MPYT 87


>gi|218264329|ref|ZP_03478186.1| hypothetical protein PRABACTJOHN_03877 [Parabacteroides johnsonii
          DSM 18315]
 gi|218222097|gb|EEC94747.1| hypothetical protein PRABACTJOHN_03877 [Parabacteroides johnsonii
          DSM 18315]
          Length = 89

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPYVT 85


>gi|221633229|ref|YP_002522454.1| 30S ribosomal protein S18 [Thermomicrobium roseum DSM 5159]
 gi|221155713|gb|ACM04840.1| 30S ribosomal protein S18 [Thermomicrobium roseum DSM 5159]
          Length = 106

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 41/65 (63%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           R+K C     G  +IDYKD   L R+LS + KI P R +    K QR+LA+AIKRAR+L 
Sbjct: 39  RKKVCSFCMDGIKKIDYKDFGRLRRYLSPQAKIEPRRATGTCAKHQRQLARAIKRARHLA 98

Query: 77  LIAYV 81
           L+ +V
Sbjct: 99  LLPFV 103


>gi|153810611|ref|ZP_01963279.1| hypothetical protein RUMOBE_00992 [Ruminococcus obeum ATCC 29174]
 gi|149833790|gb|EDM88871.1| hypothetical protein RUMOBE_00992 [Ruminococcus obeum ATCC 29174]
          Length = 87

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 40/61 (65%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  A+KRAR+L ++ Y
Sbjct: 25 CVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQRALTVAVKRARHLSMMPY 84

Query: 81 V 81
          V
Sbjct: 85 V 85


>gi|113170433|ref|YP_717225.1| Rps18 [Ostreococcus tauri]
 gi|122228947|sp|Q0P3N0|RR18_OSTTA RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|112806840|emb|CAL36347.1| Rps18 [Ostreococcus tauri]
          Length = 70

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 48/65 (73%), Gaps = 2/65 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+++ P+       I YK++ LL RF++++GKI+P R++ V+ K+QR+LAKAIK+AR LG
Sbjct: 5  RQRTSPIHA--GEIISYKNVDLLRRFITEQGKILPRRLTGVTAKEQRQLAKAIKQARILG 62

Query: 77 LIAYV 81
           + ++
Sbjct: 63 FLQFL 67


>gi|310830125|ref|YP_003962482.1| hypothetical protein ELI_4585 [Eubacterium limosum KIST612]
 gi|308741859|gb|ADO39519.1| hypothetical protein ELI_4585 [Eubacterium limosum KIST612]
          Length = 75

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 45/77 (58%), Gaps = 5/77 (6%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P P  RR     RK C    +    +DYKD+  L +++S+RGKI+P R +    K QR++
Sbjct: 2  PKPFKRR-----RKVCEFCERHETEVDYKDVATLKKYISERGKILPRRATGTCAKHQRKV 56

Query: 66 AKAIKRARYLGLIAYVN 82
           +A+KRAR + L+ Y +
Sbjct: 57 TEAVKRARNIALLPYTS 73


>gi|317057125|ref|YP_004105592.1| 30S ribosomal protein S18 [Ruminococcus albus 7]
 gi|315449394|gb|ADU22958.1| ribosomal protein S18 [Ruminococcus albus 7]
          Length = 81

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C      A +IDYKDI  L + +++R KI+P R++      QREL KAIKRAR++ 
Sbjct: 15 RKKVCMFCVDRAEKIDYKDIAKLRKCMTERAKILPRRVTGTCAYHQRELTKAIKRARHVA 74

Query: 77 LIAYV 81
          L+ YV
Sbjct: 75 LLPYV 79


>gi|197119136|ref|YP_002139563.1| 30S ribosomal protein S18 [Geobacter bemidjiensis Bem]
 gi|253700102|ref|YP_003021291.1| 30S ribosomal protein S18 [Geobacter sp. M21]
 gi|226735120|sp|B5EHW8|RS18_GEOBB RecName: Full=30S ribosomal protein S18
 gi|259494810|sp|C6E504|RS18_GEOSM RecName: Full=30S ribosomal protein S18
 gi|197088496|gb|ACH39767.1| ribosomal protein S18 [Geobacter bemidjiensis Bem]
 gi|251774952|gb|ACT17533.1| ribosomal protein S18 [Geobacter sp. M21]
          Length = 92

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 39/63 (61%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK C         IDYKD R L  F+S+RGKI+P RIS    K QRE+ +AIKRAR +
Sbjct: 21 QRRKVCRFCADKQVTIDYKDPRTLRYFVSERGKIIPRRISGNCSKHQREITEAIKRARNI 80

Query: 76 GLI 78
           L+
Sbjct: 81 ALL 83


>gi|282600706|ref|ZP_05979550.2| 30S ribosomal protein S18 [Subdoligranulum variabile DSM 15176]
 gi|282571488|gb|EFB77023.1| 30S ribosomal protein S18 [Subdoligranulum variabile DSM 15176]
          Length = 100

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C         IDYKD+  L +++S+R KI+P R++      QREL  AIKRARY+ 
Sbjct: 34 RKKVCSFCVDRVEHIDYKDLPRLRKYVSERAKIIPRRVTGTCAFHQRELTVAIKRARYMA 93

Query: 77 LIAYVN 82
          L+ YV+
Sbjct: 94 LMPYVS 99


>gi|154508266|ref|ZP_02043908.1| hypothetical protein ACTODO_00762 [Actinomyces odontolyticus ATCC
          17982]
 gi|293191178|ref|ZP_06609111.1| ribosomal protein S18 [Actinomyces odontolyticus F0309]
 gi|153797900|gb|EDN80320.1| hypothetical protein ACTODO_00762 [Actinomyces odontolyticus ATCC
          17982]
 gi|292820599|gb|EFF79568.1| ribosomal protein S18 [Actinomyces odontolyticus F0309]
          Length = 80

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (66%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          RN   ++K+ PL      +IDYKD  LL +F+S RGKI   R++ VS ++QR++A+A+K 
Sbjct: 7  RNKPIKKKANPLKSAKIEKIDYKDTALLRKFISDRGKIRARRVTGVSTQEQRKIARAVKN 66

Query: 72 ARYLGLIAY 80
          AR + L+ Y
Sbjct: 67 AREMALLPY 75


>gi|171463205|ref|YP_001797318.1| ribosomal protein S18 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
 gi|229560050|sp|B1XTM7|RS18_POLNS RecName: Full=30S ribosomal protein S18
 gi|171192743|gb|ACB43704.1| ribosomal protein S18 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
          Length = 84

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 5/78 (6%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          A  PL +R     ++ C  +  G  +IDYKD+  L  F+ +  KI P+R++    K QR+
Sbjct: 8  AQNPLFKR-----KRYCRFTVAGVEQIDYKDVDTLKGFIGENAKITPARLTGTKAKYQRQ 62

Query: 65 LAKAIKRARYLGLIAYVN 82
          L  AIKRARYL L+ + +
Sbjct: 63 LDTAIKRARYLALLPFSD 80


>gi|290968075|ref|ZP_06559624.1| ribosomal protein S18 [Megasphaera genomosp. type_1 str. 28L]
 gi|290781981|gb|EFD94560.1| ribosomal protein S18 [Megasphaera genomosp. type_1 str. 28L]
          Length = 76

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 39/65 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C         IDYKD   L RF ++RGKI+P RIS V  K QR+L  AIKRAR + 
Sbjct: 10 RRKVCNFCVDHVDLIDYKDTAKLRRFTTERGKILPRRISGVCAKHQRKLTIAIKRARAIA 69

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 70 LLPYT 74


>gi|332983146|ref|YP_004464587.1| 30S ribosomal protein S18P [Mahella australiensis 50-1 BON]
 gi|332700824|gb|AEE97765.1| SSU ribosomal protein S18P [Mahella australiensis 50-1 BON]
          Length = 85

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 41/65 (63%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C      A +IDYKDI  L +++++RGKI+P RI+    K QR+L  AIKRAR + L
Sbjct: 20 KKVCAFCADKAYQIDYKDINRLKKYVTERGKIIPRRITGNCAKHQRQLTIAIKRARAIAL 79

Query: 78 IAYVN 82
          + Y  
Sbjct: 80 LPYTT 84


>gi|134095345|ref|YP_001100420.1| 30S ribosomal protein S18 [Herminiimonas arsenicoxydans]
 gi|133739248|emb|CAL62297.1| 30S ribosomal protein S18 [Herminiimonas arsenicoxydans]
          Length = 94

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 42/67 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +     ++DYKD+  L  F+ + GKI+P+R++      QR++  AIKRAR+L 
Sbjct: 25 RKKFCRFTAAHVEQVDYKDVDTLKDFVQENGKIMPARLTGTKAIYQRQVDTAIKRARFLA 84

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 85 LLPYTDL 91


>gi|21221852|ref|NP_627631.1| 30S ribosomal protein S18 [Streptomyces coelicolor A3(2)]
 gi|256786968|ref|ZP_05525399.1| 30S ribosomal protein S18 [Streptomyces lividans TK24]
 gi|7388047|sp|Q9X8K4|RS182_STRCO RecName: Full=30S ribosomal protein S18 2
 gi|4808364|emb|CAB42778.1| putative 30S ribosomal protein S18 [Streptomyces coelicolor
          A3(2)]
          Length = 79

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 43/64 (67%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++  PL   G   +DYKD  LL +F+S RGKI   R++ V+ ++QR+LA+AIK AR + 
Sbjct: 13 RQRPNPLDRDGVTYVDYKDTELLRKFVSDRGKIRSRRVTRVTSQQQRQLARAIKNAREMA 72

Query: 77 LIAY 80
          L+ Y
Sbjct: 73 LLPY 76


>gi|295835236|ref|ZP_06822169.1| ribosomal protein S18 [Streptomyces sp. SPB74]
 gi|197698172|gb|EDY45105.1| ribosomal protein S18 [Streptomyces sp. SPB74]
          Length = 79

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 39/59 (66%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          PL   G   IDYKD  LL +FLS RGKI   R++ VS ++QR+LA AIK AR + L+ Y
Sbjct: 18 PLDAAGITYIDYKDTDLLRKFLSDRGKIRSRRVTRVSAQQQRQLATAIKNAREMALLPY 76


>gi|283768493|ref|ZP_06341405.1| ribosomal protein S18 [Bulleidia extructa W1219]
 gi|283104885|gb|EFC06257.1| ribosomal protein S18 [Bulleidia extructa W1219]
          Length = 76

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 41/72 (56%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R+    RRK C  +      IDYKD+ LL +F+S   KI P R++    K QR LA AI
Sbjct: 3  FRKQRMGRRKVCYFTKNNIKFIDYKDVELLKKFISPNAKITPRRVTGTRAKYQRPLAIAI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 63 KRARQMALLPYV 74


>gi|320095140|ref|ZP_08026848.1| 30S ribosomal protein S18 [Actinomyces sp. oral taxon 178 str.
          F0338]
 gi|319977922|gb|EFW09557.1| 30S ribosomal protein S18 [Actinomyces sp. oral taxon 178 str.
          F0338]
          Length = 80

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (66%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          RN   ++K+ PL      +IDYKD  LL +F+S RGKI   R++ VS ++QR++A+A+K 
Sbjct: 7  RNKPIKKKANPLKSAKIEKIDYKDTALLRKFISDRGKIRARRVTGVSTQEQRKIARAVKN 66

Query: 72 ARYLGLIAY 80
          AR + L+ Y
Sbjct: 67 AREMALLPY 75


>gi|150019892|ref|YP_001312146.1| 30S ribosomal protein S18 [Clostridium beijerinckii NCIMB 8052]
 gi|189029672|sp|A6M3L0|RS18_CLOB8 RecName: Full=30S ribosomal protein S18
 gi|149906357|gb|ABR37190.1| ribosomal protein S18 [Clostridium beijerinckii NCIMB 8052]
          Length = 86

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 46/77 (59%), Gaps = 3/77 (3%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P   +RR+   R+K C      A  IDYKDI  L +++++RGKI+P RIS    K QREL
Sbjct: 12 PGGKMRRS---RKKVCAFCVDKAEFIDYKDINKLRKYVTERGKILPRRISGTCAKHQREL 68

Query: 66 AKAIKRARYLGLIAYVN 82
            +IKRAR + L+ +  
Sbjct: 69 TSSIKRARNIALLPFTT 85


>gi|146305681|ref|YP_001186146.1| 30S ribosomal protein S18 [Pseudomonas mendocina ymp]
 gi|330501635|ref|YP_004378504.1| 30S ribosomal protein S18 [Pseudomonas mendocina NK-01]
 gi|166220976|sp|A4XPZ8|RS18_PSEMY RecName: Full=30S ribosomal protein S18
 gi|145573882|gb|ABP83414.1| SSU ribosomal protein S18P [Pseudomonas mendocina ymp]
 gi|328915921|gb|AEB56752.1| 30S ribosomal protein S18 [Pseudomonas mendocina NK-01]
          Length = 76

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 40/59 (67%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +    ID+KD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRAR+L L+ Y +
Sbjct: 14 TAEDVKEIDFKDLNTLKAYISETGKIVPSRITGTKARYQRQLATAIKRARFLALLPYTD 72


>gi|300777789|ref|ZP_07087647.1| 30S ribosomal protein S18 [Chryseobacterium gleum ATCC 35910]
 gi|300503299|gb|EFK34439.1| 30S ribosomal protein S18 [Chryseobacterium gleum ATCC 35910]
          Length = 100

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL   N    +K C     G   +DYKD   L +F++++GKI+P R +  S K QR+++
Sbjct: 22 TPL-DINTKSEKKYCRFKKYGIKHVDYKDADFLLQFVNEQGKILPRRYTGTSLKYQRKVS 80

Query: 67 KAIKRARYLGLIAYV 81
           AIKRAR+L L+ YV
Sbjct: 81 AAIKRARHLALLPYV 95


>gi|160890914|ref|ZP_02071917.1| hypothetical protein BACUNI_03359 [Bacteroides uniformis ATCC
          8492]
 gi|167764865|ref|ZP_02436986.1| hypothetical protein BACSTE_03257 [Bacteroides stercoris ATCC
          43183]
 gi|218128603|ref|ZP_03457407.1| hypothetical protein BACEGG_00173 [Bacteroides eggerthii DSM
          20697]
 gi|270295895|ref|ZP_06202095.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|317475593|ref|ZP_07934855.1| ribosomal protein S18 [Bacteroides eggerthii 1_2_48FAA]
 gi|317479666|ref|ZP_07938790.1| ribosomal protein S18 [Bacteroides sp. 4_1_36]
 gi|319899907|ref|YP_004159635.1| SSU ribosomal protein S18P [Bacteroides helcogenes P 36-108]
 gi|329957654|ref|ZP_08298129.1| ribosomal protein S18 [Bacteroides clarus YIT 12056]
 gi|329960227|ref|ZP_08298669.1| ribosomal protein S18 [Bacteroides fluxus YIT 12057]
 gi|156859913|gb|EDO53344.1| hypothetical protein BACUNI_03359 [Bacteroides uniformis ATCC
          8492]
 gi|167697534|gb|EDS14113.1| hypothetical protein BACSTE_03257 [Bacteroides stercoris ATCC
          43183]
 gi|217989205|gb|EEC55519.1| hypothetical protein BACEGG_00173 [Bacteroides eggerthii DSM
          20697]
 gi|270273299|gb|EFA19161.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|316904167|gb|EFV25997.1| ribosomal protein S18 [Bacteroides sp. 4_1_36]
 gi|316908297|gb|EFV29989.1| ribosomal protein S18 [Bacteroides eggerthii 1_2_48FAA]
 gi|319414938|gb|ADV42049.1| SSU ribosomal protein S18P [Bacteroides helcogenes P 36-108]
 gi|328522531|gb|EGF49640.1| ribosomal protein S18 [Bacteroides clarus YIT 12056]
 gi|328532900|gb|EGF59677.1| ribosomal protein S18 [Bacteroides fluxus YIT 12057]
          Length = 90

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVT 86


>gi|189463978|ref|ZP_03012763.1| hypothetical protein BACINT_00313 [Bacteroides intestinalis DSM
          17393]
 gi|224536025|ref|ZP_03676564.1| hypothetical protein BACCELL_00889 [Bacteroides cellulosilyticus
          DSM 14838]
 gi|189438551|gb|EDV07536.1| hypothetical protein BACINT_00313 [Bacteroides intestinalis DSM
          17393]
 gi|224522350|gb|EEF91455.1| hypothetical protein BACCELL_00889 [Bacteroides cellulosilyticus
          DSM 14838]
          Length = 89

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVT 85


>gi|150010521|ref|YP_001305264.1| 30S ribosomal protein S18 [Parabacteroides distasonis ATCC 8503]
 gi|154491708|ref|ZP_02031334.1| hypothetical protein PARMER_01319 [Parabacteroides merdae ATCC
          43184]
 gi|255016568|ref|ZP_05288694.1| 30S ribosomal protein S18 [Bacteroides sp. 2_1_7]
 gi|256842194|ref|ZP_05547698.1| ribosomal protein S18 [Parabacteroides sp. D13]
 gi|262384879|ref|ZP_06078011.1| 30S ribosomal protein S18 [Bacteroides sp. 2_1_33B]
 gi|298377641|ref|ZP_06987592.1| ribosomal protein S18 [Bacteroides sp. 3_1_19]
 gi|301308939|ref|ZP_07214884.1| ribosomal protein S18 [Bacteroides sp. 20_3]
 gi|205616305|sp|A6LIX8|RS18_PARD8 RecName: Full=30S ribosomal protein S18
 gi|149938945|gb|ABR45642.1| 30S ribosomal protein S18 [Parabacteroides distasonis ATCC 8503]
 gi|154087949|gb|EDN86994.1| hypothetical protein PARMER_01319 [Parabacteroides merdae ATCC
          43184]
 gi|256736078|gb|EEU49408.1| ribosomal protein S18 [Parabacteroides sp. D13]
 gi|262293595|gb|EEY81531.1| 30S ribosomal protein S18 [Bacteroides sp. 2_1_33B]
 gi|298265344|gb|EFI07006.1| ribosomal protein S18 [Bacteroides sp. 3_1_19]
 gi|300832965|gb|EFK63590.1| ribosomal protein S18 [Bacteroides sp. 20_3]
          Length = 89

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVT 85


>gi|333029249|ref|ZP_08457310.1| 30S ribosomal protein S18 [Bacteroides coprosuis DSM 18011]
 gi|332739846|gb|EGJ70328.1| 30S ribosomal protein S18 [Bacteroides coprosuis DSM 18011]
          Length = 90

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVT 86


>gi|332665254|ref|YP_004448042.1| 30S ribosomal protein S18 [Haliscomenobacter hydrossis DSM 1100]
 gi|332334068|gb|AEE51169.1| 30S ribosomal protein S18 [Haliscomenobacter hydrossis DSM 1100]
          Length = 88

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
           +R+K C     G   IDYKD   L +F++++GKI+P RI+  S K QR++A A+KRAR+
Sbjct: 17 QNRKKYCRFRKFGIKYIDYKDGDFLLQFINEQGKILPRRITGNSLKYQRKVATAVKRARH 76

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 77 LALLPYV 83


>gi|167747438|ref|ZP_02419565.1| hypothetical protein ANACAC_02158 [Anaerostipes caccae DSM 14662]
 gi|317471167|ref|ZP_07930538.1| ribosomal protein S18 [Anaerostipes sp. 3_2_56FAA]
 gi|167652800|gb|EDR96929.1| hypothetical protein ANACAC_02158 [Anaerostipes caccae DSM 14662]
 gi|316901382|gb|EFV23325.1| ribosomal protein S18 [Anaerostipes sp. 3_2_56FAA]
          Length = 84

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 39/64 (60%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C    +    IDYKD+  L +++S+RGKI+P RI+    K QR +  AIKRAR+L L+
Sbjct: 20 KVCAFCTEADAVIDYKDVATLKKYVSERGKILPRRITGTCAKHQRAVTSAIKRARHLALM 79

Query: 79 AYVN 82
           Y  
Sbjct: 80 PYTQ 83


>gi|304438788|ref|ZP_07398715.1| 30S ribosomal protein S18 [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372711|gb|EFM26290.1| 30S ribosomal protein S18 [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 74

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 43/71 (60%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++R    RRK C         IDYKD + L RF+S++GKI+P R++    K QRE+  AI
Sbjct: 1  MQRRFRSRRKVCAFCQDPNKVIDYKDSQSLRRFISEKGKILPRRVTGSCAKHQREVTSAI 60

Query: 70 KRARYLGLIAY 80
          KRAR + L+ Y
Sbjct: 61 KRARQIALLPY 71


>gi|94263201|ref|ZP_01287018.1| Ribosomal protein S18 [delta proteobacterium MLMS-1]
 gi|94270367|ref|ZP_01291725.1| Ribosomal protein S18 [delta proteobacterium MLMS-1]
 gi|93450833|gb|EAT01866.1| Ribosomal protein S18 [delta proteobacterium MLMS-1]
 gi|93456419|gb|EAT06539.1| Ribosomal protein S18 [delta proteobacterium MLMS-1]
          Length = 78

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + R+    RRK C      +  IDYKDI+ L  FL++RGKI+P RI     + QR+L +A
Sbjct: 1  MQRKKFFGRRKVCRFCADKSLVIDYKDIKNLRGFLTERGKIIPRRIYGNCARHQRQLCEA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR + L+ Y
Sbjct: 61 IKRARQIALLPY 72


>gi|170016529|ref|YP_001727448.1| ribosomal protein S18 [Leuconostoc citreum KM20]
 gi|326693086|ref|ZP_08230091.1| 30S ribosomal protein S18 [Leuconostoc argentinum KCTC 3773]
 gi|229560045|sp|B1MWV2|RS18_LEUCK RecName: Full=30S ribosomal protein S18
 gi|169803386|gb|ACA82004.1| Ribosomal protein S18 [Leuconostoc citreum KM20]
          Length = 94

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYK+  LL RF+S+RGKI+P R++  S K QR++  AIKRAR + L+ +V
Sbjct: 41 IDYKNTELLERFISERGKILPRRVTGTSAKNQRKVTTAIKRARIMALLPFV 91


>gi|116619041|ref|YP_819412.1| SSU ribosomal protein S18P [Leuconostoc mesenteroides subsp.
          mesenteroides ATCC 8293]
 gi|122270759|sp|Q03UT3|RS18_LEUMM RecName: Full=30S ribosomal protein S18
 gi|116097888|gb|ABJ63039.1| SSU ribosomal protein S18P [Leuconostoc mesenteroides subsp.
          mesenteroides ATCC 8293]
          Length = 94

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYK+  LL RF+S+RGKI+P R++  S K QR++  AIKRAR + L+ +V
Sbjct: 41 IDYKNTELLERFISERGKILPRRVTGTSAKNQRKVTTAIKRARIMALLPFV 91


>gi|222054669|ref|YP_002537031.1| ribosomal protein S18 [Geobacter sp. FRC-32]
 gi|254812941|sp|B9M5U9|RS18_GEOSF RecName: Full=30S ribosomal protein S18
 gi|221563958|gb|ACM19930.1| ribosomal protein S18 [Geobacter sp. FRC-32]
          Length = 91

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 39/63 (61%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK C         IDYKD R L  F+S+RGKI+P RIS    K QRE+ +AIKRAR +
Sbjct: 20 QRRKVCRFCADKQVTIDYKDPRTLRYFISERGKIIPRRISGNCAKHQREITEAIKRARNI 79

Query: 76 GLI 78
           L+
Sbjct: 80 ALL 82


>gi|254798679|ref|YP_003058300.1| ribosomal protein S18 [Parachlorella kessleri]
 gi|229915627|gb|ACQ90970.1| ribosomal protein S18 [Parachlorella kessleri]
          Length = 105

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 44/58 (75%), Gaps = 2/58 (3%)

Query: 28 APR--IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          APR  +DYK+ +LL +F+S +GKI+P R + ++ K+QR +A AIKRAR  GL+ +VNL
Sbjct: 40 APRYLMDYKNTKLLVKFISPQGKILPRRATGLTAKQQRSMANAIKRARMSGLLPFVNL 97


>gi|118587178|ref|ZP_01544606.1| ribosomal protein S18 [Oenococcus oeni ATCC BAA-1163]
 gi|118432320|gb|EAV39058.1| ribosomal protein S18 [Oenococcus oeni ATCC BAA-1163]
          Length = 106

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 37/51 (72%)

Query: 31  IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
           +DYKD  LL RF++  GKI+P RI+  S K QR++A AIKRAR + L+ +V
Sbjct: 53  VDYKDTELLQRFIADNGKILPRRITGTSSKNQRKIATAIKRARIMALLPFV 103


>gi|313664921|ref|YP_004046792.1| ribosomal protein S18 [Mycoplasma leachii PG50]
 gi|312949974|gb|ADR24570.1| ribosomal protein S18 [Mycoplasma leachii PG50]
          Length = 75

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD+ LL +F+S  G+I+P RI+  S K QR+LA AIKRAR + L+ YV
Sbjct: 23 IDYKDVELLKKFISPNGQILPRRITGTSPKDQRQLALAIKRARQMALLPYV 73


>gi|332830347|gb|EGK02975.1| 30S ribosomal protein S18 [Dysgonomonas gadei ATCC BAA-286]
 gi|332883573|gb|EGK03856.1| 30S ribosomal protein S18 [Dysgonomonas mossii DSM 22836]
          Length = 88

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 29 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVT 84


>gi|322420134|ref|YP_004199357.1| 30S ribosomal protein S18 [Geobacter sp. M18]
 gi|320126521|gb|ADW14081.1| ribosomal protein S18 [Geobacter sp. M18]
          Length = 93

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 39/63 (61%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK C         IDYKD R L  F+S+RGKI+P RIS    K QRE+ +AIKRAR +
Sbjct: 22 QRRKVCRFCADKQVSIDYKDPRTLRYFVSERGKIIPRRISGNCSKHQREITEAIKRARNI 81

Query: 76 GLI 78
           L+
Sbjct: 82 ALL 84


>gi|121605292|ref|YP_982621.1| 30S ribosomal protein S18 [Polaromonas naphthalenivorans CJ2]
 gi|166220969|sp|A1VPX2|RS18_POLNA RecName: Full=30S ribosomal protein S18
 gi|120594261|gb|ABM37700.1| SSU ribosomal protein S18P [Polaromonas naphthalenivorans CJ2]
          Length = 94

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKDI  L  F+S+ GKI+P+R++      QR++  A+KRAR+L 
Sbjct: 24 RKRFCRFTAAGVEEIDYKDIDTLRDFVSENGKIIPARLTGTRAIFQRQINTAVKRARFLA 83

Query: 77 LIAYVN 82
          ++ Y +
Sbjct: 84 MLPYSD 89


>gi|315605480|ref|ZP_07880518.1| 30S ribosomal protein S18 [Actinomyces sp. oral taxon 180 str.
          F0310]
 gi|315312826|gb|EFU60905.1| 30S ribosomal protein S18 [Actinomyces sp. oral taxon 180 str.
          F0310]
          Length = 80

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (66%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          RN   ++K+ PL      +IDYKD  LL +F+S RGKI   R++ VS ++QR++A+A+K 
Sbjct: 7  RNKPIKKKANPLKSAKIDKIDYKDTALLRKFISDRGKIRARRVTGVSTQEQRKIARAVKN 66

Query: 72 ARYLGLIAY 80
          AR + L+ Y
Sbjct: 67 AREMALLPY 75


>gi|26991556|ref|NP_746981.1| 30S ribosomal protein S18 [Pseudomonas putida KT2440]
 gi|104783859|ref|YP_610357.1| 30S ribosomal protein S18 [Pseudomonas entomophila L48]
 gi|148549959|ref|YP_001270061.1| 30S ribosomal protein S18 [Pseudomonas putida F1]
 gi|167035922|ref|YP_001671153.1| 30S ribosomal protein S18 [Pseudomonas putida GB-1]
 gi|170723828|ref|YP_001751516.1| 30S ribosomal protein S18 [Pseudomonas putida W619]
 gi|325271216|ref|ZP_08137761.1| 30S ribosomal protein S18 [Pseudomonas sp. TJI-51]
 gi|38258490|sp|Q88DE9|RS18_PSEPK RecName: Full=30S ribosomal protein S18
 gi|122985731|sp|Q1I462|RS18_PSEE4 RecName: Full=30S ribosomal protein S18
 gi|166220977|sp|A5W9R7|RS18_PSEP1 RecName: Full=30S ribosomal protein S18
 gi|189029684|sp|B0KKY2|RS18_PSEPG RecName: Full=30S ribosomal protein S18
 gi|229560054|sp|B1JAH0|RS18_PSEPW RecName: Full=30S ribosomal protein S18
 gi|24986641|gb|AAN70445.1|AE016685_10 ribosomal protein S18 [Pseudomonas putida KT2440]
 gi|95112846|emb|CAK17574.1| 30S ribosomal protein S18 [Pseudomonas entomophila L48]
 gi|148514017|gb|ABQ80877.1| SSU ribosomal protein S18P [Pseudomonas putida F1]
 gi|166862410|gb|ABZ00818.1| ribosomal protein S18 [Pseudomonas putida GB-1]
 gi|169761831|gb|ACA75147.1| ribosomal protein S18 [Pseudomonas putida W619]
 gi|313500860|gb|ADR62226.1| RpsR [Pseudomonas putida BIRD-1]
 gi|324103619|gb|EGC00921.1| 30S ribosomal protein S18 [Pseudomonas sp. TJI-51]
          Length = 76

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 40/59 (67%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +    ID+KD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRAR+L L+ Y +
Sbjct: 14 TAEDVKEIDFKDLNTLKAYVSETGKIVPSRITGTKARYQRQLATAIKRARFLALLPYTD 72


>gi|302870697|ref|YP_003839334.1| 30S ribosomal protein S18 [Micromonospora aurantiaca ATCC 27029]
 gi|315506934|ref|YP_004085821.1| ribosomal protein s18 [Micromonospora sp. L5]
 gi|302573556|gb|ADL49758.1| ribosomal protein S18 [Micromonospora aurantiaca ATCC 27029]
 gi|315413553|gb|ADU11670.1| ribosomal protein S18 [Micromonospora sp. L5]
          Length = 79

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K  PL   G   IDYKD  LL +F+S RGKI   R++ V+ ++QR++A+A+K AR + 
Sbjct: 11 KKKVNPLDKDGITYIDYKDTALLRKFISDRGKIRARRVTGVTSQQQRQIARAVKNAREMA 70

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 71 LLPYT 75


>gi|257065460|ref|YP_003145132.1| SSU ribosomal protein S18P [Slackia heliotrinireducens DSM 20476]
 gi|256793113|gb|ACV23783.1| SSU ribosomal protein S18P [Slackia heliotrinireducens DSM 20476]
          Length = 86

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 8/81 (9%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MAE +  P        RRK C         +DYKD  LL ++++ RGKI P R++    +
Sbjct: 1  MAEYSKQP--------RRKYCQFCKDDTEYVDYKDTALLRKYMTDRGKIKPRRVTGACVQ 52

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QR++A AIK AR +GL+ Y 
Sbjct: 53 HQRDVANAIKNAREMGLMPYT 73


>gi|225571308|ref|ZP_03780304.1| hypothetical protein CLOHYLEM_07406 [Clostridium hylemonae DSM
          15053]
 gi|225159784|gb|EEG72403.1| hypothetical protein CLOHYLEM_07406 [Clostridium hylemonae DSM
          15053]
          Length = 88

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 40/61 (65%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AIKRAR++ ++ Y
Sbjct: 26 CVFCGKENNEIDYKDVAKLRKYISERGKILPRRITGNCAKHQRALTVAIKRARHIAIMPY 85

Query: 81 V 81
          V
Sbjct: 86 V 86


>gi|121595517|ref|YP_987413.1| 30S ribosomal protein S18 [Acidovorax sp. JS42]
 gi|222111738|ref|YP_002554002.1| 30S ribosomal protein s18 [Acidovorax ebreus TPSY]
 gi|166220919|sp|A1WAR2|RS18_ACISJ RecName: Full=30S ribosomal protein S18
 gi|254765424|sp|B9MDJ3|RS18_DIAST RecName: Full=30S ribosomal protein S18
 gi|120607597|gb|ABM43337.1| SSU ribosomal protein S18P [Acidovorax sp. JS42]
 gi|221731182|gb|ACM34002.1| ribosomal protein S18 [Acidovorax ebreus TPSY]
          Length = 93

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKD+  L  F+++ GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 24 RKRFCRFTVAGVEEIDYKDVDTLRDFIAENGKIIPARLTGTRAIYQRQLNTAIKRARFLA 83

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 84 LLPYSD 89


>gi|153956490|ref|YP_001397255.1| 30S ribosomal protein S18 [Clostridium kluyveri DSM 555]
 gi|219856793|ref|YP_002473915.1| hypothetical protein CKR_3450 [Clostridium kluyveri NBRC 12016]
 gi|189029673|sp|A5N438|RS18_CLOK5 RecName: Full=30S ribosomal protein S18
 gi|254765422|sp|B9DXQ8|RS18_CLOK1 RecName: Full=30S ribosomal protein S18
 gi|146349348|gb|EDK35884.1| RpsR [Clostridium kluyveri DSM 555]
 gi|219570517|dbj|BAH08501.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 84

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK C      +  IDYKDI  L +++++RGKI+P RIS    K QREL +AIKRAR + 
Sbjct: 18 KRKVCAFCMDKSEFIDYKDINKLRKYVTERGKILPRRISGNCAKHQRELTRAIKRARNIA 77

Query: 77 LIAYV 81
          L+ + 
Sbjct: 78 LLPFT 82


>gi|221068653|ref|ZP_03544758.1| ribosomal protein S18 [Comamonas testosteroni KF-1]
 gi|264677151|ref|YP_003277057.1| ribosomal protein S18 [Comamonas testosteroni CNB-2]
 gi|299530695|ref|ZP_07044110.1| 30S ribosomal protein S18 [Comamonas testosteroni S44]
 gi|220713676|gb|EED69044.1| ribosomal protein S18 [Comamonas testosteroni KF-1]
 gi|262207663|gb|ACY31761.1| ribosomal protein S18 [Comamonas testosteroni CNB-2]
 gi|298721211|gb|EFI62153.1| 30S ribosomal protein S18 [Comamonas testosteroni S44]
          Length = 93

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKD+  L  F+++ GKIVP+R++      QR+L  AIKRAR+L 
Sbjct: 24 RKRFCRFTVAGVEEIDYKDVDTLRDFIAENGKIVPARLTGTRAIYQRQLNTAIKRARFLA 83

Query: 77 LIAYVN 82
          ++ Y +
Sbjct: 84 MLPYSD 89


>gi|116490138|ref|YP_809667.1| SSU ribosomal protein S18P [Oenococcus oeni PSU-1]
 gi|290889532|ref|ZP_06552622.1| hypothetical protein AWRIB429_0012 [Oenococcus oeni AWRIB429]
 gi|122277671|sp|Q04HQ5|RS18_OENOB RecName: Full=30S ribosomal protein S18
 gi|116090863|gb|ABJ56017.1| SSU ribosomal protein S18P [Oenococcus oeni PSU-1]
 gi|290480730|gb|EFD89364.1| hypothetical protein AWRIB429_0012 [Oenococcus oeni AWRIB429]
          Length = 106

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 37/51 (72%)

Query: 31  IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
           +DYKD  LL RF++  GKI+P RI+  S K QR++A AIKRAR + L+ +V
Sbjct: 53  VDYKDTELLQRFIADNGKILPRRITGTSSKNQRKIATAIKRARIMALLPFV 103


>gi|302877153|ref|YP_003845786.1| 30S ribosomal protein S18 [Clostridium cellulovorans 743B]
 gi|307687852|ref|ZP_07630298.1| 30S ribosomal protein S18 [Clostridium cellulovorans 743B]
 gi|302580010|gb|ADL54022.1| ribosomal protein S18 [Clostridium cellulovorans 743B]
          Length = 85

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C    +    IDYKD+  L +++++RGKI+P RIS    K QREL  +IKRAR + 
Sbjct: 19 RKKVCAFCSEKVEAIDYKDVNRLRKYVTERGKILPRRISGTCAKHQRELTGSIKRARNIA 78

Query: 77 LIAYV 81
          L+ + 
Sbjct: 79 LLPFT 83


>gi|313205958|ref|YP_004045135.1| SSU ribosomal protein s18p [Riemerella anatipestifer DSM 15868]
 gi|312445274|gb|ADQ81629.1| SSU ribosomal protein S18P [Riemerella anatipestifer DSM 15868]
 gi|315022271|gb|EFT35299.1| SSU ribosomal protein S18p [Riemerella anatipestifer RA-YM]
 gi|325336603|gb|ADZ12877.1| Ribosomal protein S18 [Riemerella anatipestifer RA-GD]
          Length = 100

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL   N    +K C     G   +DYKD   L +F++++GKI+P R +  S K QR+++
Sbjct: 22 TPL-DINTKSEKKYCRFKKYGIKYVDYKDADFLLQFVNEQGKILPRRYTGTSLKYQRKVS 80

Query: 67 KAIKRARYLGLIAYV 81
           AIKRAR+L L+ YV
Sbjct: 81 AAIKRARHLALMPYV 95


>gi|110746771|gb|ABG89277.1| ribosomal protein S18 [Paenibacillus larvae]
          Length = 75

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +      IDYKDI  L +F+S+RGKI+P R++  S K QR L  AIKRAR + L+ Y
Sbjct: 13 CYFTANKIKHIDYKDIDTLKKFISERGKILPRRVTGTSAKYQRMLTIAIKRARQVALLPY 72

Query: 81 VN 82
            
Sbjct: 73 TT 74


>gi|257070269|ref|YP_003156524.1| 30S ribosomal protein S18 [Brachybacterium faecium DSM 4810]
 gi|256561087|gb|ACU86934.1| SSU ribosomal protein S18P [Brachybacterium faecium DSM 4810]
          Length = 78

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (65%), Gaps = 3/73 (4%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P+LR+    ++K  PL   G   +DYKD  LL +F+S RGKI   R++ V+ ++QR++AK
Sbjct: 4  PVLRK---PKKKQNPLKAAGLETVDYKDAALLRKFISDRGKIRARRVTGVTVQEQRKIAK 60

Query: 68 AIKRARYLGLIAY 80
          A+K AR + L+ Y
Sbjct: 61 AVKNAREIALLPY 73


>gi|212715366|ref|ZP_03323494.1| hypothetical protein BIFCAT_00260 [Bifidobacterium catenulatum
          DSM 16992]
 gi|225352542|ref|ZP_03743565.1| hypothetical protein BIFPSEUDO_04165 [Bifidobacterium
          pseudocatenulatum DSM 20438]
 gi|212661672|gb|EEB22247.1| hypothetical protein BIFCAT_00260 [Bifidobacterium catenulatum
          DSM 16992]
 gi|225156736|gb|EEG70130.1| hypothetical protein BIFPSEUDO_04165 [Bifidobacterium
          pseudocatenulatum DSM 20438]
          Length = 82

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 38/52 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD+ LL +F+S RGKI   RI+ VS ++QRELAKAIK AR + L+ Y  
Sbjct: 28 IDYKDVALLRKFISDRGKIRSRRITGVSVQEQRELAKAIKNAREMALLPYAT 79


>gi|139439449|ref|ZP_01772890.1| Hypothetical protein COLAER_01910 [Collinsella aerofaciens ATCC
          25986]
 gi|133775228|gb|EBA39048.1| Hypothetical protein COLAER_01910 [Collinsella aerofaciens ATCC
          25986]
          Length = 88

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C    +    IDYKD +LL ++++ RGKI P R++    + Q ++A AIKRAR + 
Sbjct: 11 RRKYCQFCKENTEFIDYKDTQLLRKYMTDRGKIKPRRVTGACTQHQHDIANAIKRAREMA 70

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 71 LLPYT 75


>gi|29347572|ref|NP_811075.1| 30S ribosomal protein S18 [Bacteroides thetaiotaomicron VPI-5482]
 gi|253572032|ref|ZP_04849436.1| 30S ribosomal protein S18 [Bacteroides sp. 1_1_6]
 gi|298383735|ref|ZP_06993296.1| ribosomal protein S18 [Bacteroides sp. 1_1_14]
 gi|59798897|sp|Q8A5S6|RS18_BACTN RecName: Full=30S ribosomal protein S18
 gi|29339473|gb|AAO77269.1| 30S ribosomal protein S18 [Bacteroides thetaiotaomicron VPI-5482]
 gi|251838212|gb|EES66299.1| 30S ribosomal protein S18 [Bacteroides sp. 1_1_6]
 gi|298263339|gb|EFI06202.1| ribosomal protein S18 [Bacteroides sp. 1_1_14]
          Length = 90

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 39/52 (75%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 35 IDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPYVT 86


>gi|226323516|ref|ZP_03799034.1| hypothetical protein COPCOM_01291 [Coprococcus comes ATCC 27758]
 gi|225208200|gb|EEG90554.1| hypothetical protein COPCOM_01291 [Coprococcus comes ATCC 27758]
          Length = 87

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   GK    IDYKD   L +++S+RGKI+P RI+    K QR L  AIKRAR++ L+ Y
Sbjct: 25 CVFCGKENNEIDYKDTAKLKKYVSERGKILPRRITGNCAKHQRALTVAIKRARHIALMPY 84

Query: 81 V 81
          V
Sbjct: 85 V 85


>gi|159040547|ref|YP_001539800.1| 30S ribosomal protein S18 [Salinispora arenicola CNS-205]
 gi|238061877|ref|ZP_04606586.1| 30S ribosomal protein S18 [Micromonospora sp. ATCC 39149]
 gi|330470800|ref|YP_004408543.1| 30S ribosomal protein S18 [Verrucosispora maris AB-18-032]
 gi|205617156|sp|A8LXG1|RS18_SALAI RecName: Full=30S ribosomal protein S18
 gi|157919382|gb|ABW00810.1| ribosomal protein S18 [Salinispora arenicola CNS-205]
 gi|237883688|gb|EEP72516.1| 30S ribosomal protein S18 [Micromonospora sp. ATCC 39149]
 gi|328813771|gb|AEB47943.1| 30S ribosomal protein S18 [Verrucosispora maris AB-18-032]
          Length = 79

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K  PL   G   IDYKD  LL +F+S RGKI   R++ V+ ++QR++A+A+K AR + 
Sbjct: 11 KKKVNPLDKDGITYIDYKDTALLRKFISDRGKIRARRVTGVTSQQQRQIARAVKNAREMA 70

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 71 LLPYT 75


>gi|299135703|ref|ZP_07028887.1| ribosomal protein S18 [Acidobacterium sp. MP5ACTX8]
 gi|298601827|gb|EFI57981.1| ribosomal protein S18 [Acidobacterium sp. MP5ACTX8]
          Length = 124

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 43/65 (66%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           R+K C  + +    I Y+D+RLL +F+S RGKI+P R++  S   QR+L KAIK+AR + 
Sbjct: 57  RKKVCKFTVEKIDTISYRDVRLLQQFVSDRGKIIPRRLTGTSAPFQRKLTKAIKQARAIA 116

Query: 77  LIAYV 81
           L+ Y 
Sbjct: 117 LLPYA 121


>gi|83319872|ref|YP_424024.1| 30S ribosomal protein S18 [Mycoplasma capricolum subsp.
          capricolum ATCC 27343]
 gi|123726538|sp|Q2ST89|RS18_MYCCT RecName: Full=30S ribosomal protein S18
 gi|83283758|gb|ABC01690.1| 30S ribosomal protein S18 [Mycoplasma capricolum subsp.
          capricolum ATCC 27343]
          Length = 75

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD+ LL +F+S  G+I+P RI+  S K QR+LA AIKRAR + L+ YV
Sbjct: 23 IDYKDVELLKKFISPNGQILPRRITGTSLKDQRQLALAIKRARQMALLPYV 73


>gi|325279432|ref|YP_004251974.1| 30S ribosomal protein S18 [Odoribacter splanchnicus DSM 20712]
 gi|324311241|gb|ADY31794.1| 30S ribosomal protein S18 [Odoribacter splanchnicus DSM 20712]
          Length = 89

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K C         IDYKD   L +FL+++GKI+P RI+  S K QR++A A+KRAR+L 
Sbjct: 20 KKKYCRFRKARIKFIDYKDPEFLKKFLNEQGKILPRRITGTSVKFQRKVATAVKRARHLA 79

Query: 77 LIAYVN 82
          L+ YV 
Sbjct: 80 LLPYVT 85


>gi|148265697|ref|YP_001232403.1| 30S ribosomal protein S18 [Geobacter uraniireducens Rf4]
 gi|189029678|sp|A5G7R2|RS18_GEOUR RecName: Full=30S ribosomal protein S18
 gi|146399197|gb|ABQ27830.1| SSU ribosomal protein S18P [Geobacter uraniireducens Rf4]
          Length = 91

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 39/63 (61%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK C         IDYKD R L  F+S+RGKI+P RIS    K QRE+ +AIKRAR +
Sbjct: 20 QRRKVCRFCADKQVSIDYKDPRTLRYFISERGKIIPRRISGNCAKHQREITEAIKRARNI 79

Query: 76 GLI 78
           L+
Sbjct: 80 ALL 82


>gi|317506809|ref|ZP_07964583.1| ribosomal protein S18 [Segniliparus rugosus ATCC BAA-974]
 gi|316254883|gb|EFV14179.1| ribosomal protein S18 [Segniliparus rugosus ATCC BAA-974]
          Length = 83

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 48/82 (58%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA   P   LR     + K  PL  +G   +DYKD  LL  F+S+RGKI   R++ ++ +
Sbjct: 1  MARKPPVKKLRVAEIRKPKKNPLKAQGVEHVDYKDTNLLRTFISERGKIRSRRVTGLTPR 60

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
          +QR++A A+K AR + L+ + N
Sbjct: 61 QQRDVAVAVKNAREMALLPFTN 82


>gi|266620038|ref|ZP_06112973.1| ribosomal protein S18 [Clostridium hathewayi DSM 13479]
 gi|288868399|gb|EFD00698.1| ribosomal protein S18 [Clostridium hathewayi DSM 13479]
          Length = 88

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   G+    IDYKD+  L R++S+RGKI+P RI+    K QR L  AIKRAR++ L+ Y
Sbjct: 26 CVFCGEKNGTIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHIALMPY 85

Query: 81 V 81
           
Sbjct: 86 T 86


>gi|164686462|ref|ZP_02210490.1| hypothetical protein CLOBAR_00027 [Clostridium bartlettii DSM
          16795]
 gi|164604473|gb|EDQ97938.1| hypothetical protein CLOBAR_00027 [Clostridium bartlettii DSM
          16795]
          Length = 75

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 38/61 (62%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C        RIDYK+ + L +++++RGKI+P RIS    K QREL  AIKRAR L L+ Y
Sbjct: 13 CQFCASKDARIDYKNTQRLQKYITERGKILPRRISGTCAKHQRELTVAIKRARNLALLPY 72

Query: 81 V 81
           
Sbjct: 73 T 73


>gi|50364897|ref|YP_053322.1| 30S ribosomal protein S18 [Mesoplasma florum L1]
 gi|59798695|sp|Q6F235|RS18_MESFL RecName: Full=30S ribosomal protein S18
 gi|50363453|gb|AAT75438.1| 30S ribosomal protein S18 [Mesoplasma florum L1]
          Length = 76

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD+ LL +F+S  G+I+P RI+  S K QR+LA AIKRAR + L+ YV
Sbjct: 24 IDYKDVELLKKFISGNGQILPRRITGTSPKHQRQLAVAIKRARQMALLPYV 74


>gi|225850831|ref|YP_002731065.1| ribosomal protein S18 [Persephonella marina EX-H1]
 gi|225646076|gb|ACO04262.1| ribosomal protein S18 [Persephonella marina EX-H1]
          Length = 84

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          +PT   +     R+K C    +G    +YKD   L +F+S+RGKI+P RIS    K QR+
Sbjct: 7  SPTAQNKPFFQKRKKYCKFCAEGK-EPNYKDTEYLKQFISERGKIIPRRISGTCGKHQRK 65

Query: 65 LAKAIKRARYLGLIAYV 81
          L   IKRAR L L+ YV
Sbjct: 66 LTVEIKRARQLALLPYV 82


>gi|160885186|ref|ZP_02066189.1| hypothetical protein BACOVA_03184 [Bacteroides ovatus ATCC 8483]
 gi|237714853|ref|ZP_04545334.1| 30S ribosomal protein S18 [Bacteroides sp. D1]
 gi|237719993|ref|ZP_04550474.1| 30S ribosomal protein S18 [Bacteroides sp. 2_2_4]
 gi|260174162|ref|ZP_05760574.1| 30S ribosomal protein S18 [Bacteroides sp. D2]
 gi|262406876|ref|ZP_06083425.1| ribosomal protein S18 [Bacteroides sp. 2_1_22]
 gi|294647156|ref|ZP_06724755.1| ribosomal protein S18 [Bacteroides ovatus SD CC 2a]
 gi|294809233|ref|ZP_06767949.1| ribosomal protein S18 [Bacteroides xylanisolvens SD CC 1b]
 gi|299147873|ref|ZP_07040936.1| ribosomal protein S18 [Bacteroides sp. 3_1_23]
 gi|315922427|ref|ZP_07918667.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156109536|gb|EDO11281.1| hypothetical protein BACOVA_03184 [Bacteroides ovatus ATCC 8483]
 gi|229445178|gb|EEO50969.1| 30S ribosomal protein S18 [Bacteroides sp. D1]
 gi|229450545|gb|EEO56336.1| 30S ribosomal protein S18 [Bacteroides sp. 2_2_4]
 gi|262355579|gb|EEZ04670.1| ribosomal protein S18 [Bacteroides sp. 2_1_22]
 gi|292637443|gb|EFF55862.1| ribosomal protein S18 [Bacteroides ovatus SD CC 2a]
 gi|294443627|gb|EFG12378.1| ribosomal protein S18 [Bacteroides xylanisolvens SD CC 1b]
 gi|295084750|emb|CBK66273.1| SSU ribosomal protein S18P [Bacteroides xylanisolvens XB1A]
 gi|298514056|gb|EFI37942.1| ribosomal protein S18 [Bacteroides sp. 3_1_23]
 gi|313696302|gb|EFS33137.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 90

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 31 GIRYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPYVT 86


>gi|153855507|ref|ZP_01996626.1| hypothetical protein DORLON_02640 [Dorea longicatena DSM 13814]
 gi|149752029|gb|EDM61960.1| hypothetical protein DORLON_02640 [Dorea longicatena DSM 13814]
          Length = 88

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   GK    IDYKD   L +++S+RGKI+P RI+    K QR L  AIKRAR++ L+ Y
Sbjct: 26 CVFCGKENNEIDYKDTAKLRKYISERGKILPRRITGNCAKHQRALTVAIKRARHIALMPY 85

Query: 81 V 81
          V
Sbjct: 86 V 86


>gi|284047347|ref|YP_003397687.1| ribosomal protein S18 [Conexibacter woesei DSM 14684]
 gi|283951568|gb|ADB54312.1| ribosomal protein S18 [Conexibacter woesei DSM 14684]
          Length = 108

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (65%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S RRK CP   +   ++D+KDI  L +F+S+RGKI   RI+    + Q ++++A+KRAR 
Sbjct: 20 SSRRKPCPYCKEKVDQVDWKDIGSLRKFVSERGKIRSRRITGACRRHQNQVSRAVKRARE 79

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 80 LALLPYV 86


>gi|90994447|ref|YP_536937.1| ribosomal protein S18 [Porphyra yezoensis]
 gi|122238242|sp|Q1XDN1|RR18_PORYE RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|90819011|dbj|BAE92380.1| 30S ribosomal protein S18 [Porphyra yezoensis]
          Length = 70

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 48/67 (71%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R +  P+    A  +DYKDI LL +F++++GKI+P R + ++ K+Q++L KAIK+AR L
Sbjct: 4  YRNRISPIKPTDA--VDYKDIDLLRKFITEQGKILPKRSTGLTSKQQKKLTKAIKQARIL 61

Query: 76 GLIAYVN 82
           L+ ++N
Sbjct: 62 SLLPFLN 68


>gi|296111019|ref|YP_003621400.1| 30S ribosomal protein S18 [Leuconostoc kimchii IMSNU 11154]
 gi|295832550|gb|ADG40431.1| 30S ribosomal protein S18 [Leuconostoc kimchii IMSNU 11154]
          Length = 94

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYK+  LL RF+S+RGKI+P R++  S K QR++  A+KRAR + L+ +V
Sbjct: 41 IDYKNTELLERFISERGKILPRRVTGTSAKNQRKVTTAVKRARIMALLPFV 91


>gi|226968550|ref|YP_002808503.1| small subunit ribosomal protein S18 [Micromonas pusilla CCMP1545]
 gi|226348845|gb|ACO50748.1| small subunit ribosomal protein S18 [Micromonas pusilla CCMP1545]
          Length = 70

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 51/69 (73%), Gaps = 3/69 (4%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
          N+S +R S    G+    I+YK++ LL RF++++GKI+P R++ V+ K+QR+LA+A+K+A
Sbjct: 2  NLSRQRTSPINEGEI---INYKNVDLLRRFITEQGKILPRRLTGVTAKQQRQLARAVKQA 58

Query: 73 RYLGLIAYV 81
          R LG + ++
Sbjct: 59 RILGFLQFL 67


>gi|229816198|ref|ZP_04446508.1| hypothetical protein COLINT_03245 [Collinsella intestinalis DSM
          13280]
 gi|229808206|gb|EEP43998.1| hypothetical protein COLINT_03245 [Collinsella intestinalis DSM
          13280]
          Length = 88

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C    +    IDYKD +LL ++++ RGKI P R++    + Q ++A AIKRAR + 
Sbjct: 11 RRKYCQFCKENTEFIDYKDTQLLRKYMTDRGKIKPRRVTGACTQHQHDIANAIKRAREMA 70

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 71 LLPYA 75


>gi|39995772|ref|NP_951723.1| 30S ribosomal protein S18 [Geobacter sulfurreducens PCA]
 gi|59798802|sp|Q74FE3|RS18_GEOSL RecName: Full=30S ribosomal protein S18
 gi|39982536|gb|AAR33996.1| ribosomal protein S18 [Geobacter sulfurreducens PCA]
 gi|307634729|gb|ADI83505.2| ribosomal protein S18 [Geobacter sulfurreducens KN400]
          Length = 103

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 39/63 (61%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK C         IDYKD R+L  F+++RGKIVP RIS      QRE+ +AIKRAR +
Sbjct: 32 QRRKVCRFCADKTLVIDYKDPRVLRSFITERGKIVPRRISGNCSAHQREITEAIKRARNI 91

Query: 76 GLI 78
           LI
Sbjct: 92 ALI 94


>gi|237745856|ref|ZP_04576336.1| 30S ribosomal protein S18 [Oxalobacter formigenes HOxBLS]
 gi|229377207|gb|EEO27298.1| 30S ribosomal protein S18 [Oxalobacter formigenes HOxBLS]
          Length = 94

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C  +     +IDYKDI  L  F+ +  KI+P+R++      QR+L  AIKRAR+L 
Sbjct: 25 RKKFCRFTVANVEQIDYKDIDTLKDFIQENCKIMPARLTGTKAHYQRQLDTAIKRARFLA 84

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 85 LLPYTSL 91


>gi|188997592|ref|YP_001931843.1| ribosomal protein S18 [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932659|gb|ACD67289.1| ribosomal protein S18 [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 79

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 17 RRKSCPLSG-KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          R+K C     K  P  +YKDI  L  F+S+RGKI PSRIS    K QR+L+  IK+AR L
Sbjct: 14 RKKYCKFCAEKKEP--NYKDIETLKEFISERGKITPSRISGTCAKHQRKLSVEIKKARQL 71

Query: 76 GLIAYV 81
           LI YV
Sbjct: 72 ALIPYV 77


>gi|312131694|ref|YP_003999034.1| ssu ribosomal protein s18p [Leadbetterella byssophila DSM 17132]
 gi|311908240|gb|ADQ18681.1| SSU ribosomal protein S18P [Leadbetterella byssophila DSM 17132]
          Length = 84

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R   +R+K C     G   +DYKD   L +FL+++GKI+P R++  S K QR +A A+
Sbjct: 8  VERKEQNRKKYCRFKKLGIKYVDYKDPNFLLKFLNEQGKILPRRLTGNSLKFQRRVAIAV 67

Query: 70 KRARYLGLIAYV 81
          KRAR+L L+ YV
Sbjct: 68 KRARHLALLPYV 79


>gi|253581023|ref|ZP_04858284.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847686|gb|EES75655.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 87

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 40/61 (65%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AIKRAR++ ++ Y
Sbjct: 25 CVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQRALTVAIKRARHMSMMPY 84

Query: 81 V 81
          +
Sbjct: 85 I 85


>gi|229915540|gb|ACQ90884.1| ribosomal protein S18 [Pedinomonas minor]
          Length = 79

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 42/53 (79%)

Query: 30 RIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          RIDYK++ LL +F++  GKI+P R++S++ K+ R ++KAIK AR +GL+ +VN
Sbjct: 24 RIDYKNVLLLRKFITIEGKILPRRLTSLTAKQHRSISKAIKNARMMGLLPFVN 76


>gi|227432792|ref|ZP_03914755.1| SSU ribosomal protein S18P [Leuconostoc mesenteroides subsp.
          cremoris ATCC 19254]
 gi|227351461|gb|EEJ41724.1| SSU ribosomal protein S18P [Leuconostoc mesenteroides subsp.
          cremoris ATCC 19254]
          Length = 94

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYK+  LL RF+S+RGKI+P R++  S K QR++  AIKRAR + L+ +V
Sbjct: 41 IDYKNTELLERFISERGKILPRRLTGTSAKNQRKVTTAIKRARIMALLPFV 91


>gi|260219660|emb|CBA26505.1| 30S ribosomal protein S18 [Curvibacter putative symbiont of Hydra
          magnipapillata]
          Length = 93

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKDI  L  F+++ GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 24 RKRFCRFTVTGVEEIDYKDIDTLRDFIAENGKIIPARLTGTRAIFQRQLNTAIKRARFLA 83

Query: 77 LIAYVN 82
          ++ Y +
Sbjct: 84 MLPYSD 89


>gi|255527666|ref|ZP_05394525.1| ribosomal protein S18 [Clostridium carboxidivorans P7]
 gi|296186805|ref|ZP_06855206.1| ribosomal protein S18 [Clostridium carboxidivorans P7]
 gi|255508646|gb|EET85027.1| ribosomal protein S18 [Clostridium carboxidivorans P7]
 gi|296048519|gb|EFG87952.1| ribosomal protein S18 [Clostridium carboxidivorans P7]
          Length = 85

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK C      A  IDYKDI  L +++++RGKI+P RIS    K QR+L  AIKRAR + 
Sbjct: 19 KRKICSFCMDKAESIDYKDINKLRKYVTERGKILPRRISGNCAKHQRQLTDAIKRARNIA 78

Query: 77 LIAYV 81
          L+ + 
Sbjct: 79 LLPFT 83


>gi|229824647|ref|ZP_04450716.1| hypothetical protein GCWU000282_01994 [Catonella morbi ATCC
          51271]
 gi|229786018|gb|EEP22132.1| hypothetical protein GCWU000282_01994 [Catonella morbi ATCC
          51271]
          Length = 81

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C          DYKD+ LL RF+S++GKI+P R++    K QR L  AIKRAR +GL+
Sbjct: 16 KVCFFCANHIDHPDYKDVDLLKRFISEKGKILPRRVTGTCAKHQRALTVAIKRARIMGLL 75

Query: 79 AYV 81
           + 
Sbjct: 76 PFT 78


>gi|313887171|ref|ZP_07820867.1| ribosomal protein S18 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332300447|ref|YP_004442368.1| 30S ribosomal protein S18 [Porphyromonas asaccharolytica DSM
          20707]
 gi|312923400|gb|EFR34213.1| ribosomal protein S18 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332177510|gb|AEE13200.1| 30S ribosomal protein S18 [Porphyromonas asaccharolytica DSM
          20707]
          Length = 88

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           ++K C     G   +DYKD   L +FL+ +GKI+P RI+  S K QR +A+A+KRAR+L
Sbjct: 18 QQKKYCRFKKAGIKYVDYKDPEFLKKFLNDQGKILPRRITGNSLKFQRRVAQAVKRARHL 77

Query: 76 GLIAYVN 82
           L+ +V 
Sbjct: 78 ALLPFVT 84


>gi|86133511|ref|ZP_01052093.1| 30S ribosomal protein S18 [Polaribacter sp. MED152]
 gi|85820374|gb|EAQ41521.1| 30S ribosomal protein S18 [Polaribacter sp. MED152]
          Length = 98

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 42/64 (65%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C    KG   IDYKD   L   ++++GKI+P R++  S K QR++A+AIKRAR+L L+
Sbjct: 31 KYCRFKKKGIKYIDYKDADFLMYLVNEQGKILPRRLTGTSLKYQRKVAQAIKRARHLALM 90

Query: 79 AYVN 82
           YV 
Sbjct: 91 PYVG 94


>gi|290958445|ref|YP_003489627.1| 30S ribosomal protein S18 [Streptomyces scabiei 87.22]
 gi|260647971|emb|CBG71076.1| putative 30S ribosomal protein S18 [Streptomyces scabiei 87.22]
          Length = 77

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 41/61 (67%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          PL       IDYKD  LL RF+S RGKI   R++ VS ++QR+LA+AIK AR + L+ YV
Sbjct: 16 PLDQAKITYIDYKDTDLLRRFISDRGKIRSRRVTRVSAQQQRQLARAIKNAREMALLPYV 75

Query: 82 N 82
          +
Sbjct: 76 S 76


>gi|302553143|ref|ZP_07305485.1| ribosomal protein S18 [Streptomyces viridochromogenes DSM 40736]
 gi|302470761|gb|EFL33854.1| ribosomal protein S18 [Streptomyces viridochromogenes DSM 40736]
          Length = 77

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 41/61 (67%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          PL   G   +DYKD  LL +F+S RGKI   R++ VS ++QR+LA+AIK AR + L+ Y 
Sbjct: 16 PLDQAGITYVDYKDTDLLRKFVSDRGKIRSRRVTRVSSQQQRQLARAIKNAREMALLPYT 75

Query: 82 N 82
          +
Sbjct: 76 S 76


>gi|145597063|ref|YP_001161360.1| 30S ribosomal protein S18 [Salinispora tropica CNB-440]
 gi|205617371|sp|A4XDG6|RS18_SALTO RecName: Full=30S ribosomal protein S18
 gi|145306400|gb|ABP56982.1| SSU ribosomal protein S18P [Salinispora tropica CNB-440]
          Length = 93

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K  PL   G   IDYKD  LL +F+S RGKI   R++ V+ ++QR++A+A+K AR + 
Sbjct: 25 KKKVNPLDKDGITYIDYKDTALLRKFISDRGKIRARRVTGVTSQQQRQIARAVKNAREMA 84

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 85 LLPYT 89


>gi|89900979|ref|YP_523450.1| 30S ribosomal protein S18 [Rhodoferax ferrireducens T118]
 gi|123397182|sp|Q21WD4|RS18_RHOFD RecName: Full=30S ribosomal protein S18
 gi|89345716|gb|ABD69919.1| SSU ribosomal protein S18P [Rhodoferax ferrireducens T118]
          Length = 94

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKDI  L  F+++ GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 25 RKRFCRFTVTGVEEIDYKDIDTLRDFIAENGKIIPARLTGTRAIFQRQLNTAIKRARFLA 84

Query: 77 LIAYVN 82
          ++ Y +
Sbjct: 85 MLPYSD 90


>gi|257458034|ref|ZP_05623193.1| 30S ribosomal protein S18 [Treponema vincentii ATCC 35580]
 gi|257444747|gb|EEV19831.1| 30S ribosomal protein S18 [Treponema vincentii ATCC 35580]
          Length = 103

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 43/65 (66%), Gaps = 1/65 (1%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           R+K C    + A +IDYKD   L RF+++RGKI+P RI+    K QR+LA  IKRAR L 
Sbjct: 38  RKKVCRFCSQKA-KIDYKDPDSLRRFITERGKILPRRITGTCAKHQRKLALEIKRARALA 96

Query: 77  LIAYV 81
           L+ YV
Sbjct: 97  LLPYV 101


>gi|156741510|ref|YP_001431639.1| 30S ribosomal protein S18 [Roseiflexus castenholzii DSM 13941]
 gi|205556478|sp|A7NJF1|RS181_ROSCS RecName: Full=30S ribosomal protein S18 1
 gi|156232838|gb|ABU57621.1| ribosomal protein S18 [Roseiflexus castenholzii DSM 13941]
          Length = 90

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C         +DYKD++ L R +S+RGKI+P R + V  + QR L  AIKRAR++ 
Sbjct: 20 RRKVCAFCADKIRVVDYKDVKRLQRCMSERGKILPRRRTGVCARHQRSLTVAIKRARHMA 79

Query: 77 LIAYV 81
          L+ +V
Sbjct: 80 LLPFV 84


>gi|88803224|ref|ZP_01118750.1| ribosomal protein S18 [Polaribacter irgensii 23-P]
 gi|88780790|gb|EAR11969.1| ribosomal protein S18 [Polaribacter irgensii 23-P]
          Length = 98

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL   +     K C    KG   IDYKD   L   ++++GKI+P R++  S K QR++A
Sbjct: 20 TPL-DIDTKKEAKYCRFKKKGIKYIDYKDADFLMYLVNEQGKILPRRLTGTSLKYQRKVA 78

Query: 67 KAIKRARYLGLIAYVN 82
          +AIKRAR+L L+ YV 
Sbjct: 79 QAIKRARHLALMPYVG 94


>gi|167462797|ref|ZP_02327886.1| 30S ribosomal protein S18 (BS21) [Paenibacillus larvae subsp.
          larvae BRL-230010]
 gi|322381355|ref|ZP_08055358.1| 30S ribosomal protein S18-like protein [Paenibacillus larvae
          subsp. larvae B-3650]
 gi|321154931|gb|EFX47202.1| 30S ribosomal protein S18-like protein [Paenibacillus larvae
          subsp. larvae B-3650]
          Length = 100

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +      IDYKDI  L +F+S+RGKI+P R++  S K QR L  AIKRAR + L+ Y
Sbjct: 38 CYFTANKIKHIDYKDIDTLKKFISERGKILPRRVTGTSAKYQRMLTIAIKRARQVALLPY 97

Query: 81 VN 82
            
Sbjct: 98 TT 99


>gi|20809108|ref|NP_624279.1| 30S ribosomal protein S18 [Thermoanaerobacter tengcongensis MB4]
 gi|23822145|sp|Q8R6M3|RS18_THETN RecName: Full=30S ribosomal protein S18
 gi|20517786|gb|AAM25883.1| Ribosomal protein S18 [Thermoanaerobacter tengcongensis MB4]
          Length = 89

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C        RIDYKD+  L +++++RGKI+P RI+    + QR+L KAIKRAR + L+ Y
Sbjct: 27 CAFCADNIDRIDYKDVARLRKYITERGKILPRRITGNCARHQRQLTKAIKRARQIALLPY 86

Query: 81 V 81
           
Sbjct: 87 T 87


>gi|301632590|ref|XP_002945365.1| PREDICTED: 30S ribosomal protein S18-like [Xenopus (Silurana)
          tropicalis]
          Length = 93

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKD+  L  F+++ GKI+P+R++      QR+L  AIKRAR+L 
Sbjct: 24 RKRFCRFTVAGVEEIDYKDVDTLRDFIAENGKIIPARLTGTRAIYQRQLNTAIKRARFLA 83

Query: 77 LIAYVN 82
          ++ Y +
Sbjct: 84 MLPYSD 89


>gi|116327958|ref|YP_797678.1| 30S ribosomal protein S18 [Leptospira borgpetersenii serovar
          Hardjo-bovis L550]
 gi|116330839|ref|YP_800557.1| 30S ribosomal protein S18 [Leptospira borgpetersenii serovar
          Hardjo-bovis JB197]
 gi|59798774|sp|Q72QK2|RS18_LEPIC RecName: Full=30S ribosomal protein S18
 gi|73920774|sp|Q8F5K4|RS18_LEPIN RecName: Full=30S ribosomal protein S18
 gi|122281407|sp|Q04TH1|RS18_LEPBJ RecName: Full=30S ribosomal protein S18
 gi|122284250|sp|Q052K0|RS18_LEPBL RecName: Full=30S ribosomal protein S18
 gi|45601200|gb|AAS70682.1| 30S ribosomal protein S18 [Leptospira interrogans serovar
          Copenhageni str. Fiocruz L1-130]
 gi|116120702|gb|ABJ78745.1| 30S Ribosomal protein S18 [Leptospira borgpetersenii serovar
          Hardjo-bovis L550]
 gi|116124528|gb|ABJ75799.1| 30S Ribosomal protein S18 [Leptospira borgpetersenii serovar
          Hardjo-bovis JB197]
          Length = 81

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 49/72 (68%), Gaps = 2/72 (2%)

Query: 11 RRNVSHRRKSCPLSG--KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          R+   +++K C  +   + A +I+YK+I LL RF++ RGKI+P RI+  S + QR LA+ 
Sbjct: 7  RKQNKYKKKVCRFTADPELAKQINYKNIELLERFITNRGKIIPRRITGTSARYQRVLARE 66

Query: 69 IKRARYLGLIAY 80
          I++AR +GL+ Y
Sbjct: 67 IRKARSIGLLPY 78


>gi|228473999|ref|ZP_04058740.1| ribosomal protein S18 [Capnocytophaga gingivalis ATCC 33624]
 gi|326336347|ref|ZP_08202518.1| 30S ribosomal protein S18 [Capnocytophaga sp. oral taxon 338 str.
          F0234]
 gi|228274513|gb|EEK13354.1| ribosomal protein S18 [Capnocytophaga gingivalis ATCC 33624]
 gi|325691521|gb|EGD33489.1| 30S ribosomal protein S18 [Capnocytophaga sp. oral taxon 338 str.
          F0234]
          Length = 97

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL   + +  +K C     G   IDYKD   L +F++++GK++P RI+  S K QR++A
Sbjct: 19 TPL-NIDTNKNKKYCRFKKLGIKYIDYKDPDFLLKFINEQGKLLPRRITGTSLKFQRKIA 77

Query: 67 KAIKRARYLGLIAYV 81
           A+KRAR+L L+ YV
Sbjct: 78 VAVKRARHLALLPYV 92


>gi|257789801|ref|YP_003180407.1| 30S ribosomal protein S18 [Eggerthella lenta DSM 2243]
 gi|317489260|ref|ZP_07947777.1| ribosomal protein S18 [Eggerthella sp. 1_3_56FAA]
 gi|325832274|ref|ZP_08165273.1| ribosomal protein S18 [Eggerthella sp. HGA1]
 gi|257473698|gb|ACV54018.1| ribosomal protein S18 [Eggerthella lenta DSM 2243]
 gi|316911661|gb|EFV33253.1| ribosomal protein S18 [Eggerthella sp. 1_3_56FAA]
 gi|325486110|gb|EGC88564.1| ribosomal protein S18 [Eggerthella sp. HGA1]
          Length = 86

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C    +    IDYKD ++L ++++ RGKI P R++    + QR++A A+KRAR + 
Sbjct: 9  RRKFCQFCKEDTQYIDYKDTQMLRKYVTDRGKIKPRRVTGACTQHQRDIANAVKRAREMA 68

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 69 LMPYA 73


>gi|289770861|ref|ZP_06530239.1| 30S ribosomal protein S18 2 [Streptomyces lividans TK24]
 gi|289701060|gb|EFD68489.1| 30S ribosomal protein S18 2 [Streptomyces lividans TK24]
          Length = 105

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 43/64 (67%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           R++  PL   G   +DYKD  LL +F+S RGKI   R++ V+ ++QR+LA+AIK AR + 
Sbjct: 39  RQRPNPLDRDGVTYVDYKDTELLRKFVSDRGKIRSRRVTRVTSQQQRQLARAIKNAREMA 98

Query: 77  LIAY 80
           L+ Y
Sbjct: 99  LLPY 102


>gi|150002620|ref|YP_001297364.1| 30S ribosomal protein S18 [Bacteroides vulgatus ATCC 8482]
 gi|189462618|ref|ZP_03011403.1| hypothetical protein BACCOP_03310 [Bacteroides coprocola DSM
          17136]
 gi|198276875|ref|ZP_03209406.1| hypothetical protein BACPLE_03080 [Bacteroides plebeius DSM
          17135]
 gi|212691069|ref|ZP_03299197.1| hypothetical protein BACDOR_00559 [Bacteroides dorei DSM 17855]
 gi|224026732|ref|ZP_03645098.1| hypothetical protein BACCOPRO_03489 [Bacteroides coprophilus DSM
          18228]
 gi|237712431|ref|ZP_04542912.1| 30S ribosomal protein S18 [Bacteroides sp. 9_1_42FAA]
 gi|237726621|ref|ZP_04557102.1| 30S ribosomal protein S18 [Bacteroides sp. D4]
 gi|254881416|ref|ZP_05254126.1| 30S ribosomal protein S18 [Bacteroides sp. 4_3_47FAA]
 gi|265752133|ref|ZP_06087926.1| 30S ribosomal protein S18 [Bacteroides sp. 3_1_33FAA]
 gi|294776102|ref|ZP_06741595.1| ribosomal protein S18 [Bacteroides vulgatus PC510]
 gi|319642803|ref|ZP_07997441.1| 30S ribosomal protein S18 [Bacteroides sp. 3_1_40A]
 gi|166220923|sp|A6KWD6|RS18_BACV8 RecName: Full=30S ribosomal protein S18
 gi|149931044|gb|ABR37742.1| 30S ribosomal protein S18 [Bacteroides vulgatus ATCC 8482]
 gi|189430779|gb|EDU99763.1| hypothetical protein BACCOP_03310 [Bacteroides coprocola DSM
          17136]
 gi|198270400|gb|EDY94670.1| hypothetical protein BACPLE_03080 [Bacteroides plebeius DSM
          17135]
 gi|212666301|gb|EEB26873.1| hypothetical protein BACDOR_00559 [Bacteroides dorei DSM 17855]
 gi|224019968|gb|EEF77966.1| hypothetical protein BACCOPRO_03489 [Bacteroides coprophilus DSM
          18228]
 gi|229435147|gb|EEO45224.1| 30S ribosomal protein S18 [Bacteroides dorei 5_1_36/D4]
 gi|229453752|gb|EEO59473.1| 30S ribosomal protein S18 [Bacteroides sp. 9_1_42FAA]
 gi|254834209|gb|EET14518.1| 30S ribosomal protein S18 [Bacteroides sp. 4_3_47FAA]
 gi|263236925|gb|EEZ22395.1| 30S ribosomal protein S18 [Bacteroides sp. 3_1_33FAA]
 gi|294450053|gb|EFG18560.1| ribosomal protein S18 [Bacteroides vulgatus PC510]
 gi|317385547|gb|EFV66488.1| 30S ribosomal protein S18 [Bacteroides sp. 3_1_40A]
          Length = 89

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ +V 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPFVT 85


>gi|330995927|ref|ZP_08319822.1| ribosomal protein S18 [Paraprevotella xylaniphila YIT 11841]
 gi|332877546|ref|ZP_08445293.1| ribosomal protein S18 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
 gi|329574266|gb|EGG55841.1| ribosomal protein S18 [Paraprevotella xylaniphila YIT 11841]
 gi|332684652|gb|EGJ57502.1| ribosomal protein S18 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
          Length = 88

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ +V 
Sbjct: 29 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARHLALLPFVT 84


>gi|34540404|ref|NP_904883.1| 30S ribosomal protein S18 [Porphyromonas gingivalis W83]
 gi|188994504|ref|YP_001928756.1| 30S ribosomal protein S18 [Porphyromonas gingivalis ATCC 33277]
 gi|59798820|sp|Q7MWL2|RS18_PORGI RecName: Full=30S ribosomal protein S18
 gi|229560051|sp|B2RIG4|RS18_PORG3 RecName: Full=30S ribosomal protein S18
 gi|34396717|gb|AAQ65782.1| ribosomal protein S18 [Porphyromonas gingivalis W83]
 gi|188594184|dbj|BAG33159.1| 30S ribosomal protein S18 [Porphyromonas gingivalis ATCC 33277]
          Length = 90

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 31 GIRYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVT 86


>gi|53715145|ref|YP_101137.1| 30S ribosomal protein S18 [Bacteroides fragilis YCH46]
 gi|60683081|ref|YP_213225.1| 30S ribosomal protein S18 [Bacteroides fragilis NCTC 9343]
 gi|253566275|ref|ZP_04843729.1| 30S ribosomal protein S18 [Bacteroides sp. 3_2_5]
 gi|265766975|ref|ZP_06094804.1| ribosomal protein S18 [Bacteroides sp. 2_1_16]
 gi|59798649|sp|Q64PH8|RS18_BACFR RecName: Full=30S ribosomal protein S18
 gi|81313865|sp|Q5L9B6|RS18_BACFN RecName: Full=30S ribosomal protein S18
 gi|52218010|dbj|BAD50603.1| 30S ribosomal protein S18 [Bacteroides fragilis YCH46]
 gi|60494515|emb|CAH09312.1| putative 30S ribosomal protein S18 [Bacteroides fragilis NCTC
          9343]
 gi|251945379|gb|EES85817.1| 30S ribosomal protein S18 [Bacteroides sp. 3_2_5]
 gi|263253352|gb|EEZ24828.1| ribosomal protein S18 [Bacteroides sp. 2_1_16]
 gi|301164596|emb|CBW24155.1| putative 30S ribosomal protein S18 [Bacteroides fragilis 638R]
          Length = 90

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ +V 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPFVT 86


>gi|255535655|ref|YP_003096026.1| SSU ribosomal protein S18p [Flavobacteriaceae bacterium 3519-10]
 gi|255341851|gb|ACU07964.1| SSU ribosomal protein S18p [Flavobacteriaceae bacterium 3519-10]
          Length = 100

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 47/80 (58%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          +EV     L  N    +K C     G   +DYKD   L +F++++GKI+P R +  S K 
Sbjct: 16 SEVKFLTPLDINTKTDKKYCRFKKYGIKHVDYKDANFLLQFVNEQGKILPRRYTGTSLKY 75

Query: 62 QRELAKAIKRARYLGLIAYV 81
          QR+++ AIKRAR+L ++ YV
Sbjct: 76 QRKVSAAIKRARHLAMMPYV 95


>gi|108773275|ref|YP_635768.1| ribosomal protein S18 [Chara vulgaris]
 gi|122231310|sp|Q1ACH9|RR18_CHAVU RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|77157931|gb|ABA61972.1| ribosomal protein S18 [Chara vulgaris]
          Length = 78

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR+  P+  K   +IDYK++ LL RFLS++GKI+  R++ ++ K+QR +  AIKRAR L 
Sbjct: 12 RRRLPPI--KSGEKIDYKNLDLLRRFLSEQGKILSKRVNRLTSKQQRTMTIAIKRARILA 69

Query: 77 LIAYVN 82
          LI ++N
Sbjct: 70 LIPFLN 75


>gi|22711969|ref|NP_683799.1| ribosomal protein S18 [Chaetosphaeridium globosum]
 gi|25009146|sp|Q8M9Y7|RR18_CHAGL RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|22416973|gb|AAM96573.1| ribosomal protein S18 [Chaetosphaeridium globosum]
          Length = 79

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR+  P+  +    IDYK++ LL RF+S++GKI+  R++ ++ K+QR + KAIKRAR L 
Sbjct: 13 RRRLAPI--RAGESIDYKNVGLLRRFISEQGKILSRRVNRLTAKQQRNMTKAIKRARILA 70

Query: 77 LIAYVN 82
          L+ ++N
Sbjct: 71 LLPFLN 76


>gi|295106369|emb|CBL03912.1| SSU ribosomal protein S18P [Gordonibacter pamelaeae 7-10-1-b]
          Length = 86

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C      A  +DYKD ++L ++++ RGKI P R++    + QR++A A+KRAR + 
Sbjct: 9  RRKFCQFCKDEANYVDYKDTQMLRKYVTDRGKIKPRRVTGACTQHQRDIANAVKRAREMA 68

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 69 LMPYA 73


>gi|126661839|ref|ZP_01732838.1| 30S ribosomal protein S18 [Flavobacteria bacterium BAL38]
 gi|126625218|gb|EAZ95907.1| 30S ribosomal protein S18 [Flavobacteria bacterium BAL38]
          Length = 98

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL   + +  +K C     G   IDYKD   L +F++++GKI+P R++  S K QR+++
Sbjct: 20 TPL-NIDTNKTKKYCRFKKSGIKYIDYKDADFLLKFVNEQGKILPRRLTGTSLKYQRKVS 78

Query: 67 KAIKRARYLGLIAYV 81
           A+KRAR+L L+ YV
Sbjct: 79 VAVKRARHLALMPYV 93


>gi|57234187|ref|YP_181760.1| 30S ribosomal protein S18 [Dehalococcoides ethenogenes 195]
 gi|123773606|sp|Q3Z7N9|RS18_DEHE1 RecName: Full=30S ribosomal protein S18
 gi|57224635|gb|AAW39692.1| ribosomal protein S18 [Dehalococcoides ethenogenes 195]
          Length = 147

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK C    +   RIDYKD   L R++S RGKI P R +    + QR LA AIKRAR++ 
Sbjct: 21 KRKICSFCAEKVSRIDYKDSAKLARYISDRGKIEPRRRTGTCARHQRALANAIKRARFIA 80

Query: 77 LIAYVN 82
          L+ +V+
Sbjct: 81 LMPFVS 86


>gi|225011730|ref|ZP_03702168.1| ribosomal protein S18 [Flavobacteria bacterium MS024-2A]
 gi|225004233|gb|EEG42205.1| ribosomal protein S18 [Flavobacteria bacterium MS024-2A]
          Length = 98

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 1/75 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL   + S ++K C     G   +DYKD   L +F++++GKI+P R++  S K QR+++
Sbjct: 20 TPL-NIDTSTQKKYCRFKRTGIKYVDYKDPDFLIKFVNEQGKILPRRLTGTSLKYQRKVS 78

Query: 67 KAIKRARYLGLIAYV 81
           A+KRAR+L L+ YV
Sbjct: 79 VAVKRARHLALMPYV 93


>gi|294633130|ref|ZP_06711689.1| 30S ribosomal protein S18 [Streptomyces sp. e14]
 gi|292830911|gb|EFF89261.1| 30S ribosomal protein S18 [Streptomyces sp. e14]
          Length = 78

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
           ++ + +  PL   G   IDYKD  LL +F+S RGKI   R++ +S ++QR+LA A+K A
Sbjct: 8  TLARKNRPNPLDAAGITYIDYKDTELLRKFISDRGKIRSRRVTRISRRQQRQLAAAVKNA 67

Query: 73 RYLGLIAY 80
          R + L+ Y
Sbjct: 68 REMALLPY 75


>gi|237757030|ref|ZP_04585482.1| ribosomal protein S18 [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237690810|gb|EEP59966.1| ribosomal protein S18 [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 79

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 17 RRKSCPLSG-KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          R+K C     K  P  +YKDI  L  F+S+RGKI+PSRIS    K QR+LA  IK+AR L
Sbjct: 14 RKKYCKFCAEKKEP--NYKDIETLKGFISERGKIIPSRISGTCAKHQRKLAVEIKKARQL 71

Query: 76 GLIAYV 81
           L+ YV
Sbjct: 72 ALLPYV 77


>gi|190571062|ref|YP_001975420.1| ribosomal protein S18 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|190357334|emb|CAQ54764.1| ribosomal protein S18 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
          Length = 91

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R K CPL+      IDYK+I LL++F S  G+I+P R++ V  +KQR+L  AI RAR+L 
Sbjct: 22 RPKVCPLAASKDEDIDYKNIDLLSKFTSDYGRILPRRLTGVCARKQRKLRLAIIRARFLA 81

Query: 77 LIAYV 81
          L  Y 
Sbjct: 82 LAPYC 86


>gi|300172598|ref|YP_003771763.1| 30S ribosomal protein S18 [Leuconostoc gasicomitatum LMG 18811]
 gi|299886976|emb|CBL90944.1| 30S ribosomal protein S18 [Leuconostoc gasicomitatum LMG 18811]
          Length = 94

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYK+  LL RF+S+RGKI+P R++  S K QR++  AIKRAR + L+ +V
Sbjct: 41 IDYKNTELLERFISERGKILPRRVTGTSAKNQRKVTIAIKRARIMALLPFV 91


>gi|229822653|ref|YP_002884179.1| ribosomal protein S18 [Beutenbergia cavernae DSM 12333]
 gi|259494802|sp|C5C659|RS18_BEUC1 RecName: Full=30S ribosomal protein S18
 gi|229568566|gb|ACQ82417.1| ribosomal protein S18 [Beutenbergia cavernae DSM 12333]
          Length = 78

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 3/73 (4%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P+LR+    ++KS PL       IDYKD  LL +F+S RGKI   R++ VS ++QR +AK
Sbjct: 4  PVLRK---PKKKSNPLKSAKIEAIDYKDTVLLRKFISDRGKIRARRVTGVSVQEQRAIAK 60

Query: 68 AIKRARYLGLIAY 80
          A+K AR + L+ Y
Sbjct: 61 AVKNAREMALLPY 73


>gi|148242324|ref|YP_001227481.1| 30S ribosomal protein S18 [Synechococcus sp. RCC307]
 gi|166222252|sp|A5GTB9|RS18_SYNR3 RecName: Full=30S ribosomal protein S18
 gi|147850634|emb|CAK28128.1| 30S ribosomal protein S18 [Synechococcus sp. RCC307]
          Length = 73

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 43/56 (76%), Gaps = 1/56 (1%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G P IDYKD  LL +F+++RGK++P R++ ++ ++QR+L  ++KRAR + L+ +VN
Sbjct: 16 GDP-IDYKDTDLLKKFITERGKLLPRRMTGLTARQQRDLTNSVKRARIVALLPFVN 70


>gi|260063156|ref|YP_003196236.1| 30S ribosomal protein S18 [Robiginitalea biformata HTCC2501]
 gi|88783250|gb|EAR14422.1| ribosomal protein S18 [Robiginitalea biformata HTCC2501]
          Length = 98

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL     S  +K C     G   IDYKD   L + ++++GKI+P R++  S K QR++A
Sbjct: 20 TPL-NIETSKEKKYCRFKKSGIKYIDYKDPDFLMKLVNEQGKILPRRLTGTSLKYQRKVA 78

Query: 67 KAIKRARYLGLIAYVN 82
          +AIKR+R+L L+ YV 
Sbjct: 79 QAIKRSRHLALMPYVG 94


>gi|160947594|ref|ZP_02094761.1| hypothetical protein PEPMIC_01529 [Parvimonas micra ATCC 33270]
 gi|158446728|gb|EDP23723.1| hypothetical protein PEPMIC_01529 [Parvimonas micra ATCC 33270]
          Length = 74

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++R    R+K        +  +DYKD+  L +F+S+RGKI+P R++  + K+QRE+  AI
Sbjct: 1  MQRKFRPRKKVVAYFSDNSKPLDYKDVNTLKKFISERGKILPRRVTGATAKQQREITAAI 60

Query: 70 KRARYLGLIAY 80
          K+AR + L+ Y
Sbjct: 61 KKARQVALLPY 71


>gi|221195118|ref|ZP_03568174.1| ribosomal protein S18 [Atopobium rimae ATCC 49626]
 gi|221185021|gb|EEE17412.1| ribosomal protein S18 [Atopobium rimae ATCC 49626]
          Length = 90

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C    +    IDYKD +LL ++++ RGKI P R++    + Q ++A AIKRAR + 
Sbjct: 13 RRKYCQFCKENTEYIDYKDTQLLRKYMTDRGKIKPRRVTGACTQHQHDIALAIKRAREMA 72

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 73 LLPYT 77


>gi|302384674|ref|YP_003820496.1| ribosomal protein S18 [Clostridium saccharolyticum WM1]
 gi|302195302|gb|ADL02873.1| ribosomal protein S18 [Clostridium saccharolyticum WM1]
          Length = 88

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   G+    IDYKD+  L R++S+RGKI+P RI+    K QR L  AIKRAR++ L+ Y
Sbjct: 26 CVFCGEKNGVIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHIALMPY 85

Query: 81 V 81
           
Sbjct: 86 T 86


>gi|305667287|ref|YP_003863574.1| 30S ribosomal protein S18 [Maribacter sp. HTCC2170]
 gi|88709334|gb|EAR01567.1| ribosomal protein S18 [Maribacter sp. HTCC2170]
          Length = 98

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL     + ++K C     G   IDYKD   L + ++++GK++P R++  S K QR++A
Sbjct: 20 TPL-NIETNTKKKYCRFKKSGIKYIDYKDADFLMKLVNEQGKLLPRRLTGTSLKYQRKVA 78

Query: 67 KAIKRARYLGLIAYVN 82
          +A+KRAR+L L+ YV 
Sbjct: 79 QAVKRARHLALMPYVG 94


>gi|319760231|ref|YP_004124169.1| 30S ribosomal protein S18 [Candidatus Blochmannia vafer str.
          BVAF]
 gi|318038945|gb|ADV33495.1| 30S ribosomal protein S18 [Candidatus Blochmannia vafer str.
          BVAF]
          Length = 76

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          ++ R + HR K C  + +    +DYKD+  +   + + GKI+PSRI+    K QR+LA+A
Sbjct: 1  MILRYIRHR-KFCRFTAEKCTEVDYKDLVKIQSSIIENGKIIPSRITGTRSKYQRQLARA 59

Query: 69 IKRARYLGLIAYVN 82
          IK ARYL L+ Y +
Sbjct: 60 IKIARYLSLLPYTD 73


>gi|258645631|ref|ZP_05733100.1| ribosomal protein S18 [Dialister invisus DSM 15470]
 gi|260402992|gb|EEW96539.1| ribosomal protein S18 [Dialister invisus DSM 15470]
          Length = 77

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C         +DYKDI +L RF+S+RGKI+P R++ +  K QR++  AIKRAR + 
Sbjct: 11 RRKICQGCVDHIENVDYKDIAMLRRFISERGKILPRRVTGICAKHQRKINLAIKRARAIA 70

Query: 77 LIAY 80
          L+ +
Sbjct: 71 LLPF 74


>gi|91788895|ref|YP_549847.1| 30S ribosomal protein S18 [Polaromonas sp. JS666]
 gi|123059688|sp|Q128U3|RS18_POLSJ RecName: Full=30S ribosomal protein S18
 gi|91698120|gb|ABE44949.1| SSU ribosomal protein S18P [Polaromonas sp. JS666]
          Length = 94

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKDI  L  F+++ GKI+P+R++      QR++  A+KRAR+L 
Sbjct: 24 RKRFCRFTAAGVEEIDYKDIDTLRDFVAENGKIIPARLTGTRAIFQRQINTAVKRARFLA 83

Query: 77 LIAYVN 82
          ++ Y +
Sbjct: 84 MLPYSD 89


>gi|317133426|ref|YP_004092740.1| ribosomal protein S18 [Ethanoligenens harbinense YUAN-3]
 gi|315471405|gb|ADU28009.1| ribosomal protein S18 [Ethanoligenens harbinense YUAN-3]
          Length = 84

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         IDYKDI  L ++LS+R KI+P R++      QREL  AIKRAR+L L+ Y
Sbjct: 22 CSFCVDKVESIDYKDIAKLRKYLSERAKILPRRVTGTCAHHQRELTIAIKRARHLALLPY 81

Query: 81 VN 82
          V+
Sbjct: 82 VS 83


>gi|323485447|ref|ZP_08090795.1| hypothetical protein HMPREF9474_02546 [Clostridium symbiosum
          WAL-14163]
 gi|323695065|ref|ZP_08109208.1| ribosomal protein S18 [Clostridium symbiosum WAL-14673]
 gi|323401310|gb|EGA93660.1| hypothetical protein HMPREF9474_02546 [Clostridium symbiosum
          WAL-14163]
 gi|323500867|gb|EGB16786.1| ribosomal protein S18 [Clostridium symbiosum WAL-14673]
          Length = 88

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   G+    IDYKD+  L R++S+RGKI+P RI+    K QR L  AIKRAR++ L+ Y
Sbjct: 26 CVFCGEKNGVIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHIALMPY 85

Query: 81 V 81
           
Sbjct: 86 T 86


>gi|73748806|ref|YP_308045.1| 30S ribosomal protein S18 [Dehalococcoides sp. CBDB1]
 gi|147669567|ref|YP_001214385.1| 30S ribosomal protein S18 [Dehalococcoides sp. BAV1]
 gi|289432827|ref|YP_003462700.1| ribosomal protein S18 [Dehalococcoides sp. GT]
 gi|123773677|sp|Q3ZY14|RS18_DEHSC RecName: Full=30S ribosomal protein S18
 gi|205557202|sp|A5FQL1|RS18_DEHSB RecName: Full=30S ribosomal protein S18
 gi|73660522|emb|CAI83129.1| ribosomal protein S18 [Dehalococcoides sp. CBDB1]
 gi|146270515|gb|ABQ17507.1| SSU ribosomal protein S18P [Dehalococcoides sp. BAV1]
 gi|288946547|gb|ADC74244.1| ribosomal protein S18 [Dehalococcoides sp. GT]
          Length = 147

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK C    +   RIDYKD   L R++S RGKI P R +    + QR LA AIKRAR++ 
Sbjct: 21 KRKICSFCAEKVSRIDYKDSAKLARYISDRGKIEPRRRTGTCARHQRALANAIKRARFIA 80

Query: 77 LIAYVN 82
          L+ +V+
Sbjct: 81 LMPFVS 86


>gi|159901475|ref|YP_001547722.1| 30S ribosomal protein S18 [Herpetosiphon aurantiacus ATCC 23779]
 gi|205558504|sp|A9B461|RS18_HERA2 RecName: Full=30S ribosomal protein S18
 gi|159894514|gb|ABX07594.1| ribosomal protein S18 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 86

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 47/73 (64%), Gaps = 3/73 (4%)

Query: 11 RRNVSHRRKSCPLSGKG-APRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          RR  + RRK C  + +G  P  DYKDI+ L R +S RGKI+P R +    K QR+L  AI
Sbjct: 11 RRKYTPRRKVCVFTAEGIVP--DYKDIKRLQRMVSDRGKILPRRRTGTCAKYQRKLNVAI 68

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ +V+
Sbjct: 69 KRARHLALLPFVS 81


>gi|257093840|ref|YP_003167481.1| 30S ribosomal protein S18 [Candidatus Accumulibacter phosphatis
          clade IIA str. UW-1]
 gi|257046364|gb|ACV35552.1| ribosomal protein S18 [Candidatus Accumulibacter phosphatis clade
          IIA str. UW-1]
          Length = 91

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +    IDYKD+ L   ++++  KI+P+R++      QR L+ AIKRAR+L 
Sbjct: 23 RRKFCRFTAEKMEEIDYKDVDLFKEYVAENAKIMPARLTGTKAGYQRMLSVAIKRARFLA 82

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 83 LLPYTD 88


>gi|258405219|ref|YP_003197961.1| 30S ribosomal protein S18 [Desulfohalobium retbaense DSM 5692]
 gi|257797446|gb|ACV68383.1| ribosomal protein S18 [Desulfohalobium retbaense DSM 5692]
          Length = 86

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           RR    R+K C         +DYK+I LL  F++ RGKI+  RI+    K QR+L + I
Sbjct: 3  FRRKFRPRKKVCRFCQDNELNLDYKNIELLQDFVTARGKIIARRITGTCAKHQRQLTREI 62

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ Y  
Sbjct: 63 KRARQMALLYYTT 75


>gi|270308305|ref|YP_003330363.1| ribosomal protein S18 [Dehalococcoides sp. VS]
 gi|270154197|gb|ACZ62035.1| ribosomal protein S18 [Dehalococcoides sp. VS]
          Length = 147

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK C    +   RIDYKD   L R++S RGKI P R +    + QR LA AIKRAR++ 
Sbjct: 21 KRKICSFCAEKVSRIDYKDSAKLARYISDRGKIEPRRRTGTCARHQRALANAIKRARFIA 80

Query: 77 LIAYVN 82
          L+ +V+
Sbjct: 81 LMPFVS 86


>gi|313884313|ref|ZP_07818076.1| ribosomal protein S18 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620466|gb|EFR31892.1| ribosomal protein S18 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 77

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (59%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C          DYKD+ LL RF+S +GKI+P R++    K QR L  AIKRAR +GL+
Sbjct: 12 KVCYFCANHIDHPDYKDVELLQRFISDKGKILPRRVTGTCAKHQRALTIAIKRARIMGLL 71

Query: 79 AY 80
           +
Sbjct: 72 PF 73


>gi|282860311|ref|ZP_06269380.1| ribosomal protein S18 [Prevotella bivia JCVIHMP010]
 gi|282586908|gb|EFB92144.1| ribosomal protein S18 [Prevotella bivia JCVIHMP010]
          Length = 89

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+AIKRAR + L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAIKRARQIALLPYVT 85


>gi|171059509|ref|YP_001791858.1| 30S ribosomal protein S18 [Leptothrix cholodnii SP-6]
 gi|229560044|sp|B1XXH3|RS18_LEPCP RecName: Full=30S ribosomal protein S18
 gi|170776954|gb|ACB35093.1| ribosomal protein S18 [Leptothrix cholodnii SP-6]
          Length = 94

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKD+ +L  F+ + GKI P+R++      QR+L  AIKRAR+L 
Sbjct: 25 RKRFCRFTVTGVKEIDYKDLDVLRDFVGENGKITPARLTGTRAFFQRQLTTAIKRARFLA 84

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 85 LLPYSD 90


>gi|330752552|emb|CBL87499.1| Ribosomal protein S18 [uncultured Flavobacteria bacterium]
          Length = 89

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 48/78 (61%), Gaps = 3/78 (3%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          ++P  + +R+ S   K C     G   +DYKD   L RFL+++GKI+P RI+  S K QR
Sbjct: 10 LSPVDIEKRSQS---KYCRFKKMGIKYVDYKDPDFLIRFLNEQGKILPRRITGNSLKFQR 66

Query: 64 ELAKAIKRARYLGLIAYV 81
           +A AIKRAR L L+ YV
Sbjct: 67 RVAVAIKRARQLALLPYV 84


>gi|261880412|ref|ZP_06006839.1| 30S ribosomal protein S18 [Prevotella bergensis DSM 17361]
 gi|270332881|gb|EFA43667.1| 30S ribosomal protein S18 [Prevotella bergensis DSM 17361]
          Length = 90

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+AIKRAR + L+ YV 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAIKRARQIALLPYVT 86


>gi|332520811|ref|ZP_08397271.1| ribosomal protein S18 [Lacinutrix algicola 5H-3-7-4]
 gi|332043341|gb|EGI79537.1| ribosomal protein S18 [Lacinutrix algicola 5H-3-7-4]
          Length = 98

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL   + S ++K C     G   +DYKD   L  F++++GKI+P R++  S K QR+++
Sbjct: 20 TPL-NIDTSKQKKYCRFKKSGIKYVDYKDADWLLGFVNEQGKILPRRLTGTSLKYQRKVS 78

Query: 67 KAIKRARYLGLIAYVN 82
           A+KRAR+L L+ YV 
Sbjct: 79 VAVKRARHLALLPYVT 94


>gi|289422550|ref|ZP_06424393.1| ribosomal protein S18 [Peptostreptococcus anaerobius 653-L]
 gi|289157122|gb|EFD05744.1| ribosomal protein S18 [Peptostreptococcus anaerobius 653-L]
          Length = 75

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C        +IDYK+ + L +F+++RGKI+P RI+    K QREL KAIK AR + L+ Y
Sbjct: 13 CQFCADKNTKIDYKNYQKLEKFVTERGKILPRRITGTCAKHQRELTKAIKMARNIALLPY 72

Query: 81 V 81
           
Sbjct: 73 T 73


>gi|260911679|ref|ZP_05918259.1| 30S ribosomal protein S18 [Prevotella sp. oral taxon 472 str.
          F0295]
 gi|288927613|ref|ZP_06421460.1| ribosomal protein S18 [Prevotella sp. oral taxon 317 str. F0108]
 gi|260634227|gb|EEX52337.1| 30S ribosomal protein S18 [Prevotella sp. oral taxon 472 str.
          F0295]
 gi|288330447|gb|EFC69031.1| ribosomal protein S18 [Prevotella sp. oral taxon 317 str. F0108]
          Length = 89

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+AIKRAR + L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAIKRARQIALLPYVT 85


>gi|282855813|ref|ZP_06265115.1| ribosomal protein S18 [Pyramidobacter piscolens W5455]
 gi|282586327|gb|EFB91593.1| ribosomal protein S18 [Pyramidobacter piscolens W5455]
          Length = 82

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 8  PLLRRNVSHRR-KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          P+ +R    RR K C         +DYKD+  L +++S+RGKI+P R++    K QR+L 
Sbjct: 6  PMRKRGGGKRRPKVCFFCVDKLDEVDYKDVERLKKYVSERGKIIPRRVTGNCAKHQRQLT 65

Query: 67 KAIKRARYLGLIAYV 81
           A+KRAR++ L+ Y 
Sbjct: 66 IAVKRARFMALLPYT 80


>gi|224368965|ref|YP_002603129.1| 30S ribosomal protein S18 [Desulfobacterium autotrophicum HRM2]
 gi|223691682|gb|ACN14965.1| RpsR [Desulfobacterium autotrophicum HRM2]
          Length = 83

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK C         I YKD + L  F+++RGKI+P RI+    K QR L+ AIK+AR +
Sbjct: 14 QRRKVCRFCADSTLEISYKDAKALRSFITERGKIIPRRITGTCAKHQRVLSSAIKQARTI 73

Query: 76 GLIAYVN 82
           L+ YV 
Sbjct: 74 ALLPYVG 80


>gi|300857396|ref|YP_003782380.1| 30S ribosomal protein S18 [Clostridium ljungdahlii DSM 13528]
 gi|300437511|gb|ADK17278.1| 30S ribosomal protein S18 [Clostridium ljungdahlii DSM 13528]
          Length = 85

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK C      +  IDYKDI  L +++++RGKI+P RIS    K QREL  AIKRAR + 
Sbjct: 19 KRKVCAFCMDKSEFIDYKDINKLRKYVTERGKILPRRISGNCAKHQRELTVAIKRARNIA 78

Query: 77 LIAYV 81
          L+ + 
Sbjct: 79 LLPFT 83


>gi|167038652|ref|YP_001666230.1| 30S ribosomal protein S18 [Thermoanaerobacter pseudethanolicus
          ATCC 33223]
 gi|167041002|ref|YP_001663987.1| 30S ribosomal protein S18 [Thermoanaerobacter sp. X514]
 gi|256751478|ref|ZP_05492356.1| ribosomal protein S18 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913787|ref|ZP_07131104.1| ribosomal protein S18 [Thermoanaerobacter sp. X561]
 gi|307265461|ref|ZP_07547017.1| ribosomal protein S18 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307725527|ref|YP_003905278.1| 30S ribosomal protein S18 [Thermoanaerobacter sp. X513]
 gi|320117044|ref|YP_004187203.1| 30S ribosomal protein S18 [Thermoanaerobacter brockii subsp.
          finnii Ako-1]
 gi|326391890|ref|ZP_08213400.1| ribosomal protein S18 [Thermoanaerobacter ethanolicus JW 200]
 gi|229560075|sp|B0K8G2|RS18_THEP3 RecName: Full=30S ribosomal protein S18
 gi|229560076|sp|B0K5L7|RS18_THEPX RecName: Full=30S ribosomal protein S18
 gi|166855242|gb|ABY93651.1| ribosomal protein S18 [Thermoanaerobacter sp. X514]
 gi|166857486|gb|ABY95894.1| ribosomal protein S18 [Thermoanaerobacter pseudethanolicus ATCC
          33223]
 gi|256749697|gb|EEU62723.1| ribosomal protein S18 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300890472|gb|EFK85617.1| ribosomal protein S18 [Thermoanaerobacter sp. X561]
 gi|306919575|gb|EFN49793.1| ribosomal protein S18 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307582588|gb|ADN55987.1| ribosomal protein S18 [Thermoanaerobacter sp. X513]
 gi|319930135|gb|ADV80820.1| ribosomal protein S18 [Thermoanaerobacter brockii subsp. finnii
          Ako-1]
 gi|325992052|gb|EGD50534.1| ribosomal protein S18 [Thermoanaerobacter ethanolicus JW 200]
          Length = 88

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C        +IDYKD+  L +++++RGKI+P RI+    + QR+L KAIKRAR + L+ Y
Sbjct: 26 CAFCTDNIDKIDYKDVARLRKYITERGKILPRRITGNCARHQRQLTKAIKRARQIALLPY 85

Query: 81 V 81
           
Sbjct: 86 T 86


>gi|320161644|ref|YP_004174869.1| 30S ribosomal protein S18 [Anaerolinea thermophila UNI-1]
 gi|319995498|dbj|BAJ64269.1| 30S ribosomal protein S18 [Anaerolinea thermophila UNI-1]
          Length = 90

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P +RR V+ R K C        +IDYK + LL R++++ GKI P R +    K QRELA 
Sbjct: 12 PQMRRYVA-RPKICQFCVDKNIKIDYKAVDLLRRYVTEEGKIRPRRQTGTCAKHQRELAT 70

Query: 68 AIKRARYLGLIAYV 81
          AIKRAR+L  + +V
Sbjct: 71 AIKRARHLAFLPFV 84


>gi|283798280|ref|ZP_06347433.1| ribosomal protein S18 [Clostridium sp. M62/1]
 gi|291074059|gb|EFE11423.1| ribosomal protein S18 [Clostridium sp. M62/1]
 gi|295090607|emb|CBK76714.1| SSU ribosomal protein S18P [Clostridium cf. saccharolyticum K10]
 gi|295115695|emb|CBL36542.1| SSU ribosomal protein S18P [butyrate-producing bacterium SM4/1]
          Length = 88

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 38/61 (62%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   G+    IDYKD   L R++S+RGKI+P RI+    K QR L  AIKRAR++ L+ Y
Sbjct: 26 CVFCGEKNGTIDYKDTNKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHIALMPY 85

Query: 81 V 81
           
Sbjct: 86 T 86


>gi|54026952|ref|YP_121194.1| 30S ribosomal protein S18 [Nocardia farcinica IFM 10152]
 gi|59798929|sp|Q5YPR1|RS182_NOCFA RecName: Full=30S ribosomal protein S18 2
 gi|54018460|dbj|BAD59830.1| putative ribosomal protein S18 [Nocardia farcinica IFM 10152]
          Length = 84

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          AP+  +R   + R K  PL   G   +DYKD+ LL  F+S RGKI   R++ ++ ++QR+
Sbjct: 6  APSKKVRAEQARRPKKNPLIAAGIETVDYKDVNLLRTFISDRGKIRSRRVTGLTPQQQRQ 65

Query: 65 LAKAIKRARYLGLIAYVN 82
          +A A+K AR + L+ + +
Sbjct: 66 VAVAVKNAREMALLPFTS 83


>gi|115378659|ref|ZP_01465809.1| ribosomal protein S18 [Stigmatella aurantiaca DW4/3-1]
 gi|310823079|ref|YP_003955437.1| 30S ribosomal protein S18 [Stigmatella aurantiaca DW4/3-1]
 gi|115364325|gb|EAU63410.1| ribosomal protein S18 [Stigmatella aurantiaca DW4/3-1]
 gi|309396151|gb|ADO73610.1| 30S ribosomal protein S18 [Stigmatella aurantiaca DW4/3-1]
          Length = 146

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           R+K C    +   ++D+KD   L  F+++RGKI+P RIS    K QRE+A AIKRAR L 
Sbjct: 78  RKKVCRFCAEKNAKVDFKDQATLKYFVTERGKIIPRRISGNCAKHQREVAIAIKRARGLA 137

Query: 77  LIAY 80
           L+ Y
Sbjct: 138 LLPY 141


>gi|255011271|ref|ZP_05283397.1| 30S ribosomal protein S18 [Bacteroides fragilis 3_1_12]
 gi|313149083|ref|ZP_07811276.1| 30S ribosomal protein S18 [Bacteroides fragilis 3_1_12]
 gi|313137850|gb|EFR55210.1| 30S ribosomal protein S18 [Bacteroides fragilis 3_1_12]
          Length = 90

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 39/52 (75%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ +V 
Sbjct: 35 IDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPFVT 86


>gi|311746134|ref|ZP_07719919.1| ribosomal protein S18 [Algoriphagus sp. PR1]
 gi|126576355|gb|EAZ80633.1| ribosomal protein S18 [Algoriphagus sp. PR1]
          Length = 83

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 45/67 (67%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
           +R+K C     G   IDYKD   L +F++++GKI+P R++  S K Q+++A AIK+AR+
Sbjct: 12 ENRKKYCRFKKHGIKYIDYKDPNFLLKFVNEQGKILPRRLTGNSAKYQKKVANAIKKARH 71

Query: 75 LGLIAYV 81
          L L+ +V
Sbjct: 72 LALLPFV 78


>gi|325270188|ref|ZP_08136795.1| 30S ribosomal protein S18 [Prevotella multiformis DSM 16608]
 gi|324987489|gb|EGC19465.1| 30S ribosomal protein S18 [Prevotella multiformis DSM 16608]
          Length = 89

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+AIKRAR + L+ YV 
Sbjct: 30 GIKYIDYKDGEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAIKRARQIALLPYVT 85


>gi|238925607|ref|YP_002939124.1| 30S ribosomal protein S18 [Eubacterium rectale ATCC 33656]
 gi|238877283|gb|ACR76990.1| 30S ribosomal protein S18 [Eubacterium rectale ATCC 33656]
 gi|291524157|emb|CBK89744.1| SSU ribosomal protein S18P [Eubacterium rectale DSM 17629]
 gi|291527800|emb|CBK93386.1| SSU ribosomal protein S18P [Eubacterium rectale M104/1]
          Length = 85

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 1/61 (1%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   GK    IDYKD   L R++S+RGKI+P RI+    K QR L  AIKRAR+L L+ Y
Sbjct: 24 CVFCGKDNV-IDYKDTNKLKRYISERGKILPRRITGNCAKHQRALTVAIKRARHLALMPY 82

Query: 81 V 81
          V
Sbjct: 83 V 83


>gi|18311622|ref|NP_563556.1| 30S ribosomal protein S18 [Clostridium perfringens str. 13]
 gi|110801194|ref|YP_697330.1| 30S ribosomal protein S18 [Clostridium perfringens ATCC 13124]
 gi|110801451|ref|YP_699889.1| 30S ribosomal protein S18 [Clostridium perfringens SM101]
 gi|168207913|ref|ZP_02633918.1| ribosomal protein S18 [Clostridium perfringens E str. JGS1987]
 gi|168211574|ref|ZP_02637199.1| ribosomal protein S18 [Clostridium perfringens B str. ATCC 3626]
 gi|168214826|ref|ZP_02640451.1| ribosomal protein S18 [Clostridium perfringens CPE str. F4969]
 gi|168218034|ref|ZP_02643659.1| ribosomal protein S18 [Clostridium perfringens NCTC 8239]
 gi|169343454|ref|ZP_02864454.1| ribosomal protein S18 [Clostridium perfringens C str. JGS1495]
 gi|182626399|ref|ZP_02954152.1| ribosomal protein S18 [Clostridium perfringens D str. JGS1721]
 gi|20978678|sp|Q8XH45|RS18_CLOPE RecName: Full=30S ribosomal protein S18
 gi|122958625|sp|Q0TM10|RS18_CLOP1 RecName: Full=30S ribosomal protein S18
 gi|123341463|sp|Q0SPR8|RS18_CLOPS RecName: Full=30S ribosomal protein S18
 gi|18146306|dbj|BAB82346.1| 30S ribosomal protein S18 [Clostridium perfringens str. 13]
 gi|110675841|gb|ABG84828.1| 30S ribosomal protein S18 [Clostridium perfringens ATCC 13124]
 gi|110681952|gb|ABG85322.1| 30S ribosomal protein S18 [Clostridium perfringens SM101]
 gi|169298406|gb|EDS80495.1| ribosomal protein S18 [Clostridium perfringens C str. JGS1495]
 gi|170660796|gb|EDT13479.1| ribosomal protein S18 [Clostridium perfringens E str. JGS1987]
 gi|170710455|gb|EDT22637.1| ribosomal protein S18 [Clostridium perfringens B str. ATCC 3626]
 gi|170713723|gb|EDT25905.1| ribosomal protein S18 [Clostridium perfringens CPE str. F4969]
 gi|177908273|gb|EDT70826.1| ribosomal protein S18 [Clostridium perfringens D str. JGS1721]
 gi|182379953|gb|EDT77432.1| ribosomal protein S18 [Clostridium perfringens NCTC 8239]
          Length = 80

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C      A  IDYKD+  L +++++RGKI+P RIS    K QR+L  AIKR+R + 
Sbjct: 14 RKKVCIFCVDKAESIDYKDVAKLKKYITERGKILPRRISGTCAKHQRQLTDAIKRSRNIA 73

Query: 77 LIAYVN 82
          L+ +  
Sbjct: 74 LLPFTT 79


>gi|169824836|ref|YP_001692447.1| 30S ribosomal protein S18 [Finegoldia magna ATCC 29328]
 gi|297587219|ref|ZP_06945864.1| 30S ribosomal protein S18 [Finegoldia magna ATCC 53516]
 gi|302379548|ref|ZP_07268033.1| ribosomal protein S18 [Finegoldia magna ACS-171-V-Col3]
 gi|303234545|ref|ZP_07321182.1| ribosomal protein S18 [Finegoldia magna BVS033A4]
 gi|167831641|dbj|BAG08557.1| 30S ribosomal protein S18 [Finegoldia magna ATCC 29328]
 gi|297575200|gb|EFH93919.1| 30S ribosomal protein S18 [Finegoldia magna ATCC 53516]
 gi|302312455|gb|EFK94451.1| ribosomal protein S18 [Finegoldia magna ACS-171-V-Col3]
 gi|302494379|gb|EFL54148.1| ribosomal protein S18 [Finegoldia magna BVS033A4]
          Length = 74

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++R    R+K  P        IDYKD+ +L  ++S+RGKI+P R++ ++ K QR++  AI
Sbjct: 1  MQRRFRPRKKIDPFQKDKTKVIDYKDVNMLKNYISERGKILPRRVTGLNAKHQRQITDAI 60

Query: 70 KRARYLGLIAY 80
          K+AR + L+ Y
Sbjct: 61 KKARQVALLPY 71


>gi|296136558|ref|YP_003643800.1| ribosomal protein S18 [Thiomonas intermedia K12]
 gi|295796680|gb|ADG31470.1| ribosomal protein S18 [Thiomonas intermedia K12]
          Length = 96

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 43/67 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +     RIDYKD+ +L   +++  +I+P+R++  S   QR+L  AIKRAR+L 
Sbjct: 27 RKRFCRFTVAKVERIDYKDVDVLKDLIAENARIIPARLTGTSAHYQRQLNTAIKRARFLA 86

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 87 LLPYTDL 93


>gi|170288132|ref|YP_001738370.1| ribosomal protein S18 [Thermotoga sp. RQ2]
 gi|229560077|sp|B1L8K5|RS18_THESQ RecName: Full=30S ribosomal protein S18
 gi|170175635|gb|ACB08687.1| ribosomal protein S18 [Thermotoga sp. RQ2]
          Length = 75

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (71%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          +DYKD RLL+ FL+ +GKI+P R++    K QR +  AIKRAR +GL+ Y+ +
Sbjct: 23 VDYKDTRLLSEFLTDKGKIIPKRLTGTCAKHQRMVKVAIKRARQMGLLPYLKI 75


>gi|312601294|gb|ADQ90549.1| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae 168]
          Length = 87

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (64%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
          +C         IDYKDI +L RF++  GKI PSRI+    K QR+LA A+KRAR++ L+ 
Sbjct: 13 TCQFCEAKLFYIDYKDIEVLQRFINTFGKIQPSRITGNCAKHQRKLALAVKRARFVALLP 72

Query: 80 YV 81
          ++
Sbjct: 73 FI 74


>gi|224179528|ref|YP_002601063.1| ribosomal protein S18 [Monomastix sp. OKE-1]
 gi|217314571|gb|ACK36914.1| ribosomal protein S18 [Monomastix sp. OKE-1]
          Length = 62

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 39/52 (75%)

Query: 29 PRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
           +IDYKD+  L RF++++GKI+  R + +  K+QREL KA+K+AR LGL+ +
Sbjct: 4  TQIDYKDVAYLRRFITEQGKILSRRFTGLKAKQQRELTKAVKQARILGLLGF 55


>gi|184201983|ref|YP_001856190.1| 30S ribosomal protein S18 [Kocuria rhizophila DC2201]
 gi|205558187|sp|B2GJD6|RS18_KOCRD RecName: Full=30S ribosomal protein S18
 gi|183582213|dbj|BAG30684.1| 30S ribosomal protein S18 [Kocuria rhizophila DC2201]
          Length = 78

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 41/62 (66%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K  PL       IDYKD+ LL +F+S RGKI   R++ VS ++QR++A+AIK AR + L+
Sbjct: 12 KQNPLKAADVTEIDYKDVALLRKFISDRGKIRARRVTGVSVQEQRKIAQAIKNAREVALL 71

Query: 79 AY 80
           Y
Sbjct: 72 PY 73


>gi|146301223|ref|YP_001195814.1| 30S ribosomal protein S18 [Flavobacterium johnsoniae UW101]
 gi|205557694|sp|A5FE76|RS18_FLAJO RecName: Full=30S ribosomal protein S18
 gi|146155641|gb|ABQ06495.1| 30S ribosomal protein S18 [Flavobacterium johnsoniae UW101]
          Length = 98

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL     +  +K C     G   IDYKD   L +F++++GKI+P R++  S K QR+++
Sbjct: 20 TPL-NIETNKTKKYCRFKKSGIKYIDYKDADFLLKFVNEQGKILPRRLTGTSLKYQRKVS 78

Query: 67 KAIKRARYLGLIAYV 81
           A+KRAR+L L+ YV
Sbjct: 79 VAVKRARHLALMPYV 93


>gi|282880329|ref|ZP_06289043.1| ribosomal protein S18 [Prevotella timonensis CRIS 5C-B1]
 gi|281305831|gb|EFA97877.1| ribosomal protein S18 [Prevotella timonensis CRIS 5C-B1]
          Length = 89

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 85


>gi|282877913|ref|ZP_06286722.1| ribosomal protein S18 [Prevotella buccalis ATCC 35310]
 gi|281299914|gb|EFA92274.1| ribosomal protein S18 [Prevotella buccalis ATCC 35310]
          Length = 90

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 86


>gi|160902036|ref|YP_001567617.1| ribosomal protein S18 [Petrotoga mobilis SJ95]
 gi|254812950|sp|A9BH64|RS18_PETMO RecName: Full=30S ribosomal protein S18
 gi|160359680|gb|ABX31294.1| ribosomal protein S18 [Petrotoga mobilis SJ95]
          Length = 76

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R K C L       IDYKD+R L  F++ +GKI+P RI+    K QR +  AI+RAR + 
Sbjct: 10 RIKKCKLCRDNVEYIDYKDVRKLKEFMNDKGKILPKRINGNCAKHQRMVRTAIQRARKMM 69

Query: 77 LIAYVN 82
          L+ YVN
Sbjct: 70 LVPYVN 75


>gi|304383092|ref|ZP_07365567.1| 30S ribosomal protein S18 [Prevotella marshii DSM 16973]
 gi|304335778|gb|EFM02033.1| 30S ribosomal protein S18 [Prevotella marshii DSM 16973]
          Length = 88

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+AIKRAR + L+ YV 
Sbjct: 29 GIKYIDYKDPDFLKKFLNEQGKILPRRITGTSLKYQRRVAQAIKRARQIALLPYVT 84


>gi|256425943|ref|YP_003126596.1| ribosomal protein S18 [Chitinophaga pinensis DSM 2588]
 gi|256040851|gb|ACU64395.1| ribosomal protein S18 [Chitinophaga pinensis DSM 2588]
          Length = 88

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C     G   +DYKD   L +FL+ +GK++P RIS  S K QR++A+AIK+AR + L
Sbjct: 20 KKYCRFKKLGIRYVDYKDAEFLKKFLNDQGKMLPRRISGNSLKFQRKVAQAIKKARQMAL 79

Query: 78 IAYVN 82
          + YV 
Sbjct: 80 LPYVT 84


>gi|220927534|ref|YP_002504443.1| 30S ribosomal protein S18 [Clostridium cellulolyticum H10]
 gi|219997862|gb|ACL74463.1| ribosomal protein S18 [Clostridium cellulolyticum H10]
          Length = 96

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K C      A  IDYKDI  + +++S+RGKI+P RIS    K QR+L  A+KRAR++ 
Sbjct: 30 KKKVCSFCVDKATDIDYKDIAKIRKYVSERGKILPRRISGNCAKHQRQLTVAVKRARHIA 89

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 90 LLPYT 94


>gi|320537662|ref|ZP_08037595.1| ribosomal protein S18 [Treponema phagedenis F0421]
 gi|320145503|gb|EFW37186.1| ribosomal protein S18 [Treponema phagedenis F0421]
          Length = 102

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 43/66 (65%), Gaps = 1/66 (1%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R+K C    +   +IDYKD   L RF+++RGKI+P RI+    K QR+LA  IKRAR L
Sbjct: 35 YRKKVCRFCSQKI-KIDYKDPDALRRFITERGKILPRRITGTCAKHQRKLATEIKRARAL 93

Query: 76 GLIAYV 81
           L+ +V
Sbjct: 94 ALLPFV 99


>gi|154249360|ref|YP_001410185.1| 30S ribosomal protein S18 [Fervidobacterium nodosum Rt17-B1]
 gi|254811617|sp|A7HKU5|RS18_FERNB RecName: Full=30S ribosomal protein S18
 gi|154153296|gb|ABS60528.1| ribosomal protein S18 [Fervidobacterium nodosum Rt17-B1]
          Length = 76

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 41/63 (65%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+C +       +DYKDIR+L  FL+++GKI+P R++    K QR +  AIKRAR + L+
Sbjct: 12 KACKMCEMNVEYVDYKDIRILKDFLNEKGKILPRRLTGNCAKHQRMVKIAIKRARQMALL 71

Query: 79 AYV 81
           Y+
Sbjct: 72 PYI 74


>gi|29831189|ref|NP_825823.1| 30S ribosomal protein S18 [Streptomyces avermitilis MA-4680]
 gi|59798959|sp|Q82EG9|RS182_STRAW RecName: Full=30S ribosomal protein S18 2
 gi|29608303|dbj|BAC72358.1| putative ribosomal protein S18 [Streptomyces avermitilis MA-4680]
          Length = 78

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 43/69 (62%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R V+   +  PL   G   IDYKD  LL +FLS RGKI   R++ V+ ++QR LA+A+K 
Sbjct: 7  RKVASTPRPNPLDQNGITYIDYKDTDLLRKFLSDRGKIRSRRVTRVTAQQQRLLARAVKN 66

Query: 72 ARYLGLIAY 80
          AR + L+ Y
Sbjct: 67 AREMALLPY 75


>gi|253681270|ref|ZP_04862068.1| ribosomal protein S18 [Clostridium botulinum D str. 1873]
 gi|331268206|ref|YP_004394698.1| 30S ribosomal protein S18 [Clostridium botulinum BKT015925]
 gi|253562508|gb|EES91959.1| ribosomal protein S18 [Clostridium botulinum D str. 1873]
 gi|329124756|gb|AEB74701.1| ribosomal protein S18 [Clostridium botulinum BKT015925]
          Length = 78

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 38/61 (62%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C      +  IDYKD+  L +F+++RGKI+P RIS    K QREL  AIKRAR + L+ +
Sbjct: 16 CAFCADKSSFIDYKDVNKLRKFVTERGKILPRRISGNCAKHQRELTLAIKRARNVALLPF 75

Query: 81 V 81
           
Sbjct: 76 T 76


>gi|291458693|ref|ZP_06598083.1| ribosomal protein S18 [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291418610|gb|EFE92329.1| ribosomal protein S18 [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 118

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           RRK C      A  +D+KDI  L +++S+RGKI+P RI+      QR +  AIKRAR++ 
Sbjct: 52  RRKVCVFCSDKAKPVDFKDIATLRKYISERGKILPRRITGTCATHQRAITTAIKRARHIA 111

Query: 77  LIAY 80
           L+ Y
Sbjct: 112 LLPY 115


>gi|294673370|ref|YP_003573986.1| 30S ribosomal protein S18 [Prevotella ruminicola 23]
 gi|294473390|gb|ADE82779.1| ribosomal protein S18 [Prevotella ruminicola 23]
          Length = 88

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 29 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 84


>gi|149372600|ref|ZP_01891712.1| 30S ribosomal protein S18 [unidentified eubacterium SCB49]
 gi|149354643|gb|EDM43207.1| 30S ribosomal protein S18 [unidentified eubacterium SCB49]
          Length = 98

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL     + ++K C     G   +DYKD   L RF++++GK++P R++  S K QR++A
Sbjct: 20 TPL-NIETAKQKKYCRFKKSGIKYVDYKDGEWLLRFVNEQGKLLPRRLTGTSLKYQRKVA 78

Query: 67 KAIKRARYLGLIAYVN 82
           A+KR+R+L L+ YV 
Sbjct: 79 VAVKRSRHLALMPYVT 94


>gi|220915256|ref|YP_002490560.1| ribosomal protein S18 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|254765404|sp|B8J802|RS18_ANAD2 RecName: Full=30S ribosomal protein S18
 gi|219953110|gb|ACL63494.1| ribosomal protein S18 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 133

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%)

Query: 19  KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
           K C      A ++DYKD   +  FL++RGKI+P RIS    K QRE+A AIKR R L ++
Sbjct: 67  KVCRFCADKALKVDYKDQGQMKYFLTERGKIIPRRISGNCAKHQREVATAIKRGRMLAIL 126

Query: 79  AYV 81
            Y 
Sbjct: 127 PYT 129


>gi|197120545|ref|YP_002132496.1| 30S ribosomal protein S18 [Anaeromyxobacter sp. K]
 gi|229470520|sp|B4ULC0|RS18_ANASK RecName: Full=30S ribosomal protein S18
 gi|196170394|gb|ACG71367.1| ribosomal protein S18 [Anaeromyxobacter sp. K]
          Length = 135

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%)

Query: 19  KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
           K C      A ++DYKD   +  FL++RGKI+P RIS    K QRE+A AIKR R L ++
Sbjct: 69  KVCRFCADKALKVDYKDQGQMKYFLTERGKIIPRRISGNCAKHQREVATAIKRGRMLAIL 128

Query: 79  AYV 81
            Y 
Sbjct: 129 PYT 131


>gi|150025893|ref|YP_001296719.1| 30S ribosomal protein S18 [Flavobacterium psychrophilum JIP02/86]
 gi|205557707|sp|A6H0P2|RS18_FLAPJ RecName: Full=30S ribosomal protein S18
 gi|149772434|emb|CAL43916.1| 30S ribosomal protein S18 [Flavobacterium psychrophilum JIP02/86]
          Length = 98

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL   + +  +K C     G   IDYKD   L +F++++GKI+P R++  S K QR+++
Sbjct: 20 TPL-NIDTNKTKKYCRFKKSGIKYIDYKDADFLLKFVNEQGKILPRRLTGTSLKYQRKVS 78

Query: 67 KAIKRARYLGLIAYV 81
           A+KRAR+L  + YV
Sbjct: 79 VAVKRARHLAFMPYV 93


>gi|239978061|ref|ZP_04700585.1| putative 30S ribosomal protein S18 [Streptomyces albus J1074]
 gi|291449962|ref|ZP_06589352.1| 30S ribosomal protein S18 2 [Streptomyces albus J1074]
 gi|291352911|gb|EFE79813.1| 30S ribosomal protein S18 2 [Streptomyces albus J1074]
          Length = 79

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (67%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          PL   G   IDYKD  LL +FLS RGKI   RI+ V+ ++QR+LA+A++ AR + L+ Y
Sbjct: 18 PLLAAGITYIDYKDTELLRKFLSDRGKIRSRRITRVTAQQQRQLARAVRNAREMALLPY 76


>gi|257783834|ref|YP_003179051.1| 30S ribosomal protein S18 [Atopobium parvulum DSM 20469]
 gi|257472341|gb|ACV50460.1| ribosomal protein S18 [Atopobium parvulum DSM 20469]
          Length = 90

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C    +    IDYKD +LL ++++ RGKI P R++    + Q ++A AIKRAR + 
Sbjct: 13 RRKYCQFCKEETEFIDYKDTQLLRKYMTDRGKIKPRRVTGTCTQHQHDIALAIKRAREMA 72

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 73 LLPYT 77


>gi|281420810|ref|ZP_06251809.1| ribosomal protein S18 [Prevotella copri DSM 18205]
 gi|281405102|gb|EFB35782.1| ribosomal protein S18 [Prevotella copri DSM 18205]
          Length = 89

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 85


>gi|300727908|ref|ZP_07061286.1| ribosomal protein S18 [Prevotella bryantii B14]
 gi|299774750|gb|EFI71364.1| ribosomal protein S18 [Prevotella bryantii B14]
          Length = 90

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 86


>gi|225873662|ref|YP_002755121.1| ribosomal protein S18 [Acidobacterium capsulatum ATCC 51196]
 gi|254765401|sp|C1F903|RS18_ACIC5 RecName: Full=30S ribosomal protein S18
 gi|225791607|gb|ACO31697.1| ribosomal protein S18 [Acidobacterium capsulatum ATCC 51196]
          Length = 105

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 42/64 (65%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           R+K C    +    I Y+D+RLL +F+++RGKIVP R++ V    QR L +AIK+AR + 
Sbjct: 38  RKKVCKFCTEKIDAIPYRDVRLLQQFVAERGKIVPRRLTGVCTTHQRRLTRAIKQARNIA 97

Query: 77  LIAY 80
           L+ +
Sbjct: 98  LLPF 101


>gi|260592153|ref|ZP_05857611.1| ribosomal protein S18 [Prevotella veroralis F0319]
 gi|288802528|ref|ZP_06407967.1| ribosomal protein S18 [Prevotella melaninogenica D18]
 gi|302346422|ref|YP_003814720.1| ribosomal protein S18 [Prevotella melaninogenica ATCC 25845]
 gi|325857451|ref|ZP_08172506.1| ribosomal protein S18 [Prevotella denticola CRIS 18C-A]
 gi|327314149|ref|YP_004329586.1| 30S ribosomal protein S18 [Prevotella denticola F0289]
 gi|260535787|gb|EEX18404.1| ribosomal protein S18 [Prevotella veroralis F0319]
 gi|288335056|gb|EFC73492.1| ribosomal protein S18 [Prevotella melaninogenica D18]
 gi|302150343|gb|ADK96604.1| ribosomal protein S18 [Prevotella melaninogenica ATCC 25845]
 gi|325483161|gb|EGC86141.1| ribosomal protein S18 [Prevotella denticola CRIS 18C-A]
 gi|326944059|gb|AEA19944.1| ribosomal protein S18 [Prevotella denticola F0289]
          Length = 89

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 30 GIKYIDYKDGEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 85


>gi|256833731|ref|YP_003162458.1| 30S ribosomal protein S18 [Jonesia denitrificans DSM 20603]
 gi|256687262|gb|ACV10155.1| ribosomal protein S18 [Jonesia denitrificans DSM 20603]
          Length = 78

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 43/64 (67%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++KS PL       +DYKD  LL +F+S RGKI   R++ VS ++QR++A+A+K AR + 
Sbjct: 10 KKKSNPLKSAKIDAVDYKDTALLRKFISDRGKIRARRVTGVSVQEQRQIARAVKNAREMA 69

Query: 77 LIAY 80
          L+ Y
Sbjct: 70 LLPY 73


>gi|323345547|ref|ZP_08085770.1| 30S ribosomal protein S18 [Prevotella oralis ATCC 33269]
 gi|323093661|gb|EFZ36239.1| 30S ribosomal protein S18 [Prevotella oralis ATCC 33269]
          Length = 90

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 86


>gi|238020010|ref|ZP_04600436.1| hypothetical protein VEIDISOL_01886 [Veillonella dispar ATCC
          17748]
 gi|269797402|ref|YP_003311302.1| ribosomal protein S18 [Veillonella parvula DSM 2008]
 gi|282849200|ref|ZP_06258585.1| ribosomal protein S18 [Veillonella parvula ATCC 17745]
 gi|294793012|ref|ZP_06758158.1| ribosomal protein S18 [Veillonella sp. 6_1_27]
 gi|294794948|ref|ZP_06760083.1| ribosomal protein S18 [Veillonella sp. 3_1_44]
 gi|303228727|ref|ZP_07315547.1| ribosomal protein S18 [Veillonella atypica ACS-134-V-Col7a]
 gi|303231551|ref|ZP_07318280.1| ribosomal protein S18 [Veillonella atypica ACS-049-V-Sch6]
 gi|313893864|ref|ZP_07827430.1| ribosomal protein S18 [Veillonella sp. oral taxon 158 str. F0412]
 gi|237863534|gb|EEP64824.1| hypothetical protein VEIDISOL_01886 [Veillonella dispar ATCC
          17748]
 gi|269094031|gb|ACZ24022.1| ribosomal protein S18 [Veillonella parvula DSM 2008]
 gi|282580904|gb|EFB86302.1| ribosomal protein S18 [Veillonella parvula ATCC 17745]
 gi|294454310|gb|EFG22684.1| ribosomal protein S18 [Veillonella sp. 3_1_44]
 gi|294455957|gb|EFG24321.1| ribosomal protein S18 [Veillonella sp. 6_1_27]
 gi|302513797|gb|EFL55810.1| ribosomal protein S18 [Veillonella atypica ACS-049-V-Sch6]
 gi|302516601|gb|EFL58523.1| ribosomal protein S18 [Veillonella atypica ACS-134-V-Col7a]
 gi|313441428|gb|EFR59854.1| ribosomal protein S18 [Veillonella sp. oral taxon 158 str. F0412]
          Length = 76

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C        +IDYKD+  L RF ++RGKI+P RIS    K QR+L  +IKRAR + L+
Sbjct: 12 KVCVFCADHIDQIDYKDVAKLRRFTTERGKILPRRISGTCAKHQRKLTTSIKRARAIALL 71

Query: 79 AYV 81
           + 
Sbjct: 72 PFT 74


>gi|303235604|ref|ZP_07322211.1| ribosomal protein S18 [Prevotella disiens FB035-09AN]
 gi|302484051|gb|EFL47039.1| ribosomal protein S18 [Prevotella disiens FB035-09AN]
          Length = 90

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 31 GIKYIDYKDGEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 86


>gi|225026122|ref|ZP_03715314.1| hypothetical protein EUBHAL_00363 [Eubacterium hallii DSM 3353]
 gi|224956559|gb|EEG37768.1| hypothetical protein EUBHAL_00363 [Eubacterium hallii DSM 3353]
          Length = 86

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 44/74 (59%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P+ RR    R+K C         IDYKD+  L R++S+RGKI+P RI+    K QR L  
Sbjct: 11 PMRRRGGRRRKKVCIFCADKNAVIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTV 70

Query: 68 AIKRARYLGLIAYV 81
          AIKRAR++ L+ Y 
Sbjct: 71 AIKRARHVSLMPYT 84


>gi|288801223|ref|ZP_06406678.1| ribosomal protein S18 [Prevotella sp. oral taxon 299 str. F0039]
 gi|288331834|gb|EFC70317.1| ribosomal protein S18 [Prevotella sp. oral taxon 299 str. F0039]
          Length = 89

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARQIALLPYVT 85


>gi|224282369|ref|ZP_03645691.1| 30S ribosomal protein S18 [Bifidobacterium bifidum NCIMB 41171]
 gi|310286813|ref|YP_003938071.1| ribosomal protein S18 [Bifidobacterium bifidum S17]
 gi|311063711|ref|YP_003970436.1| 30S ribosomal protein S18P RpsR [Bifidobacterium bifidum PRL2010]
 gi|313139513|ref|ZP_07801706.1| 30S ribosomal protein S18 [Bifidobacterium bifidum NCIMB 41171]
 gi|309250749|gb|ADO52497.1| ribosomal protein S18 [Bifidobacterium bifidum S17]
 gi|310866030|gb|ADP35399.1| RpsR SSU ribosomal protein S18P [Bifidobacterium bifidum PRL2010]
 gi|313132023|gb|EFR49640.1| 30S ribosomal protein S18 [Bifidobacterium bifidum NCIMB 41171]
          Length = 82

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 38/52 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD+ LL +F+S RGKI   RI+ V+ ++QREL+KAIK AR + L+ Y  
Sbjct: 28 IDYKDVALLRKFISDRGKIRSRRITGVTVQEQRELSKAIKNAREMALLPYAT 79


>gi|261410090|ref|YP_003246331.1| 30S ribosomal protein S18 [Paenibacillus sp. Y412MC10]
 gi|315644249|ref|ZP_07897419.1| ribosomal protein S18 [Paenibacillus vortex V453]
 gi|329925101|ref|ZP_08280045.1| ribosomal protein S18 [Paenibacillus sp. HGF5]
 gi|261286553|gb|ACX68524.1| ribosomal protein S18 [Paenibacillus sp. Y412MC10]
 gi|315280624|gb|EFU43913.1| ribosomal protein S18 [Paenibacillus vortex V453]
 gi|328940220|gb|EGG36552.1| ribosomal protein S18 [Paenibacillus sp. HGF5]
          Length = 90

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +      IDYKD  LL +F+S+RGKI+P R++  S K QR L  AIKR+R + L+ Y
Sbjct: 28 CFFTVNKITHIDYKDTDLLKKFISERGKILPRRVTGTSAKYQRALTIAIKRSRQIALLPY 87

Query: 81 VN 82
            
Sbjct: 88 TT 89


>gi|157363691|ref|YP_001470458.1| 30S ribosomal protein S18 [Thermotoga lettingae TMO]
 gi|205618988|sp|A8F5G0|RS18_THELT RecName: Full=30S ribosomal protein S18
 gi|157314295|gb|ABV33394.1| ribosomal protein S18 [Thermotoga lettingae TMO]
          Length = 78

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (71%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          +DYKD+RLLN FL+ + KI+P R++    K QR +  AIKRAR++ L+ ++ L
Sbjct: 26 VDYKDLRLLNEFLTDKAKIIPKRVTGNCAKHQRMIKIAIKRARHMALLPFIKL 78


>gi|307566431|ref|ZP_07628866.1| 30S ribosomal protein S18 [Prevotella amnii CRIS 21A-A]
 gi|307344856|gb|EFN90258.1| 30S ribosomal protein S18 [Prevotella amnii CRIS 21A-A]
          Length = 89

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 30 GIKYIDYKDPNFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 85


>gi|322433963|ref|YP_004216175.1| ribosomal protein S18 [Acidobacterium sp. MP5ACTX9]
 gi|321161690|gb|ADW67395.1| ribosomal protein S18 [Acidobacterium sp. MP5ACTX9]
          Length = 129

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 43/64 (67%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           R+K C    +    I Y+D+RLL  F+++RGKIVP R++ V  + QR L+ AIK++R + 
Sbjct: 62  RKKVCKFCTEKIDAISYRDVRLLQGFVAERGKIVPRRLTGVCTRHQRRLSLAIKQSRNIA 121

Query: 77  LIAY 80
           L+A+
Sbjct: 122 LLAF 125


>gi|313202816|ref|YP_004041473.1| SSU ribosomal protein s18p [Paludibacter propionicigenes WB4]
 gi|312442132|gb|ADQ78488.1| SSU ribosomal protein S18P [Paludibacter propionicigenes WB4]
          Length = 89

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 40/52 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD   L +FL+++GKI+P R++  S K QR++A+A+KRAR++ L+ YV 
Sbjct: 34 IDYKDPEFLKKFLNEQGKILPRRLTGTSLKFQRKVAQAVKRARHIALLPYVT 85


>gi|124266721|ref|YP_001020725.1| 30S ribosomal protein S18 [Methylibium petroleiphilum PM1]
 gi|166220959|sp|A2SG01|RS18_METPP RecName: Full=30S ribosomal protein S18
 gi|124259496|gb|ABM94490.1| SSU ribosomal protein S18P [Methylibium petroleiphilum PM1]
          Length = 96

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +  G   IDYKD+  L  F+++ GKI P+R++      QR+L+  IKRAR+L 
Sbjct: 27 RKRFCRFTVTGVTEIDYKDVDTLRDFIAENGKITPARLTGTRAFFQRQLSTCIKRARFLA 86

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 87 LLPYSD 92


>gi|312898031|ref|ZP_07757437.1| ribosomal protein S18 [Megasphaera micronuciformis F0359]
 gi|310620856|gb|EFQ04410.1| ribosomal protein S18 [Megasphaera micronuciformis F0359]
          Length = 76

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 37/63 (58%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD   L RF ++RGKI+P R+S V  K QR+L  AIKRAR + L+
Sbjct: 12 KVCNFCVDHIEEIDYKDTAKLRRFTTERGKILPRRVSGVCAKHQRKLTVAIKRARAIALL 71

Query: 79 AYV 81
           Y 
Sbjct: 72 PYT 74


>gi|108803692|ref|YP_643629.1| 30S ribosomal protein S18P [Rubrobacter xylanophilus DSM 9941]
 gi|122976088|sp|Q1AXR1|RS18_RUBXD RecName: Full=30S ribosomal protein S18
 gi|108764935|gb|ABG03817.1| SSU ribosomal protein S18P [Rubrobacter xylanophilus DSM 9941]
          Length = 81

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 42/67 (62%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S ++K C    +    +DYKD  +L RF S+RGKI   R++ +  + QRE A+AIKRAR 
Sbjct: 12 SGKKKVCVFCKENIEYVDYKDYNMLRRFTSERGKIRARRVTGLCPQHQRETARAIKRARE 71

Query: 75 LGLIAYV 81
          + L+ Y+
Sbjct: 72 MALLPYI 78


>gi|307244733|ref|ZP_07526835.1| ribosomal protein S18 [Peptostreptococcus stomatis DSM 17678]
 gi|306491910|gb|EFM63961.1| ribosomal protein S18 [Peptostreptococcus stomatis DSM 17678]
          Length = 75

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 40/61 (65%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C      + +IDYK+++ L +++++RGKI+P RI+    K QRE+ KAIK AR + L+ Y
Sbjct: 13 CQFCADKSTKIDYKNVQKLEKYVTERGKILPRRITGTCAKHQREVTKAIKLARNVALLPY 72

Query: 81 V 81
           
Sbjct: 73 T 73


>gi|23335650|ref|ZP_00120884.1| COG0238: Ribosomal protein S18 [Bifidobacterium longum DJO10A]
 gi|23465012|ref|NP_695615.1| 30S ribosomal protein S18 [Bifidobacterium longum NCC2705]
 gi|189440079|ref|YP_001955160.1| 30S ribosomal protein S18 [Bifidobacterium longum DJO10A]
 gi|213691157|ref|YP_002321743.1| ribosomal protein S18 [Bifidobacterium longum subsp. infantis
          ATCC 15697]
 gi|227545708|ref|ZP_03975757.1| ribosomal protein S18 [Bifidobacterium longum subsp. infantis
          ATCC 55813]
 gi|239622618|ref|ZP_04665649.1| 30S ribosomal protein S18 [Bifidobacterium longum subsp. infantis
          CCUG 52486]
 gi|296453411|ref|YP_003660554.1| 30S ribosomal protein S18 [Bifidobacterium longum subsp. longum
          JDM301]
 gi|312133417|ref|YP_004000756.1| rpsr [Bifidobacterium longum subsp. longum BBMN68]
 gi|317482747|ref|ZP_07941759.1| ribosomal protein S18 [Bifidobacterium sp. 12_1_47BFAA]
 gi|322688391|ref|YP_004208125.1| 30S ribosomal protein S18 [Bifidobacterium longum subsp. infantis
          157F]
 gi|322690411|ref|YP_004219981.1| 30S ribosomal protein S18 [Bifidobacterium longum subsp. longum
          JCM 1217]
 gi|59798916|sp|Q8G758|RS18_BIFLO RecName: Full=30S ribosomal protein S18
 gi|23325614|gb|AAN24251.1| 30S ribosomal protein S18-2 [Bifidobacterium longum NCC2705]
 gi|189428514|gb|ACD98662.1| Ribosomal protein S18 [Bifidobacterium longum DJO10A]
 gi|213522618|gb|ACJ51365.1| ribosomal protein S18 [Bifidobacterium longum subsp. infantis
          ATCC 15697]
 gi|227213824|gb|EEI81663.1| ribosomal protein S18 [Bifidobacterium longum subsp. infantis
          ATCC 55813]
 gi|239514615|gb|EEQ54482.1| 30S ribosomal protein S18 [Bifidobacterium longum subsp. infantis
          CCUG 52486]
 gi|291517548|emb|CBK71164.1| SSU ribosomal protein S18P [Bifidobacterium longum subsp. longum
          F8]
 gi|296182842|gb|ADG99723.1| ribosomal protein S18 [Bifidobacterium longum subsp. longum
          JDM301]
 gi|311772646|gb|ADQ02134.1| RpsR [Bifidobacterium longum subsp. longum BBMN68]
 gi|316915782|gb|EFV37192.1| ribosomal protein S18 [Bifidobacterium sp. 12_1_47BFAA]
 gi|320455267|dbj|BAJ65889.1| 30S ribosomal protein S18 [Bifidobacterium longum subsp. longum
          JCM 1217]
 gi|320457215|dbj|BAJ67836.1| 30S ribosomal protein S18 [Bifidobacterium longum subsp. infantis
          ATCC 15697]
 gi|320459727|dbj|BAJ70347.1| 30S ribosomal protein S18 [Bifidobacterium longum subsp. infantis
          157F]
          Length = 82

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 38/52 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD+ LL +F+S RGKI   RI+ V+ ++QREL+KAIK AR + L+ Y  
Sbjct: 28 IDYKDVALLRKFISDRGKIRSRRITGVTVQEQRELSKAIKNAREMALLPYAT 79


>gi|302334831|ref|YP_003800038.1| SSU ribosomal protein S18P [Olsenella uli DSM 7084]
 gi|301318671|gb|ADK67158.1| SSU ribosomal protein S18P [Olsenella uli DSM 7084]
          Length = 90

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C    +    IDYKD +LL ++++ RGKI P R++    + Q ++A AIKRAR + 
Sbjct: 13 RRKYCQFCKEDVEFIDYKDTQLLRKYMTDRGKIKPRRVTGACTQHQHDIAVAIKRAREMA 72

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 73 LLPYT 77


>gi|158319096|ref|YP_001511603.1| ribosomal protein S18 [Alkaliphilus oremlandii OhILAs]
 gi|205556770|sp|A8MED6|RS18_ALKOO RecName: Full=30S ribosomal protein S18
 gi|158139295|gb|ABW17607.1| ribosomal protein S18 [Alkaliphilus oremlandii OhILAs]
          Length = 78

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C      +  IDYKD+  L +++++RGKI+P RIS      QREL +AIKR+R++ L+ Y
Sbjct: 16 CVFCADKSKNIDYKDVHKLKKYITERGKILPRRISGNCAIHQRELTQAIKRSRHIALLPY 75

Query: 81 V 81
           
Sbjct: 76 T 76


>gi|295133966|ref|YP_003584642.1| 30S ribosomal protein S18 [Zunongwangia profunda SM-A87]
 gi|294981981|gb|ADF52446.1| 30S ribosomal protein S18 [Zunongwangia profunda SM-A87]
          Length = 99

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL     S  +K C     G   IDYKD   L  F++++GK++P R++  S K QR++A
Sbjct: 21 TPL-NIETSKTKKYCRFKRSGIKYIDYKDPDFLMSFVNEQGKLLPRRLTGTSLKYQRKVA 79

Query: 67 KAIKRARYLGLIAYVN 82
           A+KRAR+L L+ YV 
Sbjct: 80 VAVKRARHLALMPYVG 95


>gi|83816823|ref|YP_445490.1| ribosomal protein S18 [Salinibacter ruber DSM 13855]
 gi|294507376|ref|YP_003571434.1| 30S ribosomal protein S18 [Salinibacter ruber M8]
 gi|123726178|sp|Q2S2U1|RS18_SALRD RecName: Full=30S ribosomal protein S18
 gi|83758217|gb|ABC46330.1| ribosomal protein S18 [Salinibacter ruber DSM 13855]
 gi|294343704|emb|CBH24482.1| 30S ribosomal protein S18 [Salinibacter ruber M8]
          Length = 70

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 39/52 (75%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          +DYKD   L +F++ +GKI+P R++ V  + QR++ KAIKRAR+L L+ YV+
Sbjct: 15 VDYKDTEFLEQFINNQGKILPRRVTGVPARVQRQITKAIKRARHLALMPYVS 66


>gi|288926386|ref|ZP_06420308.1| ribosomal protein S18 [Prevotella buccae D17]
 gi|315608713|ref|ZP_07883691.1| 30S ribosomal protein S18 [Prevotella buccae ATCC 33574]
 gi|288336839|gb|EFC75203.1| ribosomal protein S18 [Prevotella buccae D17]
 gi|315249563|gb|EFU29574.1| 30S ribosomal protein S18 [Prevotella buccae ATCC 33574]
          Length = 90

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 39/55 (70%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYV 85


>gi|11467816|ref|NP_050867.1| ribosomal protein S18 [Nephroselmis olivacea]
 gi|20978742|sp|Q9TKX8|RR18_NEPOL RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|5880745|gb|AAD54838.1|AF137379_61 ribosomal protein S18 [Nephroselmis olivacea]
          Length = 73

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 48/68 (70%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S RR +   + +   RIDYK++ LL +FL++ GKI+P R++ ++ K+QR + +AIK+AR 
Sbjct: 5  SRRRLAKLANAQIDDRIDYKNVDLLRQFLTEEGKILPRRVTGLTAKQQRGMTRAIKQARI 64

Query: 75 LGLIAYVN 82
          + L+ +++
Sbjct: 65 MALLEFIH 72


>gi|253573878|ref|ZP_04851220.1| ribosomal protein S18 [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251846355|gb|EES74361.1| ribosomal protein S18 [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 89

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +      IDYKD  LL +F+S+RGKI+P R++  S K QR L  AIKR+R + L+ Y
Sbjct: 27 CYFTVNKITHIDYKDTELLKKFISERGKILPRRVTGTSAKYQRLLTIAIKRSRQIALLPY 86

Query: 81 VN 82
            
Sbjct: 87 TT 88


>gi|291455937|ref|ZP_06595327.1| ribosomal protein S18 [Bifidobacterium breve DSM 20213]
 gi|291382346|gb|EFE89864.1| ribosomal protein S18 [Bifidobacterium breve DSM 20213]
          Length = 82

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 38/52 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD+ LL +F+S RGKI   RI+ V+ ++QREL+KAIK AR + L+ Y  
Sbjct: 28 IDYKDVALLRKFISDRGKIRSRRITGVTVQEQRELSKAIKNAREMALLPYAT 79


>gi|326802630|ref|YP_004320448.1| ribosomal protein S18 [Aerococcus urinae ACS-120-V-Col10a]
 gi|326651036|gb|AEA01219.1| ribosomal protein S18 [Aerococcus urinae ACS-120-V-Col10a]
          Length = 79

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 37/63 (58%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD  LL+R++S +GKI+P R++    K QR L  AIKRAR + L+
Sbjct: 14 KVCFFCANHMDFIDYKDTDLLSRYVSDKGKILPRRVTGTCAKHQRTLTSAIKRARIMALL 73

Query: 79 AYV 81
           + 
Sbjct: 74 PFT 76


>gi|312879778|ref|ZP_07739578.1| SSU ribosomal protein S18P [Aminomonas paucivorans DSM 12260]
 gi|310783069|gb|EFQ23467.1| SSU ribosomal protein S18P [Aminomonas paucivorans DSM 12260]
          Length = 80

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C        R+DYK+   L +++++RGKIVP R++    K QR+L +AIKRAR L L+
Sbjct: 16 KVCHFCVDKVQRVDYKEFEKLRKYVTERGKIVPRRVTGTCAKHQRQLTRAIKRARILALL 75

Query: 79 AYV 81
           + 
Sbjct: 76 PFT 78


>gi|220927516|ref|YP_002504425.1| 30S ribosomal protein S18 [Clostridium cellulolyticum H10]
 gi|326202835|ref|ZP_08192702.1| ribosomal protein S18 [Clostridium papyrosolvens DSM 2782]
 gi|219997844|gb|ACL74445.1| ribosomal protein S18 [Clostridium cellulolyticum H10]
 gi|325986912|gb|EGD47741.1| ribosomal protein S18 [Clostridium papyrosolvens DSM 2782]
          Length = 97

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K C      A  IDYKD+  + +++S+RGKI+P RIS    K QR+L  A+KRAR++ 
Sbjct: 31 KKKVCSFCVDKATDIDYKDVAKIRKYVSERGKILPRRISGNCAKHQRQLTVAVKRARHIA 90

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 91 LLPYT 95


>gi|332654781|ref|ZP_08420523.1| ribosomal protein S18 [Ruminococcaceae bacterium D16]
 gi|332516124|gb|EGJ45732.1| ribosomal protein S18 [Ruminococcaceae bacterium D16]
          Length = 79

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (57%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C         IDYKD   L R+ S+RGKI+P R +      QR+L +AIKRAR + 
Sbjct: 13 RRKVCAFCVDKVECIDYKDAAKLRRYTSERGKILPRRTTGTCAMHQRQLTEAIKRARQVA 72

Query: 77 LIAYVN 82
          L+ YV 
Sbjct: 73 LLPYVT 78


>gi|172040219|ref|YP_001799933.1| 30S ribosomal protein S18 [Corynebacterium urealyticum DSM 7109]
 gi|229559980|sp|B1VFG0|RS18_CORU7 RecName: Full=30S ribosomal protein S18
 gi|171851523|emb|CAQ04499.1| 30S ribosomal protein S18 [Corynebacterium urealyticum DSM 7109]
          Length = 82

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (66%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S R K  PL  +G  ++DYK+  LL +F+S RGKI   R++ ++ ++QRE+A AIK AR 
Sbjct: 14 SRRPKKNPLKAEGIEQVDYKNYALLRKFISDRGKIRSRRVTGLTPQQQREVATAIKNARE 73

Query: 75 LGLIAY 80
          + L+ +
Sbjct: 74 MALLPF 79


>gi|297545636|ref|YP_003677938.1| 30S ribosomal protein S18 [Thermoanaerobacter mathranii subsp.
          mathranii str. A3]
 gi|296843411|gb|ADH61927.1| ribosomal protein S18 [Thermoanaerobacter mathranii subsp.
          mathranii str. A3]
          Length = 89

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C        +IDYKD+  L +++++RGKI+P RI+    + QR+L +AIKRAR + L+ Y
Sbjct: 27 CAFCTDNIDKIDYKDVARLRKYITERGKILPRRITGNCARHQRQLTRAIKRARQIALLPY 86

Query: 81 V 81
           
Sbjct: 87 T 87


>gi|237785093|ref|YP_002905798.1| 30S ribosomal protein S18 [Corynebacterium kroppenstedtii DSM
          44385]
 gi|259494804|sp|C4LHF0|RS18_CORK4 RecName: Full=30S ribosomal protein S18
 gi|237758005|gb|ACR17255.1| 30S ribosomal protein S18 [Corynebacterium kroppenstedtii DSM
          44385]
          Length = 82

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 44/68 (64%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + R K  PL  +G   +DYKDI  L  F+S+RGKI   R++ ++ ++QR++A A+K AR 
Sbjct: 14 TRRPKKNPLKARGIEAVDYKDIETLRTFISERGKIRSRRVTGLTPQQQRQVATAVKNARE 73

Query: 75 LGLIAYVN 82
          + L+ + +
Sbjct: 74 MALLPFTS 81


>gi|83589003|ref|YP_429012.1| 30S ribosomal protein S18 [Moorella thermoacetica ATCC 39073]
 gi|123753003|sp|Q2RM70|RS18_MOOTA RecName: Full=30S ribosomal protein S18
 gi|83571917|gb|ABC18469.1| SSU ribosomal protein S18P [Moorella thermoacetica ATCC 39073]
          Length = 75

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 38/61 (62%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C        ++DYKD+  L R++S+RGKI+P RIS      QR+L +AIKRAR L L+ Y
Sbjct: 13 CSFCVDKIEQVDYKDVNRLRRYISERGKILPRRISGNCAHHQRQLTRAIKRARALALLPY 72

Query: 81 V 81
           
Sbjct: 73 T 73


>gi|239918783|ref|YP_002958341.1| SSU ribosomal protein S18P [Micrococcus luteus NCTC 2665]
 gi|281414991|ref|ZP_06246733.1| 30S ribosomal protein S18 [Micrococcus luteus NCTC 2665]
 gi|289706693|ref|ZP_06503041.1| ribosomal protein S18 [Micrococcus luteus SK58]
 gi|259494814|sp|C5C7U9|RS18_MICLC RecName: Full=30S ribosomal protein S18
 gi|239839990|gb|ACS31787.1| SSU ribosomal protein S18P [Micrococcus luteus NCTC 2665]
 gi|289556613|gb|EFD49956.1| ribosomal protein S18 [Micrococcus luteus SK58]
          Length = 79

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 42/64 (65%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          KS PL       IDYKD+ LL +F+S RGKI   R++ V+ ++QR++A+A+K AR + L+
Sbjct: 12 KSNPLKAAKITEIDYKDVALLRKFISDRGKIRARRVTGVTVQEQRKIAQAVKNAREVALL 71

Query: 79 AYVN 82
           Y  
Sbjct: 72 PYAG 75


>gi|94971562|ref|YP_593610.1| 30S ribosomal protein S18 [Candidatus Koribacter versatilis
           Ellin345]
 gi|123079320|sp|Q1IHW4|RS18_ACIBL RecName: Full=30S ribosomal protein S18
 gi|94553612|gb|ABF43536.1| SSU ribosomal protein S18P [Candidatus Koribacter versatilis
           Ellin345]
          Length = 123

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 44/71 (61%)

Query: 12  RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
           R    R+K C    +    IDYKD+RLL +F+++ GKIVP R++ V    QR L+ AIK+
Sbjct: 51  RKFFRRKKVCKFCVEKIDAIDYKDVRLLGQFVAESGKIVPRRLTGVCTPHQRRLSDAIKQ 110

Query: 72  ARYLGLIAYVN 82
           AR + L+ + +
Sbjct: 111 ARNIALLPFAS 121


>gi|118579197|ref|YP_900447.1| 30S ribosomal protein S18 [Pelobacter propionicus DSM 2379]
 gi|166220968|sp|A1AM19|RS18_PELPD RecName: Full=30S ribosomal protein S18
 gi|118501907|gb|ABK98389.1| SSU ribosomal protein S18P [Pelobacter propionicus DSM 2379]
          Length = 94

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (61%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK C    +    IDYK+ R L  F+++RGKIVP RIS      QRE+ +AIKRAR L
Sbjct: 23 QRRKVCRFCAEKNLTIDYKEPRTLRYFITERGKIVPRRISGNCSAHQREITEAIKRARNL 82

Query: 76 GLI 78
           L+
Sbjct: 83 ALL 85


>gi|18860333|ref|NP_569651.1| ribosomal protein S18 [Psilotum nudum]
 gi|20978677|sp|Q8WHZ9|RR18_PSINU RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|18389486|dbj|BAB84238.1| ribosomal protein S18 [Psilotum nudum]
          Length = 75

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 40/52 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYK+I LL RF+S+RGKI+  R++ ++ K+QR +  +IKRAR L L+ ++N
Sbjct: 21 IDYKNIDLLRRFISERGKILSRRMTKLTSKQQRSVTVSIKRARILALLPFIN 72


>gi|289579513|ref|YP_003478140.1| ribosomal protein S18 [Thermoanaerobacter italicus Ab9]
 gi|289529226|gb|ADD03578.1| ribosomal protein S18 [Thermoanaerobacter italicus Ab9]
          Length = 89

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C        +IDYKD+  L +++++RGKI+P RI+    + QR+L +AIKRAR + L+ Y
Sbjct: 27 CAFCTDNIDKIDYKDVARLRKYITERGKILPRRITGNCARHQRQLTRAIKRARQIALLPY 86

Query: 81 V 81
           
Sbjct: 87 T 87


>gi|54020444|ref|YP_115817.1| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae 232]
 gi|161611220|ref|YP_279087.2| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae J]
 gi|161611227|ref|YP_287690.2| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae 7448]
 gi|59798622|sp|Q600Z8|RS18_MYCH2 RecName: Full=30S ribosomal protein S18
 gi|166221070|sp|Q4A872|RS18_MYCH7 RecName: Full=30S ribosomal protein S18
 gi|166221071|sp|Q4AA45|RS18_MYCHJ RecName: Full=30S ribosomal protein S18
 gi|53987617|gb|AAV27818.1| 30s ribosomal protein S18 [Mycoplasma hyopneumoniae 232]
 gi|144227556|gb|AAZ44376.2| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae J]
 gi|144575366|gb|AAZ53667.2| 30s ribosomal protein S18 [Mycoplasma hyopneumoniae 7448]
          Length = 87

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKDI +L RF++  GKI PSRI+    K QR+LA A+KRAR++ L+ ++
Sbjct: 24 IDYKDIEVLQRFINTFGKIQPSRITGNCAKHQRKLALAVKRARFVALLPFI 74


>gi|229915459|gb|ACQ90804.1| ribosomal protein S18 [Oocystis solitaria]
          Length = 95

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 39/51 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYK++ LL +FL+  GKI+P R+S ++ K+QR ++KAIK AR +G I Y+
Sbjct: 37 IDYKNVVLLRKFLTAEGKILPRRVSGLNAKQQRYMSKAIKNARMIGFIPYI 87


>gi|307683491|dbj|BAJ19724.1| ribosomal protein S18 [Pseudotsuga sinensis var. wilsoniana]
          Length = 86

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 51/76 (67%), Gaps = 1/76 (1%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P    RRN++  R+     G G  RIDYK++ L++RF+S++GKI+  R++ ++ K+QR +
Sbjct: 8  PKRSFRRNLTPIRRHLSPIGSGD-RIDYKNMSLISRFISEQGKILSGRVNRLTSKQQRLM 66

Query: 66 AKAIKRARYLGLIAYV 81
            AIKRAR L L+ ++
Sbjct: 67 TNAIKRARILSLLPFL 82


>gi|325291432|ref|YP_004267613.1| SSU ribosomal protein S18P [Syntrophobotulus glycolicus DSM 8271]
 gi|324966833|gb|ADY57612.1| SSU ribosomal protein S18P [Syntrophobotulus glycolicus DSM 8271]
          Length = 81

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C         IDYKD+  L +++++RGKI+P RIS    K QRE+  AIKRAR + 
Sbjct: 15 RKRVCSFCVDKVTEIDYKDLPKLRKYVTERGKILPRRISGNCAKHQREVTIAIKRARSIA 74

Query: 77 LIAYV 81
          L+ YV
Sbjct: 75 LLPYV 79


>gi|121535339|ref|ZP_01667151.1| ribosomal protein S18 [Thermosinus carboxydivorans Nor1]
 gi|121306031|gb|EAX46961.1| ribosomal protein S18 [Thermosinus carboxydivorans Nor1]
          Length = 76

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K C        R+DYKD+  L RF+++RGKI+P RIS    + QR+L  AIKRAR + 
Sbjct: 10 KKKVCSFCVDKIERVDYKDVPRLRRFITERGKILPRRISGNCARHQRQLTLAIKRARNMA 69

Query: 77 LIAYV 81
          L+ + 
Sbjct: 70 LLPFT 74


>gi|238809826|dbj|BAH69616.1| hypothetical protein [Mycoplasma fermentans PG18]
          Length = 97

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 40/66 (60%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + RR+ C    +    +DYKD+  L++F++  G+I P   +    K QR++A AIKRAR+
Sbjct: 23 NFRRRRCETCDQKLTYVDYKDVEFLSKFITATGQIKPHSATGACAKDQRKIANAIKRARF 82

Query: 75 LGLIAY 80
          + LI Y
Sbjct: 83 MALIPY 88


>gi|225848304|ref|YP_002728467.1| ribosomal protein S18 [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644141|gb|ACN99191.1| ribosomal protein S18 [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 76

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 3/66 (4%)

Query: 17 RRKSCPLSG-KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          R+K C     K  P  +YKD+ +L  F+S+RG+I+P RIS    K QR+L+  IK+AR L
Sbjct: 11 RKKYCKFCAEKKEP--NYKDVEMLKEFISERGRIIPRRISGTCAKHQRKLSVEIKKARQL 68

Query: 76 GLIAYV 81
           LI YV
Sbjct: 69 ALIPYV 74


>gi|302546721|ref|ZP_07299063.1| ribosomal protein S18 [Streptomyces hygroscopicus ATCC 53653]
 gi|302464339|gb|EFL27432.1| ribosomal protein S18 [Streptomyces himastatinicus ATCC 53653]
          Length = 80

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 5/77 (6%)

Query: 9  LLRRNVSHRRKS-----CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          + RR  S RR +      PL   G   +DYK+  LL +F+S RGKI   R++ V+ ++QR
Sbjct: 1  MARRATSDRRGAKRPRVNPLDAAGITYVDYKNTDLLRKFISDRGKIRSPRVTHVTRQQQR 60

Query: 64 ELAKAIKRARYLGLIAY 80
          ++A+AIK AR + L+ Y
Sbjct: 61 QIARAIKNAREMALLPY 77


>gi|291285953|ref|YP_003502769.1| 30S ribosomal protein S18 [Denitrovibrio acetiphilus DSM 12809]
 gi|290883113|gb|ADD66813.1| ribosomal protein S18 [Denitrovibrio acetiphilus DSM 12809]
          Length = 76

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 43/65 (66%), Gaps = 1/65 (1%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           R+K C    +    IDYKD++LL +F+++RGKI+P R++    + QR+LA A+K AR +
Sbjct: 9  QRKKVCRFCTETID-IDYKDVKLLRQFVTERGKIMPRRLTGTCARHQRQLATAVKTARII 67

Query: 76 GLIAY 80
           L+ +
Sbjct: 68 ALLPF 72


>gi|116672660|ref|YP_833593.1| 30S ribosomal protein S18 [Arthrobacter sp. FB24]
 gi|119961039|ref|YP_949830.1| 30S ribosomal protein S18 [Arthrobacter aurescens TC1]
 gi|220914622|ref|YP_002489931.1| 30S ribosomal protein S18 [Arthrobacter chlorophenolicus A6]
 gi|325965247|ref|YP_004243153.1| 30S ribosomal protein S18P [Arthrobacter phenanthrenivorans
          Sphe3]
 gi|205556877|sp|A1RC68|RS18_ARTAT RecName: Full=30S ribosomal protein S18
 gi|205556887|sp|A0K2H3|RS18_ARTS2 RecName: Full=30S ribosomal protein S18
 gi|254765405|sp|B8H839|RS18_ARTCA RecName: Full=30S ribosomal protein S18
 gi|116612769|gb|ABK05493.1| SSU ribosomal protein S18P [Arthrobacter sp. FB24]
 gi|119947898|gb|ABM06809.1| ribosomal protein S18 [Arthrobacter aurescens TC1]
 gi|219861500|gb|ACL41842.1| ribosomal protein S18 [Arthrobacter chlorophenolicus A6]
 gi|323471334|gb|ADX75019.1| SSU ribosomal protein S18P [Arthrobacter phenanthrenivorans
          Sphe3]
          Length = 79

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 42/62 (67%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          KS PL       IDYKD+ LL +F+S RGKI   R++ V+ ++QR++A+AIK AR + L+
Sbjct: 12 KSNPLKAADITVIDYKDVALLRKFISDRGKIRARRVTGVTVQEQRKIAQAIKNAREVALL 71

Query: 79 AY 80
           Y
Sbjct: 72 PY 73


>gi|300870579|ref|YP_003785450.1| 30S ribosomal protein S18 [Brachyspira pilosicoli 95/1000]
 gi|300688278|gb|ADK30949.1| 30S ribosomal protein S18 [Brachyspira pilosicoli 95/1000]
          Length = 114

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%)

Query: 3   EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
           EV       R    ++K C         +DYKDI+LL +++ + GKI+P R++    K Q
Sbjct: 33  EVNEKDAASRKKFFKKKICYFCKNNIDVLDYKDIKLLKKYVKESGKIIPKRLNGTCSKHQ 92

Query: 63  RELAKAIKRARYLGLIAY 80
           R + KAIKRAR + L+ Y
Sbjct: 93  RLVTKAIKRARNIALLPY 110


>gi|329935150|ref|ZP_08285141.1| 30S ribosomal protein S18 [Streptomyces griseoaurantiacus M045]
 gi|329305219|gb|EGG49077.1| 30S ribosomal protein S18 [Streptomyces griseoaurantiacus M045]
          Length = 78

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 43/67 (64%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          ++ + +  PL   G   IDYKD  LL +F+S RGKI   R++ V+ ++QR++A A+K AR
Sbjct: 9  LARKNRPNPLDAAGITYIDYKDTDLLRKFISDRGKIRSRRVTRVNRQQQRQIATAVKNAR 68

Query: 74 YLGLIAY 80
           + L+ Y
Sbjct: 69 EMALLPY 75


>gi|291521978|emb|CBK80271.1| SSU ribosomal protein S18P [Coprococcus catus GD/7]
          Length = 87

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 37/51 (72%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYKD   L R++S+RGKI+P RI+    K QR+L  AIKRAR++ L+ Y+
Sbjct: 35 IDYKDTNKLKRYISERGKILPRRITGNCAKHQRKLTTAIKRARHIALMPYI 85


>gi|163842243|ref|YP_001626648.1| 30S ribosomal protein S18 [Renibacterium salmoninarum ATCC 33209]
 gi|205616911|sp|A9WVL3|RS18_RENSM RecName: Full=30S ribosomal protein S18
 gi|162955719|gb|ABY25234.1| SSU ribosomal protein S18P [Renibacterium salmoninarum ATCC
          33209]
          Length = 79

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 42/62 (67%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          KS PL       IDYKD+ LL +F+S RGKI   R++ V+ ++QR++A+AIK AR + L+
Sbjct: 12 KSNPLKAADITVIDYKDVALLRKFISDRGKIRARRVTGVTVQEQRKIAQAIKNAREVALL 71

Query: 79 AY 80
           Y
Sbjct: 72 PY 73


>gi|290487260|gb|ADD30014.1| ribosomal protein S18 [Bulnesia arborea]
          Length = 105

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 49/68 (72%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S RR+  P+  +   RIDY+++ LLNRFLS++GKI+  R++ ++ K+QR +  AIK+AR 
Sbjct: 14 SFRRRLPPI--QSGDRIDYRNLSLLNRFLSEQGKILSRRVNRLTLKQQRLVTIAIKQARI 71

Query: 75 LGLIAYVN 82
          L L+ ++N
Sbjct: 72 LSLLPFMN 79


>gi|217076742|ref|YP_002334458.1| ribosomal protein S18 [Thermosipho africanus TCF52B]
 gi|217036595|gb|ACJ75117.1| ribosomal protein S18 [Thermosipho africanus TCF52B]
          Length = 74

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (60%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C L       +DYKDI+LL  FL+++ KI+P RI+    K QR +  AIKRAR + L+
Sbjct: 10 KVCKLCQSKVEYVDYKDIKLLREFLTEKEKIIPRRITGNCAKHQRMVKIAIKRARQMALL 69

Query: 79 AYVN 82
           YV 
Sbjct: 70 PYVK 73


>gi|294102403|ref|YP_003554261.1| ribosomal protein S18 [Aminobacterium colombiense DSM 12261]
 gi|293617383|gb|ADE57537.1| ribosomal protein S18 [Aminobacterium colombiense DSM 12261]
          Length = 87

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    R K C         +DYKD+  L +++S+RGKI+P R++    K QR+L  AIK
Sbjct: 15 RRGGKRRPKVCFYCVDKIDYVDYKDVERLRKYISERGKIMPRRVTGNCAKHQRQLTTAIK 74

Query: 71 RARYLGLIAY 80
          RAR++ L+ Y
Sbjct: 75 RARFMALLPY 84


>gi|227824505|ref|ZP_03989337.1| 30S ribosomal protein S18 [Acidaminococcus sp. D21]
 gi|226905004|gb|EEH90922.1| 30S ribosomal protein S18 [Acidaminococcus sp. D21]
          Length = 79

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 38/62 (61%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD+  L +F+++RGKI+P RI+    K QR+L  AIKRAR + L+
Sbjct: 15 KVCSFCVDKVEEIDYKDVAKLRKFITERGKILPRRITGTCAKHQRQLTIAIKRARNVALL 74

Query: 79 AY 80
           +
Sbjct: 75 PF 76


>gi|148269458|ref|YP_001243918.1| 30S ribosomal protein S18 [Thermotoga petrophila RKU-1]
 gi|281411824|ref|YP_003345903.1| ribosomal protein S18 [Thermotoga naphthophila RKU-10]
 gi|166222254|sp|A5IJG9|RS18_THEP1 RecName: Full=30S ribosomal protein S18
 gi|147735002|gb|ABQ46342.1| SSU ribosomal protein S18P [Thermotoga petrophila RKU-1]
 gi|281372927|gb|ADA66489.1| ribosomal protein S18 [Thermotoga naphthophila RKU-10]
          Length = 75

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (71%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          +DYKD RLL+ FL+ +GKI+P R++    K QR +  AIKRAR +GL+ Y+ +
Sbjct: 23 VDYKDTRLLSEFLTDKGKIIPKRLTGNCSKHQRMVKVAIKRARQMGLLPYLKI 75


>gi|297154862|gb|ADI04574.1| 30S ribosomal protein S18 [Streptomyces bingchenggensis BCW-1]
          Length = 80

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (62%), Gaps = 5/75 (6%)

Query: 11 RRNVSHRRKS-----CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          RR+ + RR S      PL   G   +DYK+  LL +F+S RGKI   R++ V+ ++QR++
Sbjct: 3  RRSTTDRRTSKRPRVNPLDAAGITYVDYKNTDLLRKFISDRGKIRSRRVTHVTRQQQRQI 62

Query: 66 AKAIKRARYLGLIAY 80
          ++AIK AR + L+ Y
Sbjct: 63 SRAIKNAREMALLPY 77


>gi|300087857|ref|YP_003758379.1| 30S ribosomal protein S18 [Dehalogenimonas lykanthroporepellens
          BL-DC-9]
 gi|299527590|gb|ADJ26058.1| ribosomal protein S18 [Dehalogenimonas lykanthroporepellens
          BL-DC-9]
          Length = 153

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 39/65 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C         IDYKD   L+R++S+RGKI P R S    K QR LA AIK+AR + 
Sbjct: 27 RRKVCAFCADKNLVIDYKDTARLSRYISERGKINPRRRSGTCAKHQRALANAIKQARMIA 86

Query: 77 LIAYV 81
          L+ +V
Sbjct: 87 LLPFV 91


>gi|167754091|ref|ZP_02426218.1| hypothetical protein ALIPUT_02379 [Alistipes putredinis DSM
          17216]
 gi|167658716|gb|EDS02846.1| hypothetical protein ALIPUT_02379 [Alistipes putredinis DSM
          17216]
          Length = 92

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 41/55 (74%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          G   +DYKD   L +FL+++GKI+P R++  S K Q+++A+A+KRAR+L ++ +V
Sbjct: 33 GIKYVDYKDGEFLKKFLNEQGKILPRRLTGTSQKFQKKVAQAVKRARHLAILPFV 87


>gi|323149196|ref|YP_004222025.1| ribosomal protein S18 [Coccomyxa sp. C-169]
 gi|317467252|gb|ADV29873.1| ribosomal protein S18 [Coccomyxa sp. C-169]
          Length = 95

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +++S P S      IDYK+I LL +F++  GKI+P R S ++ K+QR +A+AIK AR +G
Sbjct: 23 QKRSRPKSPTFQGTIDYKNIVLLRKFITAEGKILPRRSSLLTAKQQRYMARAIKNARIMG 82

Query: 77 LIAYVN 82
          L+ ++N
Sbjct: 83 LLPFIN 88


>gi|268609247|ref|ZP_06142974.1| 30S ribosomal protein S18 [Ruminococcus flavefaciens FD-1]
          Length = 80

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 41/66 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C        RIDYKD+  L + +++R KI+P R++      QREL  AIKRAR++ 
Sbjct: 14 RKKVCMFCADRIERIDYKDLAKLRKCMTERAKILPRRVTGTCAFHQRELTVAIKRARHIA 73

Query: 77 LIAYVN 82
          L+ Y++
Sbjct: 74 LLPYIS 79


>gi|294340686|emb|CAZ89078.1| putative 30S ribosomal protein S18 RpsR [Thiomonas sp. 3As]
          Length = 96

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 43/67 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++ C  +     +IDYKD+ +L   +++  +I+P+R++  S   QR+L  AIKRAR+L 
Sbjct: 27 RKRFCRFTVAKVEQIDYKDVDVLKDLIAENARIIPARLTGTSAHYQRQLNTAIKRARFLA 86

Query: 77 LIAYVNL 83
          L+ Y +L
Sbjct: 87 LLPYTDL 93


>gi|308189828|ref|YP_003922759.1| 30S ribosomal protein S18 [Mycoplasma fermentans JER]
 gi|319777043|ref|YP_004136694.1| 30S ribosomal protein s18 [Mycoplasma fermentans M64]
 gi|307624570|gb|ADN68875.1| 30S ribosomal protein S18 [Mycoplasma fermentans JER]
 gi|318038118|gb|ADV34317.1| 30S ribosomal protein S18 [Mycoplasma fermentans M64]
          Length = 84

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 40/66 (60%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + RR+ C    +    +DYKD+  L++F++  G+I P   +    K QR++A AIKRAR+
Sbjct: 10 NFRRRRCETCDQKLTYVDYKDVEFLSKFITATGQIKPHSATGACAKDQRKIANAIKRARF 69

Query: 75 LGLIAY 80
          + LI Y
Sbjct: 70 MALIPY 75


>gi|126701289|ref|YP_001090186.1| 30S ribosomal protein S18 [Clostridium difficile 630]
 gi|254977322|ref|ZP_05273794.1| 30S ribosomal protein S18 [Clostridium difficile QCD-66c26]
 gi|255094653|ref|ZP_05324131.1| 30S ribosomal protein S18 [Clostridium difficile CIP 107932]
 gi|255102879|ref|ZP_05331856.1| 30S ribosomal protein S18 [Clostridium difficile QCD-63q42]
 gi|255308699|ref|ZP_05352870.1| 30S ribosomal protein S18 [Clostridium difficile ATCC 43255]
 gi|255316406|ref|ZP_05357989.1| 30S ribosomal protein S18 [Clostridium difficile QCD-76w55]
 gi|255519065|ref|ZP_05386741.1| 30S ribosomal protein S18 [Clostridium difficile QCD-97b34]
 gi|255652249|ref|ZP_05399151.1| 30S ribosomal protein S18 [Clostridium difficile QCD-37x79]
 gi|255657618|ref|ZP_05403027.1| 30S ribosomal protein S18 [Clostridium difficile QCD-23m63]
 gi|260685203|ref|YP_003216488.1| 30S ribosomal protein S18 [Clostridium difficile CD196]
 gi|260688862|ref|YP_003219996.1| 30S ribosomal protein S18 [Clostridium difficile R20291]
 gi|296452701|ref|ZP_06894392.1| 30S ribosomal protein S18 [Clostridium difficile NAP08]
 gi|296880045|ref|ZP_06904015.1| 30S ribosomal protein S18 [Clostridium difficile NAP07]
 gi|306521964|ref|ZP_07408311.1| 30S ribosomal protein S18 [Clostridium difficile QCD-32g58]
 gi|122973570|sp|Q181R4|RS18_CLOD6 RecName: Full=30S ribosomal protein S18
 gi|115252726|emb|CAJ70570.1| 30S ribosomal protein S18 [Clostridium difficile]
 gi|260211366|emb|CBA67007.1| 30S ribosomal protein S18 [Clostridium difficile CD196]
 gi|260214879|emb|CBE07674.1| 30S ribosomal protein S18 [Clostridium difficile R20291]
 gi|296258483|gb|EFH05387.1| 30S ribosomal protein S18 [Clostridium difficile NAP08]
 gi|296429022|gb|EFH14899.1| 30S ribosomal protein S18 [Clostridium difficile NAP07]
          Length = 75

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (60%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C        +IDYK  + L +++++RGKI+P RIS    K QREL  AIKRAR + L+ Y
Sbjct: 13 CQFCADKNAKIDYKSTQRLQKYITERGKILPRRISGTCAKHQRELTVAIKRARNIALLPY 72

Query: 81 V 81
           
Sbjct: 73 T 73


>gi|320109096|ref|YP_004184686.1| 30S ribosomal protein S18 [Terriglobus saanensis SP1PR4]
 gi|319927617|gb|ADV84692.1| ribosomal protein S18 [Terriglobus saanensis SP1PR4]
          Length = 127

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%)

Query: 12  RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
           R    R+K C    +   +I Y+D+RLL  F+++RGKIVP R++ V    QR+L+ AIK+
Sbjct: 55  RKFFRRKKVCKFCVEKIDQISYRDVRLLQGFVAERGKIVPRRLTGVCTTHQRQLSLAIKQ 114

Query: 72  ARYLGLIAYV 81
           AR + L+ + 
Sbjct: 115 ARNIALLPFA 124


>gi|46200044|ref|YP_005711.1| 30S ribosomal protein S18 [Thermus thermophilus HB27]
 gi|55980212|ref|YP_143509.1| 30S ribosomal protein S18 [Thermus thermophilus HB8]
 gi|50401372|sp|P62659|RS18_THET2 RecName: Full=30S ribosomal protein S18
 gi|62900938|sp|Q5SLQ0|RS18_THET8 RecName: Full=30S ribosomal protein S18
 gi|116668214|pdb|2J00|R Chain R, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Mrna, Trna And Paromomycin (Part 1 Of
          4). This File Contains The 30s Subunit, Mrna, A-, P-
          And E-Site Trnas And Paromomycin For Molecule I.
 gi|116668275|pdb|2J02|R Chain R, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Mrna, Trna And Paromomycin (Part 3 Of 4)
          This File Contains The 30s Subunit, Mrna, A-, P- And
          E-Site Trnas And Paromomycin For Molecule Ii.
 gi|149242725|pdb|2OW8|SS Chain s, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
          Functional Interactions And Rearrangements. This File,
          2ow8, Contains The 30s Ribosome Subunit, Two Trna, And
          Mrna Molecules. 50s Ribosome Subunit Is In The File
          1vsa.
 gi|149243635|pdb|2UU9|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit Complexed With A Valine-Asl With Cmo5u In
          Position 34 Bound To An Mrna With A Gug-Codon In The
          A-Site And Paromomycin.
 gi|149243662|pdb|2UUA|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit Complexed With A Valine-Asl With Cmo5u In
          Position 34 Bound To An Mrna With A Guc-Codon In The
          A-Site And Paromomycin.
 gi|149243689|pdb|2UUB|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit Complexed With A Valine-Asl With Cmo5u In
          Position 34 Bound To An Mrna With A Guu-Codon In The
          A-Site And Paromomycin.
 gi|149243716|pdb|2UUC|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit Complexed With A Valine-Asl With Cmo5u In
          Position 34 Bound To An Mrna With A Gua-Codon In The
          A-Site And Paromomycin.
 gi|149243855|pdb|2UXC|R Chain R, Crystal Structure Of An Extended Trna Anticodon Stem
          Loop In Complex With Its Cognate Mrna Ucgu In The
          Context Of The Thermus Thermophilus 30s Subunit.
 gi|157836425|pdb|2UXB|R Chain R, Crystal Structure Of An Extended Trna Anticodon Stem
          Loop In Complex With Its Cognate Mrna Gggu In The
          Context Of The Thermus Thermophilus 30s Subunit.
 gi|157836502|pdb|2V46|R Chain R, Structure Of The Ribosome Recycling Factor Bound To The
          Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe
          And Trna-Fmet (Part 1 Of 4). This File Contains The 30s
          Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For
          Molecule 1.
 gi|157836558|pdb|2V48|R Chain R, Structure Of The Ribosome Recycling Factor Bound To The
          Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe
          And Trna-Fmet (Part 3 Of 4). This File Contains The 30s
          Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For
          Molecule 2.
 gi|158430917|pdb|2UXD|R Chain R, Crystal Structure Of An Extended Trna Anticodon Stem
          Loop In Complex With Its Cognate Mrna Cggg In The
          Context Of The Thermus Thermophilus 30s Subunit.
 gi|160285956|pdb|2QNH|SS Chain s, Interactions And Dynamics Of The Shine-Dalgarno Helix In
          The 70s Ribosome. This File, 2qnh, Contains The 30s
          Ribosome Subunit, Two Trna, And Mrna Molecules. 50s
          Ribosome Subunit Is In The File 1vsp.
 gi|209156513|pdb|3D5A|R Chain R, Structural Basis For Translation Termination On The 70s
          Ribosome. This File Contains The 30s Subunit, Release
          Factor 1 (Rf1), Two Trna, And Mrna Molecules Of One 70s
          Ribosome. The Entire Crystal Structure Contains Two 70s
          Ribosomes As Described In Remark 400.
 gi|209156569|pdb|3D5C|R Chain R, Structural Basis For Translation Termination On The 70s
          Ribosome. This File Contains The 30s Subunit, Release
          Factor 1 (Rf1), Two Trna, And Mrna Molecules Of The
          Second 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes As Described In Remark 400.
 gi|211938836|pdb|2JL5|R Chain R, Insights Into Translational Termination From The
          Structure Of Rf2 Bound To The Ribosome (Part 1 Of 4).
          This File Contains The 30s Subunit.
 gi|211938894|pdb|2JL7|R Chain R, Insights Into Translational Termination From The
          Structure Of Rf2 Bound To The Ribosome (Part 3 Of 4).
          This File Contains The 30s Subunit.
 gi|218766790|pdb|3F1E|R Chain R, Crystal Structure Of A Translation Termination Complex
          Formed With Release Factor Rf2. This File Contains The
          30s Subunit, Rf2, Two Trna, And Mrna Molecules Of One
          70s Ribosome. The Entire Crystal Structure Contains Two
          70s Ribosomes As Described In Remark 400.
 gi|218766846|pdb|3F1G|R Chain R, Crystal Structure Of A Translation Termination Complex
          Formed With Release Factor Rf2. This File Contains The
          30s Subunit, Rf2, Two Trna, And Mrna Molecules Of The
          Second 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes As Described In Remark 400.
 gi|226887391|pdb|2WDG|R Chain R, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A-Site Trna,
          Deacylated P-Site Trna, And E-Site Trna.  This File
          Contains The 30s Subunit A-,P-, And E-Site Trnas And
          Paromomycin For Molecule I.
 gi|226887416|pdb|2WDH|R Chain R, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A-Site Trna,
          Deacylated P-Site Trna, And E-Site Trna.  This File
          Contains The 30s Subunit A-,P-, And E-Site Trnas And
          Paromomycin For Molecule Ii.
 gi|226887505|pdb|2WDK|R Chain R, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A- And P-Site
          Trnas, And E-Site Trna.  This File Contains The 30s
          Subunit A-,P-, And E-Site Trnas And Paromomycin For
          Molecule I.
 gi|226887562|pdb|2WDM|R Chain R, Structure Of The Thermus Thermophilus 70s Ribosome In
          Complex With Mrna, Paromomycin, Acylated A- And P-Site
          Trnas, And E-Site Trna.  This File Contains The 30s
          Subunit A-,P-, And E-Site Trnas And Paromomycin For
          Molecule Ii.
 gi|237823546|pdb|2WH1|R Chain R, Insights Into Translational Termination From The
          Structure Of Rf2 Bound To The Ribosome
 gi|237823605|pdb|2WH3|R Chain R, Insights Into Translational Termination From The
          Structure Of Rf2 Bound To The Ribosome). This File
          Contains The 30s Subunit.
 gi|260100003|pdb|3HUW|R Chain R, Structure Of Ef-P Bound To The 70s Ribosome; This File
          Contains The 30s Subunit, Mrna, P-Site Trna And Ef-P
          For Molecule I.
 gi|260100059|pdb|3HUY|R Chain R, Structure Of Ef-P Bound To The 70s Ribosome; This File
          Contains The 30s Subunit, Mrna, P-Site Trna And Ef-P
          For Molecule Ii.
 gi|261824501|pdb|2WRI|R Chain R, The Structure Of The Ribosome With Elongation Factor G
          Trapped In The Post-Translocational State (Part 1 Of
          4).
 gi|261824563|pdb|2WRK|R Chain R, The Structure Of The Ribosome With Elongation Factor G
          Trapped In The Post-Translocational State (Part 3 Of
          4).
 gi|261824625|pdb|2WRN|R Chain R, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
          And Trna (Part 1 Of 4).
 gi|261824684|pdb|2WRQ|R Chain R, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
          And Trna (Part 3 Of 4).
 gi|281307184|pdb|3KIQ|RR Chain r, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Precleavage State; Part 1 Of 4)
 gi|281307242|pdb|3KIS|RR Chain r, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Precleavage State; Part 3 Of 4)
 gi|281307300|pdb|3KIU|RR Chain r, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Postcleavage State; Part 1 Of 4)
 gi|281307358|pdb|3KIX|RR Chain r, Structure Of Rele Nuclease Bound To The 70s Ribosome
          (Postcleavage State; Part 3 Of 4)
 gi|288965621|pdb|3KNH|R Chain R, The Structures Of Viomycin Bound To The 70s Ribosome.
          This File Contains The 30s Subunit For Molecule I
 gi|289526699|pdb|3KNJ|R Chain R, The Structures Of Viomycin Bound To The 70s Ribosome.
          This File Contains The 30s Subunit For Molecule Ii'
 gi|289526724|pdb|3KNL|R Chain R, The Structures Of Capreomycin Bound To The 70s Ribosome.
          This File Contains The 30s Subunit For Molecule I
 gi|289526749|pdb|3KNN|R Chain R, The Structures Of Capreomycin Bound To The 70s Ribosome.
          This File Contains The 30s Subunit For Molecule Ii
 gi|294979521|pdb|3I8G|U Chain U, Elongation Complex Of The 70s Ribosome With Three Trnas
          And Entry 3i8g Contains 30s Ribosomal Subnit.The 50s
          Ribosomal Can Be Found In Pdb Entry 3i8f. Molecule B In
          The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
          (50s).
 gi|294979546|pdb|3I8H|U Chain U, Elongation Complex Of The 70s Ribosome With Three Trnas
          And Entry 3i8h Contains 30s Ribosomal Subnit. The 50s
          Ribosomal Can Be Found In Pdb Entry 3i8i. Molecule A In
          The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
          (30s).
 gi|294979605|pdb|3I9B|U Chain U, Initiation Complex Of 70s Ribosome With Two Trnas And
          Mrna. 3i9b Contains 30s Ribosomal Subunit Of Molecule
          B. The 50s Subunit Can Be Found In Pdb Entry 3i9c.
          Molecule A In The S Asymmetric Unit Is Deposited As
          3i9d (30s) And 3i9e (50s)
 gi|294979659|pdb|3I9D|U Chain U, Initiation Complex Of 70s Ribosome With Two Trnas And
          Mrna. 3i9d Contains 30s Ribosomal Subunit Of Molecule
          A. The 50s Subunit Can Be Found In Pdb Entry 3i9e.
          Molecule B In The S Asymmetric Unit Is Deposited As
          3i9b (30s) And 3i9c (50s)
 gi|295982092|pdb|2X9R|R Chain R, Structure Of The 70s Ribosome Bound To Release Factor 2
          And A Substrate Analog Provides Insights Into Catalysis
          Of Peptide Release
 gi|295982151|pdb|2X9T|R Chain R, Structure Of The 70s Ribosome Bound To Release Factor 2
          And A Substrate Analog Provides Insights Into Catalysis
          Of Peptide Release
 gi|307567979|pdb|2XFZ|R Chain R, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
          70s Ribosome (Part 1 Of 4)
 gi|307568037|pdb|2XG1|R Chain R, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
          70s Ribosome (Part 3 Of 4)
 gi|309320252|pdb|3OGE|R Chain R, Structure Of The Thermus Thermophilus Ribosome Complexed
          With Chloramphenicol. This File Contains The 30s
          Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|309320273|pdb|3OGY|R Chain R, Structure Of The Thermus Thermophilus Ribosome Complexed
          With Chloramphenicol. This File Contains The 30s
          Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|309320354|pdb|3OHC|R Chain R, Structure Of The Thermus Thermophilus Ribosome Complexed
          With Erythromycin. This File Contains The 30s Subunit
          Of One 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes.
 gi|309320375|pdb|3OHD|R Chain R, Structure Of The Thermus Thermophilus Ribosome Complexed
          With Erythromycin. This File Contains The 30s Subunit
          Of One 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes.
 gi|309320456|pdb|3OHY|R Chain R, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Azithromycin. This File Contains The 30s
          Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|309320507|pdb|3OI0|R Chain R, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Azithromycin. This File Contains The 30s
          Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|309320558|pdb|3OI2|R Chain R, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Telithromycin. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|309320609|pdb|3OI4|R Chain R, Structure Of The Thermus Thermophilus 70s Ribosome
          Complexed With Telithromycin. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|312207690|pdb|2XQD|R Chain R, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The
          70s Ribosome With A Gtp Analog
 gi|313754016|pdb|2XSY|R Chain R, Trna Tranlocation On The 70s Ribosome: The Pre-
          Translocational Translocation Intermediate Ti(Pre)
 gi|313754131|pdb|2XUY|R Chain R, Trna Tranlocation On The 70s Ribosome: The Post-
          Translocational Translocation Intermediate Ti(Post)
 gi|325533419|pdb|2Y0U|R Chain R, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To
          A Near-Cognate Codon On The 70s Ribosome
 gi|325533478|pdb|2Y0W|R Chain R, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To
          A Near-Cognate Codon On The 70s Ribosome
 gi|325533537|pdb|2Y0Y|R Chain R, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Near-Cognate Codon On The 70s Ribosome
 gi|325533596|pdb|2Y10|R Chain R, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To
          A Cognate Codon On The 70s Ribosome.
 gi|325533655|pdb|2Y12|R Chain R, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Near-Cognate Codon On The 70s Ribosome
 gi|325533714|pdb|2Y14|R Chain R, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Cognate Codon On The 70s Ribosome.
 gi|325533773|pdb|2Y16|R Chain R, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound
          To A Cognate Codon On The 70s Ribosome.
 gi|325533832|pdb|2Y18|R Chain R, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To
          A Cognate Codon On The 70s Ribosome.
 gi|46197672|gb|AAS82084.1| SSU ribosomal protein S18P [Thermus thermophilus HB27]
 gi|55771625|dbj|BAD70066.1| 30S ribosomal protein S18 [Thermus thermophilus HB8]
          Length = 88

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 32 DYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          DY+++ +L RFLS+ GKI+P R + +S K+QR LAK IKRAR LGL+ +  
Sbjct: 33 DYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTE 83


>gi|15643371|ref|NP_228415.1| 30S ribosomal protein S18 [Thermotoga maritima MSB8]
 gi|7388156|sp|Q9WZ74|RS18_THEMA RecName: Full=30S ribosomal protein S18
 gi|4981125|gb|AAD35690.1|AE001735_3 ribosomal protein S18 [Thermotoga maritima MSB8]
          Length = 75

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (71%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          +DYKD RLL+ FL+ +GKI+P R++    K QR +  AIKRAR +GL+ Y+ +
Sbjct: 23 VDYKDTRLLSEFLTDKGKIIPKRLTGNCSKHQRMVKVAIKRARQMGLLPYLKI 75


>gi|291515311|emb|CBK64521.1| SSU ribosomal protein S18P [Alistipes shahii WAL 8301]
          Length = 92

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 41/56 (73%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   +DYKD   L +FL+++GKI+P R++  S K Q+++A+A+KRAR+L ++ +V 
Sbjct: 33 GIKYVDYKDGEFLKKFLNEQGKILPRRLTGTSQKFQKKVAQAVKRARHLAILPFVT 88


>gi|222099030|ref|YP_002533598.1| 30S ribosomal protein S18 [Thermotoga neapolitana DSM 4359]
 gi|221571421|gb|ACM22233.1| 30S ribosomal protein S18 [Thermotoga neapolitana DSM 4359]
          Length = 78

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (71%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          +DYKD +LL+ FL+ +GKI+P R++    K QR +  AIKRAR +GL+ Y+ +
Sbjct: 26 VDYKDTKLLSDFLTDKGKIIPKRLTGTCAKHQRMVKVAIKRARQMGLLPYLKI 78


>gi|168187295|ref|ZP_02621930.1| ribosomal protein S18 [Clostridium botulinum C str. Eklund]
 gi|169294783|gb|EDS76916.1| ribosomal protein S18 [Clostridium botulinum C str. Eklund]
          Length = 78

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C      +  IDYKD+  L +++++RGKI+P RIS    K QREL  AIKRAR + L+ +
Sbjct: 16 CAFCADKSSSIDYKDVNKLRKYVTERGKILPRRISGNCAKHQRELTLAIKRARNVALLPF 75

Query: 81 V 81
           
Sbjct: 76 T 76


>gi|154498399|ref|ZP_02036777.1| hypothetical protein BACCAP_02388 [Bacteroides capillosus ATCC
          29799]
 gi|150272467|gb|EDM99652.1| hypothetical protein BACCAP_02388 [Bacteroides capillosus ATCC
          29799]
          Length = 79

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 36/64 (56%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD   L RFLS+R KI+P R +      QR+L +AIKRAR + L+
Sbjct: 15 KVCTFCVDKVEHIDYKDAVKLRRFLSERSKILPRRTTGTCAMHQRQLTEAIKRARQIALL 74

Query: 79 AYVN 82
           YV 
Sbjct: 75 PYVT 78


>gi|118444188|ref|YP_876991.1| 30S ribosomal protein S18 [Clostridium novyi NT]
 gi|166220947|sp|A0PX89|RS18_CLONN RecName: Full=30S ribosomal protein S18
 gi|118134644|gb|ABK61688.1| ribosomal protein S18 [Clostridium novyi NT]
          Length = 78

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C      +  IDYKD+  L +++++RGKI+P RIS    K QREL  AIKRAR + L+ +
Sbjct: 16 CAFCADKSSSIDYKDVNKLRKYVTERGKILPRRISGNCAKHQRELTLAIKRARNVALLPF 75

Query: 81 V 81
           
Sbjct: 76 T 76


>gi|308071625|ref|YP_003873230.1| 30S ribosomal protein S18 [Paenibacillus polymyxa E681]
 gi|310644855|ref|YP_003949614.1| 30S ribosomal protein s18 [Paenibacillus polymyxa SC2]
 gi|305860904|gb|ADM72692.1| 30S ribosomal protein S18 [Paenibacillus polymyxa E681]
 gi|309249806|gb|ADO59373.1| 30S ribosomal protein S18 [Paenibacillus polymyxa SC2]
          Length = 90

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 38/62 (61%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +      IDYKD  LL +F+S+RGKI+P R++  S K QR L  A+KR+R + L+ Y
Sbjct: 28 CFFTVNKITHIDYKDTDLLKKFISERGKILPRRVTGTSAKYQRMLTIAVKRSRQIALLPY 87

Query: 81 VN 82
            
Sbjct: 88 TT 89


>gi|295137025|ref|YP_003587572.1| ribosomal protein S18 [Pisum sativum]
 gi|293338597|gb|ADE43570.1| ribosomal protein S18 [Pisum sativum]
          Length = 110

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 47/65 (72%), Gaps = 1/65 (1%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          R+S PL   G  RIDYK++ LL +F+S++GKI+  R++ ++ K+QR +  AIK+AR L L
Sbjct: 16 RRSSPLIQSG-DRIDYKNLSLLFKFISRQGKILSRRVNKLTLKQQRLITIAIKQARILSL 74

Query: 78 IAYVN 82
          I +VN
Sbjct: 75 IPFVN 79


>gi|116750608|ref|YP_847295.1| 30S ribosomal protein S18 [Syntrophobacter fumaroxidans MPOB]
 gi|205618953|sp|A0LN58|RS18_SYNFM RecName: Full=30S ribosomal protein S18
 gi|116699672|gb|ABK18860.1| SSU ribosomal protein S18P [Syntrophobacter fumaroxidans MPOB]
          Length = 81

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 39/65 (60%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C        +IDYKD + L  F+++RGKIVP RIS    K QREL  A+KRAR + L+
Sbjct: 14 KVCRFCVDSELKIDYKDSKTLRYFVTERGKIVPRRISGNCAKHQRELTLAVKRARQIALL 73

Query: 79 AYVNL 83
           +  +
Sbjct: 74 PHTTI 78


>gi|303242466|ref|ZP_07328947.1| ribosomal protein S18 [Acetivibrio cellulolyticus CD2]
 gi|302589990|gb|EFL59757.1| ribosomal protein S18 [Acetivibrio cellulolyticus CD2]
          Length = 95

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K C         IDYKD+  L +++S+RGKI+P RIS    K QR++  A+KRAR++ 
Sbjct: 29 KKKICAFCVDKVTDIDYKDVSKLKKYVSERGKILPRRISGNCAKHQRQMTVAVKRARHIA 88

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 89 LLPYTS 94


>gi|269958121|ref|YP_003327910.1| 30S ribosomal protein S18 [Xylanimonas cellulosilytica DSM 15894]
 gi|269306802|gb|ACZ32352.1| ribosomal protein S18 [Xylanimonas cellulosilytica DSM 15894]
          Length = 78

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 40/61 (65%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
          S PL       +DYKD  LL +F+S RGKI   R++ VS ++QR++AKA+K AR + L+ 
Sbjct: 13 SNPLKTAKIESVDYKDTALLRKFISDRGKIRARRVTGVSVQEQRQIAKAVKNAREMALLP 72

Query: 80 Y 80
          Y
Sbjct: 73 Y 73


>gi|269797041|ref|YP_003316496.1| 30S ribosomal protein S18P [Sanguibacter keddieii DSM 10542]
 gi|269099226|gb|ACZ23662.1| SSU ribosomal protein S18P [Sanguibacter keddieii DSM 10542]
          Length = 78

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (65%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
          S PL       +DYKD  LL +F+S RGKI   R++ VS ++QR++A+A+K AR + L+ 
Sbjct: 13 SNPLKSAKIETVDYKDTALLRKFISDRGKIRARRVTGVSTQEQRQIARAVKNAREMALLP 72

Query: 80 Y 80
          Y
Sbjct: 73 Y 73


>gi|229817075|ref|ZP_04447357.1| hypothetical protein BIFANG_02330 [Bifidobacterium angulatum DSM
          20098]
 gi|229784864|gb|EEP20978.1| hypothetical protein BIFANG_02330 [Bifidobacterium angulatum DSM
          20098]
          Length = 82

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 38/52 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD+ LL +F+S RGKI   RI+ V+ ++QRE++KAIK AR + L+ Y  
Sbjct: 28 IDYKDVALLRKFISDRGKIRSRRITGVTVQEQREISKAIKNAREMALLPYAT 79


>gi|120435464|ref|YP_861150.1| 30S ribosomal protein S18 [Gramella forsetii KT0803]
 gi|205558459|sp|A0M0D8|RS18_GRAFK RecName: Full=30S ribosomal protein S18
 gi|117577614|emb|CAL66083.1| 30S ribosomal protein S18 [Gramella forsetii KT0803]
          Length = 99

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL     +  +K C     G   IDYKD   L  F++++GK++P R++  S K QR++A
Sbjct: 21 TPL-NIETTKAKKYCRFKRSGIKYIDYKDPDFLMGFVNEQGKLLPRRLTGTSLKFQRKVA 79

Query: 67 KAIKRARYLGLIAYVN 82
           A+KRAR+L L+ YV 
Sbjct: 80 TAVKRARHLALMPYVG 95


>gi|323141489|ref|ZP_08076378.1| ribosomal protein S18 [Phascolarctobacterium sp. YIT 12067]
 gi|322414069|gb|EFY04899.1| ribosomal protein S18 [Phascolarctobacterium sp. YIT 12067]
          Length = 76

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (58%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD   L R++++RGKI+P RIS    K QR+L  AIKRAR + L+
Sbjct: 12 KVCSFCVDKVEEIDYKDANKLKRYITERGKILPRRISGTCAKHQRQLTVAIKRARCVALL 71

Query: 79 AYV 81
           + 
Sbjct: 72 PFT 74


>gi|227487780|ref|ZP_03918096.1| 30S ribosomal protein S18 [Corynebacterium glucuronolyticum ATCC
          51867]
 gi|227542421|ref|ZP_03972470.1| 30S ribosomal protein S18 [Corynebacterium glucuronolyticum ATCC
          51866]
 gi|227092282|gb|EEI27594.1| 30S ribosomal protein S18 [Corynebacterium glucuronolyticum ATCC
          51867]
 gi|227181619|gb|EEI62591.1| 30S ribosomal protein S18 [Corynebacterium glucuronolyticum ATCC
          51866]
          Length = 82

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 43/67 (64%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S R K  PL   G  ++DYKD+  L +F+S RGKI   R++ ++ ++QR++A A+K AR 
Sbjct: 14 SRRPKKNPLKAAGIEKVDYKDLNTLRQFISDRGKIRSRRVTGLTPRQQRQVATAVKNARE 73

Query: 75 LGLIAYV 81
          + L+ + 
Sbjct: 74 MALLPFT 80


>gi|20095236|sp|P80382|RS18_THETH RecName: Full=30S ribosomal protein S18
 gi|10120581|pdb|1FKA|R Chain R, Structure Of Functionally Activated Small Ribosomal
          Subunit At 3.3 A Resolution
 gi|10835602|pdb|1FJG|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With The Antibiotics Streptomycin,
          Spectinomycin, And Paromomycin
 gi|11514244|pdb|1G1X|C Chain C, Structure Of Ribosomal Proteins S15, S6, S18, And 16s
          Ribosomal Rna
 gi|11514249|pdb|1G1X|H Chain H, Structure Of Ribosomal Proteins S15, S6, S18, And 16s
          Ribosomal Rna
 gi|13096411|pdb|1HR0|R Chain R, Crystal Structure Of Initiation Factor If1 Bound To The
          30s Ribosomal Subunit
 gi|13399809|pdb|1HNW|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With Tetracycline
 gi|13399831|pdb|1HNX|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With Pactamycin
 gi|13399853|pdb|1HNZ|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With Hygromycin B
 gi|14278027|pdb|1GIX|U Chain U, Crystal Structure Of The Ribosome At 5.5 A Resolution.
          This File, 1gix, Contains The 30s Ribosome Subunit,
          Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is
          In The File 1giy
 gi|14278073|pdb|1IBK|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With The Antibiotic Paromomycin
 gi|14278094|pdb|1IBL|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With A Messenger Rna Fragment And
          Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
          Site And With The Antibiotic Paromomycin
 gi|14278118|pdb|1IBM|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In Complex With A Messenger Rna Fragment And
          Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
          Site
 gi|15826137|pdb|1JGO|U Chain U, The Path Of Messenger Rna Through The Ribosome. This
          File, 1jgo, Contains The 30s Ribosome Subunit, Three
          Trna, And Mrna Molecules. 50s Ribosome Subunit Is In
          The File 1giy
 gi|15826162|pdb|1JGP|U Chain U, The Path Of Messenger Rna Through The Ribosome. This
          File, 1jgp, Contains The 30s Ribosome Subunit, Three
          Trna, And Mrna Molecules. 50s Ribosome Subunit Is In
          The File 1giy
 gi|15826187|pdb|1JGQ|U Chain U, The Path Of Messenger Rna Through The Ribosome. This
          File, 1jgq, Contains The 30s Ribosome Subunit, Three
          Trna, And Mrna Molecules. 50s Ribosome Subunit Is In
          The File 1giy
 gi|20663903|pdb|1J5E|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit
 gi|27065893|pdb|1N32|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit Bound To Codon And Near-Cognate Transfer Rna
          Anticodon Stem-Loop Mismatched At The First Codon
          Position At The A Site With Paromomycin
 gi|27065920|pdb|1N33|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit Bound To Codon And Near-Cognate Transfer Rna
          Anticodon Stem-Loop Mismatched At The Second Codon
          Position At The A Site With Paromomycin
 gi|27065947|pdb|1N34|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In The Presence Of Codon And
          Crystallographically Disordered Near-Cognate Transfer
          Rna Anticodon Stem-Loop Mismatched At The First Codon
          Position
 gi|27065973|pdb|1N36|R Chain R, Structure Of The Thermus Thermophilus 30s Ribosomal
          Subunit In The Presence Of Crystallographically
          Disordered Codon And Near-Cognate Transfer Rna
          Anticodon Stem-Loop Mismatched At The Second Codon
          Position
 gi|28373716|pdb|1ML5|U Chain U, Structure Of The E. Coli Ribosomal Termination Complex
          With Release Factor 2
 gi|58177417|pdb|1XMO|R Chain R, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed
          With Aag-Mrna In The Decoding Center
 gi|58177440|pdb|1XMQ|R Chain R, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To
          The Decoding Center
 gi|58177481|pdb|1XNQ|R Chain R, Structure Of An Inosine-Adenine Wobble Base Pair Complex
          In The Context Of The Decoding Center
 gi|58177504|pdb|1XNR|R Chain R, Crystal Structure Of An Inosine-Cytosine Wobble Base
          Pair In The Context Of The Decoding Center
 gi|66361071|pdb|1YL4|U Chain U, Crystal Structure Of 70s Ribosome With Thrs Operator And
          Trnas. 30s Subunit. The Coordinates For The 50s Subunit
          Are In The Pdb Entry 1yl3
 gi|88192253|pdb|2B64|R Chain R, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor
          Rf1 From A Crystal Structure Of The Whole Ribosomal
          Complex. This File Contains The 30s Subunit, Trnas,
          Mrna And Release Factor Rf1 From A Crystal Structure Of
          The Whole Ribosomal Complex". The Entire Crystal
          Structure Contains One 70s Ribosome, Trnas, Mrna And
          Release Factor Rf1 And Is Described In Remark 400.
 gi|88192316|pdb|2B9M|R Chain R, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor
          Rf2 From A Crystal Structure Of The Whole Ribosomal
          Complex. This File Contains The 30s Ribosomal Subunit,
          Trnas, Mrna And Release Factor Rf2 From A Crystal
          Structure Of The Whole Ribosomal Complex". The Entire
          Crystal Structure Contains One 70s Ribosome, Trnas,
          Mrna And Release Factor Rf2 And Is Described In Remark
          400.
 gi|88192372|pdb|2B9O|R Chain R, 30s Ribosomal Subunit, Trnas And Mrna From A Crystal
          Structure Of The Whole Ribosomal Complex With A Stop
          Codon In The A-Site. This File Contains The 30s
          Subunit, Trnas And Mrna From A Crystal Structure Of The
          Whole Ribosomal Complex With A Stop Codon In The A-Site
          And Is Described In Remark 400.
 gi|110591340|pdb|2F4V|R Chain R, 30s Ribosome + Designer Antibiotic
 gi|116667671|pdb|2HHH|R Chain R, Crystal Structure Of Kasugamycin Bound To The 30s
          Ribosomal Subunit
 gi|119389729|pdb|2HGI|U Chain U, Crystal Structure Of The 70s Thermus Thermophilus
          Ribosome Showing How The 16s 3'-End Mimicks Mrna E And
          P Codons. This Entry 2hgi Contains 30s Ribosomal
          Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb
          Entry 2hgj.
 gi|119389786|pdb|2HGP|U Chain U, Crystal Structure Of The 70s Thermus Thermophilus
          Ribosome With Translocated And Rotated Shine-Dalgarno
          Duplex. This Entry 2hgp Contains 30s Ribosomal Subunit.
          The 50s Ribosomal Subunit Can Be Found In Pdb Entry
          2hgq.
 gi|119389842|pdb|2HGR|U Chain U, 70s T.Th. Ribosome Functional Complex With Mrna And E-
          And P-Site Trnas At 4.5a. This Entry 2hgr Contains 30s
          Ribosomal Subunit. The 50s Ribosomal Subunit Can Be
          Found In Pdb Entry 2hgu.
 gi|186972866|pdb|2VQE|R Chain R, Modified Uridines With C5-Methylene Substituents At The
          First Position Of The Trna Anticodon Stabilize U-G
          Wobble Pairing During Decoding
 gi|186972889|pdb|2VQF|R Chain R, Modified Uridines With C5-Methylene Substituents At The
          First Position Of The Trna Anticodon Stabilize U-G
          Wobble Pairing During Decoding
 gi|307776629|pdb|3OTO|R Chain R, Crystal Structure Of The 30s Ribosomal Subunit From A
          Ksga Mutant Of Thermus Thermophilus (Hb8)
 gi|6739549|gb|AAF27297.1|AF146075_3 ribosomal protein S18 [Thermus thermophilus]
          Length = 88

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 32 DYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          DY+++ +L RFLS+ GKI+P R + +S K+QR LAK IKRAR LGL+ +  
Sbjct: 33 DYRNVEVLKRFLSETGKILPRRRTGLSGKEQRILAKTIKRARILGLLPFTE 83


>gi|312621642|ref|YP_004023255.1| 30S ribosomal protein S18 [Caldicellulosiruptor kronotskyensis
          2002]
 gi|312202109|gb|ADQ45436.1| ribosomal protein S18 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 92

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKRAR L 
Sbjct: 26 KKRVCSFCVERIYEIDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKRARILA 85

Query: 77 LIAYV 81
          L+ ++
Sbjct: 86 LLPFI 90


>gi|14278547|pdb|1I94|R Chain R, Crystal Structures Of The Small Ribosomal Subunit With
          Tetracycline, Edeine And If3
 gi|14278568|pdb|1I95|R Chain R, Crystal Structure Of The 30s Ribosomal Subunit From
          Thermus Thermophilus In Complex With Edeine
 gi|14278589|pdb|1I96|R Chain R, Crystal Structure Of The 30s Ribosomal Subunit From
          Thermus Thermophilus In Complex With The Translation
          Initiation Factor If3 (C-Terminal Domain)
 gi|14278611|pdb|1I97|R Chain R, Crystal Structure Of The 30s Ribosomal Subunit From
          Thermus Thermophilus In Complex With Tetracycline
 gi|149241292|pdb|2E5L|R Chain R, A Snapshot Of The 30s Ribosomal Subunit Capturing Mrna
          Via The Shine- Dalgarno Interaction
 gi|226887646|pdb|2ZM6|R Chain R, Crystal Structure Of The Thermus Thermophilus 30s
          Ribosomal Subunit
          Length = 87

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 32 DYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          DY+++ +L RFLS+ GKI+P R + +S K+QR LAK IKRAR LGL+ +  
Sbjct: 32 DYRNVEVLKRFLSETGKILPRRRTGLSGKEQRILAKTIKRARILGLLPFTE 82


>gi|197294134|ref|YP_002149755.1| ribosomal protein S18 [Cicer arietinum]
 gi|197089822|gb|ACH41092.1| ribosomal protein S18 [Cicer arietinum]
          Length = 108

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 48/74 (64%), Gaps = 2/74 (2%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
           L+   S RR   P+  +   RIDYK++ LL RF+SQ+GKI+  R++ +S K+QR +  A
Sbjct: 8  FLKSKQSFRRSLSPI--QSGDRIDYKNMSLLYRFISQQGKILSRRVNRLSLKQQRLITIA 65

Query: 69 IKRARYLGLIAYVN 82
          IK+AR L L+ + N
Sbjct: 66 IKQARILSLLPFAN 79


>gi|86142229|ref|ZP_01060739.1| ribosomal protein S18 [Leeuwenhoekiella blandensis MED217]
 gi|85830981|gb|EAQ49438.1| ribosomal protein S18 [Leeuwenhoekiella blandensis MED217]
          Length = 99

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL     S  +K C     G   +DYKD   L  F++++GK++P R++  S K QR+++
Sbjct: 21 TPL-NIETSKTKKYCRFKRSGIKYVDYKDADWLASFVNEQGKLLPRRLTGTSLKYQRKVS 79

Query: 67 KAIKRARYLGLIAYVN 82
           A+KRAR+L L+ YV 
Sbjct: 80 VAVKRARHLALMPYVT 95


>gi|119026499|ref|YP_910344.1| 30S ribosomal protein S18 [Bifidobacterium adolescentis ATCC
          15703]
 gi|154488158|ref|ZP_02029275.1| hypothetical protein BIFADO_01730 [Bifidobacterium adolescentis
          L2-32]
 gi|166220925|sp|A1A3H9|RS18_BIFAA RecName: Full=30S ribosomal protein S18
 gi|118766083|dbj|BAF40262.1| 30S ribosomal protein S18 [Bifidobacterium adolescentis ATCC
          15703]
 gi|154083631|gb|EDN82676.1| hypothetical protein BIFADO_01730 [Bifidobacterium adolescentis
          L2-32]
          Length = 82

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 38/52 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD+ LL +F+S RGKI   RI+ V+ ++QRE++KAIK AR + L+ Y  
Sbjct: 28 IDYKDVALLRKFISDRGKIRSRRITGVTVQEQREISKAIKNAREMALLPYAT 79


>gi|312135777|ref|YP_004003115.1| 30S ribosomal protein S18 [Caldicellulosiruptor owensensis OL]
 gi|311775828|gb|ADQ05315.1| ribosomal protein S18 [Caldicellulosiruptor owensensis OL]
          Length = 92

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKRAR L 
Sbjct: 26 KKRVCSFCVERIYEIDYKDVNRLKKFLTERGKILPRRTTGNCARHQRQLTRAIKRARILA 85

Query: 77 LIAYV 81
          L+ ++
Sbjct: 86 LLPFI 90


>gi|297201377|ref|ZP_06918774.1| ribosomal protein S18 [Streptomyces sviceus ATCC 29083]
 gi|297147875|gb|EDY57819.2| ribosomal protein S18 [Streptomyces sviceus ATCC 29083]
          Length = 77

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 40/59 (67%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          PL   G   +DYK+  LL +F+S RGKI   R++ VS ++QR+LA+A+K AR + L+ Y
Sbjct: 16 PLDAAGITYVDYKETDLLRKFVSDRGKIRSRRVTRVSAQQQRQLARAVKNAREMALLPY 74


>gi|227874245|ref|ZP_03992444.1| possible ribosomal protein S18 [Oribacterium sinus F0268]
 gi|227839914|gb|EEJ50345.1| possible ribosomal protein S18 [Oribacterium sinus F0268]
          Length = 90

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (62%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C   G     +DYKD+  L +++S+RGKI+P RI+      QR +  AIKRAR++ 
Sbjct: 24 RKKVCGFCGDKVKPVDYKDVGTLRKYISERGKILPRRITGSCALHQRAITTAIKRARHIA 83

Query: 77 LIAY 80
          L+ Y
Sbjct: 84 LLPY 87


>gi|34811546|pdb|1PNS|R Chain R, Crystal Structure Of A Streptomycin Dependent Ribosome
          From E. Coli, 30s Subunit Of 70s Ribosome. This File,
          1pns, Contains The 30s Subunit, Two Trnas, And One Mrna
          Molecule. The 50s Ribosomal Subunit Is In File 1pnu.
 gi|34811602|pdb|1PNX|R Chain R, Crystal Structure Of The Wild Type Ribosome From E.
          Coli, 30s Subunit Of 70s Ribosome. This File, 1pnx,
          Contains Only Molecules Of The 30s Ribosomal Subunit.
          The 50s Subunit Is In The Pdb File 1pny.
 gi|56966340|pdb|1VOQ|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 gi|56966393|pdb|1VOS|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 gi|56966446|pdb|1VOV|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 gi|56966499|pdb|1VOX|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 gi|56966552|pdb|1VOZ|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 gi|67464181|pdb|1X18|H Chain H, Contact Sites Of Era Gtpase On The Thermus Thermophilus
          30s Subunit
          Length = 73

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 32 DYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          DY+++ +L RFLS+ GKI+P R + +S K+QR LAK IKRAR LGL+ +  
Sbjct: 18 DYRNVEVLKRFLSETGKILPRRRTGLSGKEQRILAKTIKRARILGLLPFTE 68


>gi|77919594|ref|YP_357409.1| 30S ribosomal protein S18 [Pelobacter carbinolicus DSM 2380]
 gi|123756603|sp|Q3A318|RS18_PELCD RecName: Full=30S ribosomal protein S18
 gi|77545677|gb|ABA89239.1| SSU ribosomal protein S18P [Pelobacter carbinolicus DSM 2380]
          Length = 91

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C        +IDYK+IR L  F+++RGKIVP RIS    + QR++ +AIKRAR + L+
Sbjct: 23 KGCRFCADNTLKIDYKEIRNLRYFITERGKIVPRRISGNCAEHQRKIREAIKRARNIALL 82

Query: 79 AYV 81
           + 
Sbjct: 83 PFT 85


>gi|308179152|ref|YP_003918558.1| 30S ribosomal protein S18 [Arthrobacter arilaitensis Re117]
 gi|307746615|emb|CBT77587.1| 30S ribosomal protein S18 [Arthrobacter arilaitensis Re117]
          Length = 79

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          KS PL       IDYKD  LL +F+S RGKI   R++ VS ++QR++A+AIK AR + L+
Sbjct: 12 KSNPLKAADITVIDYKDTALLRKFISDRGKIRARRVTGVSVQEQRKIAQAIKNAREVALL 71

Query: 79 AY 80
           Y
Sbjct: 72 PY 73


>gi|152968280|ref|YP_001364064.1| 30S ribosomal protein S18 [Kineococcus radiotolerans SRS30216]
 gi|205558177|sp|A6WG61|RS18_KINRD RecName: Full=30S ribosomal protein S18
 gi|151362797|gb|ABS05800.1| ribosomal protein S18 [Kineococcus radiotolerans SRS30216]
          Length = 78

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          PL       +DYKD  LL +F+S RGKI   R++ VS ++QR++AKAIK AR + L+ Y
Sbjct: 15 PLKAAKIEAVDYKDTALLRKFISDRGKIRARRVTGVSVQEQRQIAKAIKNAREMALLPY 73


>gi|224178092|ref|YP_002600903.1| ribosomal protein S18 [Pyramimonas parkeae]
 gi|215882759|gb|ACJ71132.1| ribosomal protein S18 [Pyramimonas parkeae]
          Length = 68

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 43/57 (75%)

Query: 26 KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          K    IDYK+I LL +F++++GKI+P R++ ++ K+QR + KAIK+AR +G + +VN
Sbjct: 9  KSGELIDYKNIDLLRKFVTEQGKILPRRVTRLNAKQQRLVTKAIKQARVIGSLPFVN 65


>gi|297572323|ref|YP_003698097.1| ribosomal protein S18 [Arcanobacterium haemolyticum DSM 20595]
 gi|296932670|gb|ADH93478.1| ribosomal protein S18 [Arcanobacterium haemolyticum DSM 20595]
          Length = 78

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P+LR+    ++KS PL       +DYKD   L +F+S RGKI   R++ V+ ++QR++A+
Sbjct: 4  PVLRK---PKKKSNPLKAAKIEVVDYKDTATLRKFISDRGKIRSRRVTGVTVQEQRQIAR 60

Query: 68 AIKRARYLGLIAYVN 82
          A+K AR + L+ Y +
Sbjct: 61 AVKNAREMALLPYTS 75


>gi|260881441|ref|ZP_05404417.2| ribosomal protein S18 [Mitsuokella multacida DSM 20544]
 gi|260848791|gb|EEX68798.1| ribosomal protein S18 [Mitsuokella multacida DSM 20544]
          Length = 77

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD+  L RF+++RGKI+P RIS    K QR++  AIKRAR + L+
Sbjct: 13 KVCSFCVDKVDHIDYKDVAKLRRFVTERGKILPRRISGNCAKHQRQVTVAIKRARNIALL 72

Query: 79 AY 80
           +
Sbjct: 73 PF 74


>gi|167750475|ref|ZP_02422602.1| hypothetical protein EUBSIR_01451 [Eubacterium siraeum DSM 15702]
 gi|167656626|gb|EDS00756.1| hypothetical protein EUBSIR_01451 [Eubacterium siraeum DSM 15702]
 gi|291530826|emb|CBK96411.1| SSU ribosomal protein S18P [Eubacterium siraeum 70/3]
 gi|291557667|emb|CBL34784.1| SSU ribosomal protein S18P [Eubacterium siraeum V10Sc8a]
          Length = 99

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C      A  IDYKD+  L + +++R KI+P R++      QREL  AIK+AR + 
Sbjct: 33 RKKVCAFCADRAEFIDYKDVAKLRKCMTERYKILPRRVTGCCAYHQRELTTAIKKARQVA 92

Query: 77 LIAYVN 82
          LI YV+
Sbjct: 93 LIPYVS 98


>gi|295394868|ref|ZP_06805081.1| 30S ribosomal protein S18 [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972201|gb|EFG48063.1| 30S ribosomal protein S18 [Brevibacterium mcbrellneri ATCC 49030]
          Length = 99

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P +R+ +  ++K+ PL    A  IDYKD   L +F+S RGKI   R++ VS ++QR +AK
Sbjct: 24 PEIRKPI--KKKANPLKPGEAASIDYKDTATLRKFISDRGKIRARRVTGVSVQEQRLIAK 81

Query: 68 AIKRARYLGLIAYVN 82
          A+K AR + L+ Y +
Sbjct: 82 AVKNAREMALLPYTS 96


>gi|317050838|ref|YP_004111954.1| 30S ribosomal protein S18 [Desulfurispirillum indicum S5]
 gi|316945922|gb|ADU65398.1| ribosomal protein S18 [Desulfurispirillum indicum S5]
          Length = 123

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (59%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           R+K C    +    IDYKD++ L  F+++R KI P R++    K QR LA AIKR+R + 
Sbjct: 56  RKKVCAFCAEKVDYIDYKDVKRLRTFITERSKIKPRRMTGTCAKHQRSLATAIKRSRMMA 115

Query: 77  LIAYVNL 83
           L+ +  L
Sbjct: 116 LLPFTAL 122


>gi|224510695|pdb|3FIC|R Chain R, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas
          And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A
          6.4 A Cryo-Em Map. This File Contains The 30s Subunit
          And The Ligands
 gi|300508622|pdb|3MR8|R Chain R, Recognition Of The Amber Stop Codon By Release Factor
          Rf1. This Entry 3mr8 Contains 30s Ribosomal Subunit.
          The 50s Ribosomal Subunit Can Be Found In Pdb Entry
          3ms1. Molecule B In The Same Asymmetric Unit Is
          Deposited As 3mrz (50s) And 3ms0 (30s).
 gi|300508677|pdb|3MS0|R Chain R, Recognition Of The Amber Stop Codon By Release Factor
          Rf1. This Entry 3ms0 Contains 30s Ribosomal Subunit.
          The 50s Ribosomal Subunit Can Be Found In Pdb Entry
          3mrz. Molecule A In The Same Asymmetric Unit Is
          Deposited As 3mr8 (30s) And 3ms1 (50s).
 gi|322812567|pdb|3PYN|R Chain R, Crystal Structure Of A Complex Containing Domain 3 From
          The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
          File Contains The 30s Subunit Of The First 70s
          Ribosome.
 gi|322812620|pdb|3PYQ|R Chain R, Crystal Structure Of A Complex Containing Domain 3 From
          The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
          File Contains The 30s Subunit Of The Second 70s
          Ribosome.
 gi|322812673|pdb|3PYS|R Chain R, Crystal Structure Of A Complex Containing Domain 3 Of
          Crpv Igr Ires Rna Bound To The 70s Ribosome. This File
          Contains The 30s Subunit Of The First 70s Ribosome.
 gi|322812726|pdb|3PYU|R Chain R, Crystal Structure Of A Complex Containing Domain 3 Of
          Crpv Igr Ires Rna Bound To The 70s Ribosome. This File
          Contains The 30s Subunit Of The Second 70s Ribosome
          Length = 70

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 32 DYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          DY+++ +L RFLS+ GKI+P R + +S K+QR LAK IKRAR LGL+ +  
Sbjct: 15 DYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTE 65


>gi|222530063|ref|YP_002573945.1| 30S ribosomal protein S18 [Caldicellulosiruptor bescii DSM 6725]
 gi|222456910|gb|ACM61172.1| ribosomal protein S18 [Caldicellulosiruptor bescii DSM 6725]
          Length = 92

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKRAR L 
Sbjct: 26 KKRVCSFCVERIYEIDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKRARILA 85

Query: 77 LIAYV 81
          L+ ++
Sbjct: 86 LLPFI 90


>gi|189485365|ref|YP_001956306.1| 30S ribosomal protein S18 [uncultured Termite group 1 bacterium
          phylotype Rs-D17]
 gi|205618780|sp|B1H013|RS18_UNCTG RecName: Full=30S ribosomal protein S18
 gi|170287324|dbj|BAG13845.1| 30S ribosomal protein S18 [uncultured Termite group 1 bacterium
          phylotype Rs-D17]
          Length = 100

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P    RRN   R+K C         IDYK++ LL+ F++++GKI+  R++    K QREL
Sbjct: 24 PAGKFRRNGPIRKKVCRFCADKV-EIDYKNLSLLHTFVTEKGKILSGRMTGTCAKHQREL 82

Query: 66 AKAIKRARYLGLIAYV 81
            AIKRAR + L+ + 
Sbjct: 83 DTAIKRARMIALLPFT 98


>gi|312126896|ref|YP_003991770.1| 30S ribosomal protein S18 [Caldicellulosiruptor hydrothermalis
          108]
 gi|311776915|gb|ADQ06401.1| ribosomal protein S18 [Caldicellulosiruptor hydrothermalis 108]
          Length = 92

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKRAR L 
Sbjct: 26 KKRVCSFCVERIYEIDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKRARILA 85

Query: 77 LIAYV 81
          L+ ++
Sbjct: 86 LLPFI 90


>gi|227504198|ref|ZP_03934247.1| 30S ribosomal protein S18 [Corynebacterium striatum ATCC 6940]
 gi|227199242|gb|EEI79290.1| 30S ribosomal protein S18 [Corynebacterium striatum ATCC 6940]
          Length = 84

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R   + R K  PL  +G   +DYKD++ L  F+S RGKI   R++ ++ ++QR++A A+
Sbjct: 11 FRMEQTRRPKKNPLKAEGIETVDYKDVKTLRLFISDRGKIRSRRVTGLTPQQQRQVATAV 70

Query: 70 KRARYLGLIAYV 81
          K AR + L+ + 
Sbjct: 71 KNAREMALLPFT 82


>gi|86156546|ref|YP_463331.1| 30S ribosomal protein S18 [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123723166|sp|Q2IM64|RS18_ANADE RecName: Full=30S ribosomal protein S18
 gi|85773057|gb|ABC79894.1| SSU ribosomal protein S18P [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 135

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (58%)

Query: 19  KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
           K C        ++DYKD   +  FL++RGKI+P RIS    K QRE+A AIKR R L ++
Sbjct: 69  KVCRFCADKTLKVDYKDQGQMKYFLTERGKIIPRRISGNCAKHQREVATAIKRGRMLAIL 128

Query: 79  AYV 81
            Y 
Sbjct: 129 PYT 131


>gi|163755338|ref|ZP_02162458.1| 30S ribosomal protein S18 [Kordia algicida OT-1]
 gi|161324758|gb|EDP96087.1| 30S ribosomal protein S18 [Kordia algicida OT-1]
          Length = 98

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL     +  +K C     G   IDYKD   L +F++++GK++P R++  S K QR+++
Sbjct: 20 TPL-NIETTKAKKYCRFKKSGIKYIDYKDPDFLLKFVNEQGKLLPRRLTGTSLKYQRKVS 78

Query: 67 KAIKRARYLGLIAYVN 82
           A+KRAR+L L+ YV 
Sbjct: 79 VAVKRARHLALMPYVG 94


>gi|302872491|ref|YP_003841127.1| ribosomal protein S18 [Caldicellulosiruptor obsidiansis OB47]
 gi|302575350|gb|ADL43141.1| ribosomal protein S18 [Caldicellulosiruptor obsidiansis OB47]
          Length = 92

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKRAR L 
Sbjct: 26 KKRVCSFCVERIYEIDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKRARILA 85

Query: 77 LIAYV 81
          L+ ++
Sbjct: 86 LLPFI 90


>gi|218296081|ref|ZP_03496850.1| ribosomal protein S18 [Thermus aquaticus Y51MC23]
 gi|218243458|gb|EED09987.1| ribosomal protein S18 [Thermus aquaticus Y51MC23]
          Length = 89

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 32 DYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          DY+++ +L RFLS+ GKI+P R + +S K+QR LAK IKRAR LGL+ +  
Sbjct: 34 DYRNVEVLRRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTE 84


>gi|295398127|ref|ZP_06808176.1| 30S ribosomal protein S18 [Aerococcus viridans ATCC 11563]
 gi|294973646|gb|EFG49424.1| 30S ribosomal protein S18 [Aerococcus viridans ATCC 11563]
          Length = 78

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         +DYKD  LL R++S++GKI+P R++    K QR L   IKRAR + LI +
Sbjct: 15 CFFCANHIDHVDYKDTDLLKRYISEKGKILPRRVTGTCAKHQRTLTAGIKRARIMALIPF 74

Query: 81 VN 82
            
Sbjct: 75 TT 76


>gi|238926740|ref|ZP_04658500.1| ribosomal protein S18 [Selenomonas flueggei ATCC 43531]
 gi|292670198|ref|ZP_06603624.1| 30S ribosomal protein S18 [Selenomonas noxia ATCC 43541]
 gi|304436795|ref|ZP_07396763.1| 30S ribosomal protein S18 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
 gi|238885272|gb|EEQ48910.1| ribosomal protein S18 [Selenomonas flueggei ATCC 43531]
 gi|292648150|gb|EFF66122.1| 30S ribosomal protein S18 [Selenomonas noxia ATCC 43541]
 gi|304370275|gb|EFM23932.1| 30S ribosomal protein S18 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
          Length = 77

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 38/65 (58%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C         IDYKD   L RF ++RGKI+P RIS    K QR++  AIKRAR + 
Sbjct: 11 RRKVCSFCVDKVDHIDYKDAAKLRRFTTERGKILPRRISGNCAKHQRQVTLAIKRARNIA 70

Query: 77 LIAYV 81
          L+ + 
Sbjct: 71 LLPFT 75


>gi|255326498|ref|ZP_05367580.1| ribosomal protein S18 [Rothia mucilaginosa ATCC 25296]
 gi|283458977|ref|YP_003363626.1| 30S ribosomal protein S18 [Rothia mucilaginosa DY-18]
 gi|300742675|ref|ZP_07072696.1| ribosomal protein S18 [Rothia dentocariosa M567]
 gi|311112592|ref|YP_003983814.1| 30S ribosomal protein S18 [Rothia dentocariosa ATCC 17931]
 gi|255296538|gb|EET75873.1| ribosomal protein S18 [Rothia mucilaginosa ATCC 25296]
 gi|283135041|dbj|BAI65806.1| ribosomal protein S18 [Rothia mucilaginosa DY-18]
 gi|300381860|gb|EFJ78422.1| ribosomal protein S18 [Rothia dentocariosa M567]
 gi|310944086|gb|ADP40380.1| 30S ribosomal protein S18 [Rothia dentocariosa ATCC 17931]
          Length = 78

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K  PL       IDYKD+ LL +F+S RGKI   R++ V+ ++QR++A+AIK AR + L+
Sbjct: 12 KQNPLKAADVTVIDYKDVALLRKFISDRGKIRARRVTGVTVQEQRKIAQAIKNAREVALL 71

Query: 79 AY 80
           Y
Sbjct: 72 PY 73


>gi|134097357|ref|YP_001103018.1| 30S ribosomal protein S18 [Saccharopolyspora erythraea NRRL 2338]
 gi|291009084|ref|ZP_06567057.1| 30S ribosomal protein S18 [Saccharopolyspora erythraea NRRL 2338]
 gi|205556498|sp|A4F7R8|RS181_SACEN RecName: Full=30S ribosomal protein S18 1
 gi|133909980|emb|CAM00092.1| 30S ribosomal protein S18 [Saccharopolyspora erythraea NRRL 2338]
          Length = 81

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    R K   L   G  ++D+KD  LL RF+S RGKI   R++ ++ ++QRE+A AIK
Sbjct: 6  RRGGQRRGKPNLLQRAGVVQVDWKDTDLLRRFISDRGKIRSRRVTGLTMQEQREVATAIK 65

Query: 71 RARYLGLIAY 80
           AR + L+ Y
Sbjct: 66 NAREMALLPY 75


>gi|328886756|emb|CCA59995.1| SSU ribosomal protein S18p [Streptomyces venezuelae ATCC 10712]
          Length = 78

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 39/61 (63%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          PL   G   IDYKD  +L +F+S RGKI   R++ V+ ++QR LA AIK AR + L+ Y 
Sbjct: 17 PLDAAGITYIDYKDTDVLRKFISDRGKIRSRRVTRVTARQQRRLAAAIKNAREMALLPYT 76

Query: 82 N 82
          +
Sbjct: 77 S 77


>gi|108796846|ref|YP_636439.1| ribosomal protein S18 [Staurastrum punctulatum]
 gi|122245549|sp|Q32RT7|RR18_STAPU RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|61393614|gb|AAX45755.1| ribosomal protein S18 [Staurastrum punctulatum]
          Length = 80

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 41/57 (71%)

Query: 26 KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          K    IDYK++ LL +F+S++GKI+  RI+ ++ K+QR + KAIK AR L L+ ++N
Sbjct: 21 KPGENIDYKNVGLLRKFISEQGKILSKRITRLTSKQQRAMTKAIKSARILALLPFIN 77


>gi|296118271|ref|ZP_06836852.1| ribosomal protein S18 [Corynebacterium ammoniagenes DSM 20306]
 gi|295968829|gb|EFG82073.1| ribosomal protein S18 [Corynebacterium ammoniagenes DSM 20306]
          Length = 82

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R   + R K  PL  +G  ++DYKD + L  F+S RGKI   R++ ++ ++QR++A A+
Sbjct: 9  FRMEQTRRPKKNPLKAEGIEKVDYKDTKTLRLFISDRGKIRSRRVTGLTPQQQRQVATAV 68

Query: 70 KRARYLGLIAYV 81
          K AR + L+ + 
Sbjct: 69 KNAREMALLPFT 80


>gi|183221480|ref|YP_001839476.1| 30S ribosomal protein S18 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
 gi|189911567|ref|YP_001963122.1| 30S ribosomal protein S18 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Ames)']
 gi|205558218|sp|B0SB38|RS18_LEPBA RecName: Full=30S ribosomal protein S18
 gi|205558230|sp|B0SSW0|RS18_LEPBP RecName: Full=30S ribosomal protein S18
 gi|167776243|gb|ABZ94544.1| 30S Ribosomal protein S18 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Ames)']
 gi|167779902|gb|ABZ98200.1| 30S ribosomal protein S18 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
          Length = 94

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 45/72 (62%), Gaps = 2/72 (2%)

Query: 11 RRNVSHRRKSCPLSGKGA--PRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          R+N  +++K C      A    +DYK + +L RF++ RGKI+P RI+    K QR LA+ 
Sbjct: 20 RKNAKYKKKVCKFCADKALLAGLDYKRVDILERFVTNRGKIIPRRITGTCGKHQRALARE 79

Query: 69 IKRARYLGLIAY 80
          I+++R +GL+ +
Sbjct: 80 IRKSRSIGLLPF 91


>gi|312792728|ref|YP_004025651.1| 30S ribosomal protein S18 [Caldicellulosiruptor kristjanssonii
          177R1B]
 gi|312877716|ref|ZP_07737670.1| ribosomal protein S18 [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795517|gb|EFR11892.1| ribosomal protein S18 [Caldicellulosiruptor lactoaceticus 6A]
 gi|312179868|gb|ADQ40038.1| ribosomal protein S18 [Caldicellulosiruptor kristjanssonii
          177R1B]
          Length = 92

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKRAR L 
Sbjct: 26 KKRVCSFCVERIYEIDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKRARILA 85

Query: 77 LIAYV 81
          L+ ++
Sbjct: 86 LLPFI 90


>gi|116626134|ref|YP_828290.1| 30S ribosomal protein S18 [Candidatus Solibacter usitatus
          Ellin6076]
 gi|122251818|sp|Q01QR5|RS18_SOLUE RecName: Full=30S ribosomal protein S18
 gi|116229296|gb|ABJ88005.1| SSU ribosomal protein S18P [Candidatus Solibacter usitatus
          Ellin6076]
          Length = 99

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C    +    I+YKD+++L+ F+++RGKIVP RIS V    QR L  AIK+AR + 
Sbjct: 32 RKKVCRFCVEKIDDINYKDVKMLHAFVAERGKIVPRRISGVCAPHQRRLTDAIKKARNIA 91

Query: 77 LIAYV 81
          L+ + 
Sbjct: 92 LLPFA 96


>gi|313159250|gb|EFR58619.1| ribosomal protein S18 [Alistipes sp. HGB5]
          Length = 92

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 41/56 (73%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   +DYKD   L +FL+++GKI+P R++  S K Q+++A+A+KRAR+L ++ +V 
Sbjct: 33 GIRYVDYKDGEFLKKFLNEQGKILPRRLTGTSQKFQKKVAQAVKRARHLAILPFVT 88


>gi|205562295|sp|A9KKC8|RS18_CLOPH RecName: Full=30S ribosomal protein S18
          Length = 76

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 38/58 (65%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          + K    IDYKD+  L R++S+RGKI+P RI+    K QR L  A+KRAR++ L+ Y 
Sbjct: 17 ADKNHKEIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAVKRARHIALMPYT 74


>gi|284036033|ref|YP_003385963.1| ribosomal protein S18 [Spirosoma linguale DSM 74]
 gi|283815326|gb|ADB37164.1| ribosomal protein S18 [Spirosoma linguale DSM 74]
          Length = 83

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (64%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
            +R+K       G   IDYKD   L + L+++GKI+P R++  S K QR++A+A+KRAR
Sbjct: 11 TENRKKYDRFKKAGIKYIDYKDGNFLLKLLNEQGKILPRRLTGTSLKNQRKVAQAVKRAR 70

Query: 74 YLGLIAYV 81
          +L ++ YV
Sbjct: 71 HLAILPYV 78


>gi|227494167|ref|ZP_03924483.1| ribosomal protein S18 [Actinomyces coleocanis DSM 15436]
 gi|226831901|gb|EEH64284.1| ribosomal protein S18 [Actinomyces coleocanis DSM 15436]
          Length = 79

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 46/73 (63%), Gaps = 2/73 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P LR+ +  ++K+ PL       IDYKD  LL +F+S RGKI   R++ VS + QR +AK
Sbjct: 4  PQLRKPL--KKKANPLRTAKIENIDYKDTALLRKFISDRGKIRARRVTGVSVQDQRRIAK 61

Query: 68 AIKRARYLGLIAY 80
          A+K AR + L+ Y
Sbjct: 62 AVKNAREMALLPY 74


>gi|297565278|ref|YP_003684250.1| 30S ribosomal protein S18 [Meiothermus silvanus DSM 9946]
 gi|296849727|gb|ADH62742.1| ribosomal protein S18 [Meiothermus silvanus DSM 9946]
          Length = 97

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 40/52 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
           DYK++ +L RFLS+ GKI+P R + ++ ++QR++A+ IKRAR LGL+ + +
Sbjct: 41 TDYKNVEVLKRFLSETGKILPRRRTGLNAQEQRKIARTIKRARMLGLLPFTD 92


>gi|118475552|ref|YP_892291.1| 30S ribosomal protein S18 [Campylobacter fetus subsp. fetus
          82-40]
 gi|261885280|ref|ZP_06009319.1| 30S ribosomal protein S18 [Campylobacter fetus subsp. venerealis
          str. Azul-94]
 gi|166220938|sp|A0RQ08|RS18_CAMFF RecName: Full=30S ribosomal protein S18
 gi|118414778|gb|ABK83198.1| ribosomal protein S18 [Campylobacter fetus subsp. fetus 82-40]
          Length = 86

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          + +K C  +      IDYKD  LL   LS+R KI+P R++  S K Q  + KAIKRAR++
Sbjct: 7  YSKKYCKYTEAKVEFIDYKDTTLLKYCLSERFKIMPRRLTGTSKKYQEMVEKAIKRARHV 66

Query: 76 GLIAYV 81
           LI Y+
Sbjct: 67 ALIPYI 72


>gi|218778773|ref|YP_002430091.1| 30S ribosomal protein S18 [Desulfatibacillum alkenivorans AK-01]
 gi|218760157|gb|ACL02623.1| ribosomal protein S18 [Desulfatibacillum alkenivorans AK-01]
          Length = 82

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 35/62 (56%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         I+YKD R L  F ++RGKIVP RIS    K QR L  AIKRAR + L+ +
Sbjct: 16 CRFCADKTLEINYKDPRTLKYFTTERGKIVPRRISGTCAKHQRALTTAIKRARAIALMPF 75

Query: 81 VN 82
          V 
Sbjct: 76 VG 77


>gi|296127398|ref|YP_003634650.1| ribosomal protein S18 [Brachyspira murdochii DSM 12563]
 gi|296019214|gb|ADG72451.1| ribosomal protein S18 [Brachyspira murdochii DSM 12563]
          Length = 112

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (60%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           ++K C         +DYKDI+LL R++   GKI+P R++    K QR + KAIKRAR + 
Sbjct: 45  KKKVCYFCKNNIDVLDYKDIKLLKRYVKDSGKIIPKRLNGTCSKHQRLVTKAIKRARNIA 104

Query: 77  LIAY 80
           L+ Y
Sbjct: 105 LLPY 108


>gi|297192957|ref|ZP_06910355.1| 30S ribosomal protein S18 2 [Streptomyces pristinaespiralis ATCC
          25486]
 gi|197722638|gb|EDY66546.1| 30S ribosomal protein S18 2 [Streptomyces pristinaespiralis ATCC
          25486]
          Length = 82

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 38/52 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD  LL +F+S RGKI   R++ VS ++QR+LA+AIK AR + L+ Y +
Sbjct: 27 IDYKDTDLLRKFISDRGKIRSRRVTRVSAQQQRQLARAIKNAREMALLPYTS 78


>gi|225619963|ref|YP_002721220.1| 30S ribosomal protein S18 [Brachyspira hyodysenteriae WA1]
 gi|254765412|sp|C0R078|RS18_BRAHW RecName: Full=30S ribosomal protein S18
 gi|225214782|gb|ACN83516.1| 30S ribosomal protein S18 [Brachyspira hyodysenteriae WA1]
          Length = 111

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (60%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           ++K C         +DYKDI+LL R++   GKI+P R++    K QR + KAIKRAR + 
Sbjct: 44  KKKVCYFCKNNIDVLDYKDIKLLKRYVKDSGKIIPKRLNGTCSKHQRLVTKAIKRARNIA 103

Query: 77  LIAY 80
           L+ Y
Sbjct: 104 LLPY 107


>gi|290487270|gb|ADD30019.1| ribosomal protein S18 [Heuchera sanguinea]
          Length = 101

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P L+   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFLKSKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITI 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|269124212|ref|YP_003306789.1| 30S ribosomal protein S18 [Streptobacillus moniliformis DSM
          12112]
 gi|268315538|gb|ACZ01912.1| ribosomal protein S18 [Streptobacillus moniliformis DSM 12112]
          Length = 77

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 39/53 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          IDYK++ LL  F++ +GKI PSR++ +  K QR++AKAIKR+R + L+ Y  +
Sbjct: 23 IDYKNVDLLKNFMNDKGKISPSRVTGLDAKIQRKIAKAIKRSRQIALLPYTKI 75


>gi|283794990|ref|YP_003359381.1| ribosomal protein S18 [Olea europaea]
 gi|330850765|ref|YP_004376443.1| ribosomal protein S18 [Olea europaea subsp. europaea]
 gi|110456626|gb|ABG74753.1| ribosomal protein S18 [Forsythia europaea]
 gi|110456697|gb|ABG74806.1| ribosomal protein S18 [Jasminum abyssinicum]
 gi|281428709|gb|ADA69948.1| ribosomal protein S18 [Olea europaea]
 gi|290487234|gb|ADD30001.1| ribosomal protein S18 [Antirrhinum majus]
 gi|291059275|gb|ADD72111.1| ribosomal protein S18 [Olea europaea]
 gi|328795455|emb|CBR30337.1| ribosomal protein S18 [Olea europaea subsp. europaea]
          Length = 101

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P L+   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFLKSKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITI 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|160881890|ref|YP_001560858.1| 30S ribosomal protein S18 [Clostridium phytofermentans ISDg]
 gi|160430556|gb|ABX44119.1| ribosomal protein S18 [Clostridium phytofermentans ISDg]
          Length = 91

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 23 LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
           + K    IDYKD+  L R++S+RGKI+P RI+    K QR L  A+KRAR++ L+ Y 
Sbjct: 31 CADKNHKEIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAVKRARHIALMPYT 89


>gi|11497549|ref|NP_054957.1| ribosomal protein S18 [Spinacia oleracea]
 gi|18203259|sp|Q9M3K7|RR18_SPIOL RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|7636130|emb|CAB88750.1| ribosomal protein S18 [Spinacia oleracea]
          Length = 101

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P ++   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFIKSKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITS 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|290487236|gb|ADD30002.1| ribosomal protein S18 [Aucuba japonica]
          Length = 101

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P L+   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFLKSKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITI 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|188036219|pdb|3BBN|R Chain R, Homology Model For The Spinach Chloroplast 30s Subunit
          Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
          Length = 103

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P ++   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFIKSKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITS 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|114107155|ref|YP_740139.1| ribosomal protein S18 [Daucus carota]
 gi|122233831|sp|Q0G9U0|RR18_DAUCA RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|113200930|gb|ABI32446.1| ribosomal protein S18 [Daucus carota]
 gi|156574736|gb|ABU85200.1| ribosomal protein S18 [Anethum graveolens]
          Length = 101

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P L+   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFLKSKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITI 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|139389664|ref|YP_001123221.1| ribosomal protein S18 [Arabis hirsuta]
 gi|205831416|sp|A4QK40|RR18_ARAHI RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|134286419|dbj|BAF50045.1| ribosomal protein S18 [Arabis hirsuta]
          Length = 101

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 51/75 (68%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P  +   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ V+ K+QR +  
Sbjct: 7  PFTKSKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRVTLKQQRLITM 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|139389286|ref|YP_001123052.1| ribosomal protein S18 [Aethionema grandiflorum]
 gi|205831413|sp|A4QJM1|RR18_AETGR RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|134286248|dbj|BAF49876.1| ribosomal protein S18 [Aethionema grandiflorum]
          Length = 101

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 49/68 (72%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ V+ K+QR +  AIK+AR 
Sbjct: 14 SFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRVTLKQQRLITSAIKQARI 71

Query: 75 LGLIAYVN 82
          L L+ ++N
Sbjct: 72 LSLLPFIN 79


>gi|325955201|ref|YP_004238861.1| 30S ribosomal protein S18 [Weeksella virosa DSM 16922]
 gi|323437819|gb|ADX68283.1| 30S ribosomal protein S18 [Weeksella virosa DSM 16922]
          Length = 100

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 43/65 (66%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C     G   +DYKD   L +F++++GKI+P R +  S K QR++++AIKRAR+L L
Sbjct: 32 KKYCRFRKYGIKYVDYKDADFLLQFVNEQGKILPRRYTGTSLKYQRKVSRAIKRARHLAL 91

Query: 78 IAYVN 82
          + +V 
Sbjct: 92 LPFVG 96


>gi|227832647|ref|YP_002834354.1| 30S ribosomal protein S18 [Corynebacterium aurimucosum ATCC
          700975]
 gi|262182868|ref|ZP_06042289.1| 30S ribosomal protein S18 [Corynebacterium aurimucosum ATCC
          700975]
 gi|227453663|gb|ACP32416.1| 30S ribosomal protein S18 [Corynebacterium aurimucosum ATCC
          700975]
          Length = 84

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 46/73 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R   + R K  PL  +G  ++DYK+I+ L  F+S RGKI   R++ ++ ++QR++A A+
Sbjct: 11 FRMEQTRRPKKNPLKAEGIEKVDYKEIKTLRLFISDRGKIRSRRVTGLTPQQQRQVATAV 70

Query: 70 KRARYLGLIAYVN 82
          K AR + L+ + +
Sbjct: 71 KNAREMALLPFTS 83


>gi|330839912|ref|YP_004414492.1| 30S ribosomal protein S18 [Selenomonas sputigena ATCC 35185]
 gi|329747676|gb|AEC01033.1| 30S ribosomal protein S18 [Selenomonas sputigena ATCC 35185]
          Length = 77

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD+  L RF+++RGKI+P RIS    K QR++  AIKRAR + L+
Sbjct: 13 KVCTFCVDKVDVIDYKDVAKLRRFITERGKILPRRISGNCAKHQRQVTLAIKRARNIALL 72

Query: 79 AY 80
           +
Sbjct: 73 PF 74


>gi|153002998|ref|YP_001377323.1| 30S ribosomal protein S18 [Anaeromyxobacter sp. Fw109-5]
 gi|205556807|sp|A7H6J3|RS18_ANADF RecName: Full=30S ribosomal protein S18
 gi|152026571|gb|ABS24339.1| ribosomal protein S18 [Anaeromyxobacter sp. Fw109-5]
          Length = 143

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 37/63 (58%)

Query: 19  KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
           K C        ++DYKD   +  FL++RGKI+P RIS    K QRE+A A+KR R L ++
Sbjct: 77  KVCRFCADKTLKVDYKDQSQMKYFLTERGKIIPRRISGNCAKHQREVATAVKRGRMLAIL 136

Query: 79  AYV 81
            Y 
Sbjct: 137 PYT 139


>gi|290487250|gb|ADD30009.1| ribosomal protein S18 [Nerium oleander]
          Length = 101

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P L+   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFLKSKRSFRRRLPPI--ESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITI 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|260437868|ref|ZP_05791684.1| ribosomal protein S18 [Butyrivibrio crossotus DSM 2876]
 gi|292809894|gb|EFF69099.1| ribosomal protein S18 [Butyrivibrio crossotus DSM 2876]
          Length = 88

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 35/61 (57%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         IDYKD   L RF+S+RGKI+P RI+    K QR L  A+KRAR + ++ Y
Sbjct: 26 CVFCADSTNVIDYKDANKLKRFVSERGKILPRRITGTCAKHQRALTVAVKRARQIAILPY 85

Query: 81 V 81
           
Sbjct: 86 T 86


>gi|323149104|ref|YP_004222668.1| ribosomal protein S18 [Anthriscus cerefolium]
 gi|289645597|gb|ADD13660.1| ribosomal protein S18 [Anthriscus cerefolium]
          Length = 101

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P L+   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFLKSKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITI 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|11466725|ref|NP_039321.1| ribosomal protein S18 [Marchantia polymorpha]
 gi|133838|sp|P06375|RR18_MARPO RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|11695|emb|CAA28107.1| rps18 [Marchantia polymorpha]
          Length = 75

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 47/68 (69%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S RR+  P+  +    IDYK+I LL RF+S++GKI+  R++ ++ K+QR L  AIKRAR 
Sbjct: 7  SSRRRMPPI--RSGEIIDYKNISLLRRFVSEQGKILSRRMNRLTSKQQRLLTIAIKRARV 64

Query: 75 LGLIAYVN 82
          L L+ ++N
Sbjct: 65 LALLPFLN 72


>gi|84497235|ref|ZP_00996057.1| 30S ribosomal protein S18-2 [Janibacter sp. HTCC2649]
 gi|84382123|gb|EAP98005.1| 30S ribosomal protein S18-2 [Janibacter sp. HTCC2649]
          Length = 73

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K+ PL       IDYKD  LL +F+S RGKI   R++ VS ++QR +A A+K AR + 
Sbjct: 5  KKKANPLKAAKVENIDYKDTALLRKFISDRGKIRARRVTGVSVQEQRLIANAVKNAREMA 64

Query: 77 LIAY 80
          L+ Y
Sbjct: 65 LLPY 68


>gi|52220832|ref|YP_086988.1| ribosomal protein S18 [Panax ginseng]
 gi|62287418|sp|Q68RY4|RR18_PANGI RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|51235335|gb|AAT98531.1| ribosomal protein S18 [Panax ginseng]
          Length = 101

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P L+   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFLKSKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITI 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|260655513|ref|ZP_05861001.1| ribosomal protein S18 [Jonquetella anthropi E3_33 E1]
 gi|260629961|gb|EEX48155.1| ribosomal protein S18 [Jonquetella anthropi E3_33 E1]
          Length = 82

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 38/63 (60%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C          DYKD+  L +++S+RGKIVP R++    K QR+L  AIKRAR++ L+
Sbjct: 18 KVCYYCADKLEHADYKDVDRLRKYVSERGKIVPRRVTGNCAKHQRQLTIAIKRARFMALL 77

Query: 79 AYV 81
           Y 
Sbjct: 78 PYT 80


>gi|146296359|ref|YP_001180130.1| 30S ribosomal protein S18 [Caldicellulosiruptor saccharolyticus
          DSM 8903]
 gi|205557109|sp|A4XJ54|RS18_CALS8 RecName: Full=30S ribosomal protein S18
 gi|145409935|gb|ABP66939.1| SSU ribosomal protein S18P [Caldicellulosiruptor saccharolyticus
          DSM 8903]
          Length = 91

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKRAR L 
Sbjct: 25 KKRVCSFCVERIYDIDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKRARILA 84

Query: 77 LIAYV 81
          L+ ++
Sbjct: 85 LLPFI 89


>gi|11465981|ref|NP_054523.1| ribosomal protein S18 [Nicotiana tabacum]
 gi|28261739|ref|NP_783254.1| ribosomal protein S18 [Atropa belladonna]
 gi|78102560|ref|YP_358701.1| ribosomal protein S18 [Nicotiana sylvestris]
 gi|81301590|ref|YP_398887.1| ribosomal protein S18 [Nicotiana tomentosiformis]
 gi|89280657|ref|YP_514874.1| ribosomal protein S18 [Solanum lycopersicum]
 gi|91209010|ref|YP_538870.1| ribosomal protein S18 [Solanum bulbocastanum]
 gi|108773152|ref|YP_635661.1| ribosomal protein S18 [Solanum tuberosum]
 gi|62288969|sp|P69659|RR18_ATRBE RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|62288970|sp|P69660|RR18_TOBAC RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|122226851|sp|Q3C1K7|RR18_NICSY RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|122233122|sp|Q33C10|RR18_NICTO RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|122245043|sp|Q2MIG5|RR18_SOLBU RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|122248444|sp|Q2MI78|RR18_SOLLC RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|122248893|sp|Q2VEF6|RR18_SOLTU RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|11851|emb|CAA77371.1| ribosomal protein S18 [Nicotiana tabacum]
 gi|20068353|emb|CAC88066.1| ribosomal protein S18 [Atropa belladonna]
 gi|77799587|dbj|BAE46676.1| ribosomal protein S18 [Nicotiana sylvestris]
 gi|80750949|dbj|BAE48025.1| ribosomal protein S18 [Nicotiana tomentosiformis]
 gi|82754648|gb|ABB90062.1| ribosomal protein S18 [Solanum tuberosum]
 gi|84371917|gb|ABC56235.1| ribosomal protein S18 [Solanum bulbocastanum]
 gi|84372005|gb|ABC56322.1| ribosomal protein S18 [Solanum lycopersicum]
 gi|88656826|gb|ABD47079.1| ribosomal protein S18 [Solanum tuberosum]
 gi|89241693|emb|CAJ32415.1| ribosomal protein S18 [Solanum lycopersicum]
 gi|225220|prf||1211235BB ribosomal protein S18
          Length = 101

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P L+   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFLKFKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITL 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|163788027|ref|ZP_02182473.1| 30S ribosomal protein S18 [Flavobacteriales bacterium ALC-1]
 gi|159876347|gb|EDP70405.1| 30S ribosomal protein S18 [Flavobacteriales bacterium ALC-1]
          Length = 98

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 1/75 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL     S  +K C     G   +DYKD   L  F++++GK++P R++  S K QR+++
Sbjct: 20 TPL-NIETSKTKKYCRFKKSGIKYVDYKDADWLLGFVNEQGKLLPRRLTGTSLKYQRKVS 78

Query: 67 KAIKRARYLGLIAYV 81
           A+KRAR+L L+ YV
Sbjct: 79 VAVKRARHLALMPYV 93


>gi|223931053|ref|YP_002586914.1| ribosomal protein S18 [Syntrichia ruralis]
 gi|219562267|gb|ACL27598.1| ribosomal protein S18 [Syntrichia ruralis]
          Length = 75

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 47/68 (69%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S RR+  P+  +    IDYK+I LL RF+S++GKI+  R++ ++ K+QR +  AIKRAR 
Sbjct: 7  SSRRRLPPI--RSGEIIDYKNINLLRRFISEQGKILSRRMTRLTSKQQRLMTIAIKRARV 64

Query: 75 LGLIAYVN 82
          L L+ ++N
Sbjct: 65 LALLPFLN 72


>gi|193214370|ref|YP_001995569.1| 30S ribosomal protein S18 [Chloroherpeton thalassium ATCC 35110]
 gi|193087847|gb|ACF13122.1| ribosomal protein S18 [Chloroherpeton thalassium ATCC 35110]
          Length = 90

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 40/52 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
           DY+D R L RF++++GKI+P RI+ +S K+QR L K+IK AR+L +I +V+
Sbjct: 35 FDYRDDRKLRRFINEQGKIIPRRITGLSAKEQRLLTKSIKWARHLAIIPFVS 86


>gi|313906073|ref|ZP_07839425.1| ribosomal protein S18 [Eubacterium cellulosolvens 6]
 gi|313469118|gb|EFR64468.1| ribosomal protein S18 [Eubacterium cellulosolvens 6]
          Length = 101

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 39/61 (63%), Gaps = 1/61 (1%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   GK    IDYKD   L R++S+RGKI+P R++    K QR +  A+KRAR+L ++ Y
Sbjct: 40 CVFCGKD-NEIDYKDAAKLRRYISERGKILPRRVTGNCAKHQRAITLAVKRARHLAILPY 98

Query: 81 V 81
          V
Sbjct: 99 V 99


>gi|269925896|ref|YP_003322519.1| ribosomal protein S18 [Thermobaculum terrenum ATCC BAA-798]
 gi|269789556|gb|ACZ41697.1| ribosomal protein S18 [Thermobaculum terrenum ATCC BAA-798]
          Length = 116

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 37/65 (56%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           RRK C        ++DYKDI  + R+LS R KI   R +    K QR LA A+KRARY+ 
Sbjct: 46  RRKVCAFCADHIDKVDYKDIARIGRYLSDRAKIEGRRKTGTCAKHQRSLAVALKRARYMA 105

Query: 77  LIAYV 81
           L+ Y 
Sbjct: 106 LMPYT 110


>gi|284047425|ref|YP_003397764.1| ribosomal protein S18 [Acidaminococcus fermentans DSM 20731]
 gi|283951646|gb|ADB46449.1| ribosomal protein S18 [Acidaminococcus fermentans DSM 20731]
          Length = 78

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (58%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD   L +F+++RGKI+P RIS    K QR+L  AIKRAR + L+
Sbjct: 14 KVCSFCVDKVQEIDYKDAAKLRKFITERGKILPRRISGTCAKHQRQLTIAIKRARNVALL 73

Query: 79 AYV 81
           + 
Sbjct: 74 PFT 76


>gi|1350881|sp|P49169|RR18_PEA RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|1054830|emb|CAA57885.1| chloroplast ribosomal protein S18 [Pisum sativum]
          Length = 110

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 47/65 (72%), Gaps = 1/65 (1%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          R+S PL   G  RIDYK++ LL +F+S++GKI+  R++ ++ K+QR +  AIK+AR L L
Sbjct: 16 RRSSPLIQSG-DRIDYKNLSLLFKFISRQGKILSRRVNKLTLKQQRLITIAIKQARILSL 74

Query: 78 IAYVN 82
          + +VN
Sbjct: 75 LPFVN 79


>gi|319442737|ref|ZP_07991893.1| 30S ribosomal protein S18 [Corynebacterium variabile DSM 44702]
          Length = 83

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 43/66 (65%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S R K  PL  +G   +DYKD  LL +F+S RGKI   R++ ++ ++QR++A A+K AR 
Sbjct: 15 SRRPKKNPLKAEGIETVDYKDYALLRKFISDRGKIRGRRVTGLTPQQQRQVATAVKNARE 74

Query: 75 LGLIAY 80
          + L+ +
Sbjct: 75 MALLPF 80


>gi|319951620|ref|YP_004162887.1| ssu ribosomal protein s18p [Cellulophaga algicola DSM 14237]
 gi|319420280|gb|ADV47389.1| SSU ribosomal protein S18P [Cellulophaga algicola DSM 14237]
          Length = 98

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL   + + ++K C     G   +DYKD   L + ++++GK++P R++  S K QR++A
Sbjct: 20 TPL-NIDTNTQKKYCRFKKSGIKYVDYKDPDFLIKLVNEQGKLLPRRLTGTSLKYQRKVA 78

Query: 67 KAIKRARYLGLIAYV 81
           A+KRAR+L L+ YV
Sbjct: 79 VAVKRARHLALMPYV 93


>gi|148657503|ref|YP_001277708.1| 30S ribosomal protein S18 [Roseiflexus sp. RS-1]
 gi|205556677|sp|A5UYQ5|RS182_ROSS1 RecName: Full=30S ribosomal protein S18 2
 gi|148569613|gb|ABQ91758.1| SSU ribosomal protein S18P [Roseiflexus sp. RS-1]
          Length = 90

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         +DYKD++ L R +S+RGKI+P R + V  + QR L  AIKRAR++ L+
Sbjct: 22 KVCMFCADQIRVVDYKDVKRLQRCMSERGKILPRRRTGVCARHQRSLTVAIKRARHMALL 81

Query: 79 AYV 81
           +V
Sbjct: 82 PFV 84


>gi|332672266|ref|YP_004455274.1| 30S ribosomal protein S18 [Cellulomonas fimi ATCC 484]
 gi|332341304|gb|AEE47887.1| ribosomal protein S18 [Cellulomonas fimi ATCC 484]
          Length = 78

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K  PL       +DYKD  LL +F+S RGKI   R++ VS ++QR +A+A+K AR + 
Sbjct: 10 KKKQNPLKAAKIESVDYKDTALLRKFISDRGKIRARRVTGVSVQEQRAIARAVKNAREMA 69

Query: 77 LIAY 80
          L+ Y
Sbjct: 70 LLPY 73


>gi|228469704|ref|ZP_04054672.1| ribosomal protein S18 [Porphyromonas uenonis 60-3]
 gi|228308723|gb|EEK17449.1| ribosomal protein S18 [Porphyromonas uenonis 60-3]
          Length = 88

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 42/67 (62%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           ++K C         +DYKD   L +FL+ +GKI+P RI+  S K QR +A+A+KRAR+L
Sbjct: 18 QQKKYCRFKKARIKFVDYKDPEFLKKFLNDQGKILPRRITGNSLKFQRRVAQAVKRARHL 77

Query: 76 GLIAYVN 82
           L+ +V 
Sbjct: 78 ALLPFVT 84


>gi|327403002|ref|YP_004343840.1| 30S ribosomal protein S18P [Fluviicola taffensis DSM 16823]
 gi|327318510|gb|AEA43002.1| SSU ribosomal protein S18P [Fluviicola taffensis DSM 16823]
          Length = 87

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          + K C     G   ID+KD   L R ++++GKI+P RI+  S K Q+ + KAIKRAR+L 
Sbjct: 18 KDKYCRFKKSGIKFIDFKDATFLLRLVNEQGKILPRRITGTSAKYQKRVNKAIKRARHLA 77

Query: 77 LIAYV 81
          ++ YV
Sbjct: 78 ILPYV 82


>gi|262197682|ref|YP_003268891.1| ribosomal protein S18 [Haliangium ochraceum DSM 14365]
 gi|262081029|gb|ACY16998.1| ribosomal protein S18 [Haliangium ochraceum DSM 14365]
          Length = 105

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           RRK C         +DYK+ +LL  F++ RGKI P RIS    K QR LA AI+RAR + 
Sbjct: 37  RRKVCRFCLDNTVTLDYKNAQLLKNFITDRGKITPRRISGNCAKHQRALALAIRRARMIA 96

Query: 77  LIAY 80
           L+ +
Sbjct: 97  LLPF 100


>gi|223039715|ref|ZP_03610001.1| ribosomal protein S18 [Campylobacter rectus RM3267]
 gi|222879098|gb|EEF14193.1| ribosomal protein S18 [Campylobacter rectus RM3267]
          Length = 86

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 38/66 (57%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          + RK C  +      IDYKD  LL   LS+R KI+P R++  S K Q  + KAIKRAR  
Sbjct: 7  YSRKYCKFTEAKIEFIDYKDTSLLKYCLSERFKIMPRRLTGTSKKYQEMVEKAIKRARQA 66

Query: 76 GLIAYV 81
           LI YV
Sbjct: 67 ALIPYV 72


>gi|68536624|ref|YP_251329.1| 30S ribosomal protein S18 [Corynebacterium jeikeium K411]
 gi|260577825|ref|ZP_05845759.1| 30S ribosomal protein S18 [Corynebacterium jeikeium ATCC 43734]
 gi|123734548|sp|Q4JTZ6|RS18_CORJK RecName: Full=30S ribosomal protein S18
 gi|68264223|emb|CAI37711.1| 30S ribosomal protein S18 [Corynebacterium jeikeium K411]
 gi|258604052|gb|EEW17295.1| 30S ribosomal protein S18 [Corynebacterium jeikeium ATCC 43734]
          Length = 82

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 44/66 (66%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S R K  PL  +G   +DYK+  LL +F+S+RGKI   R++ ++ ++QR++A A+K AR 
Sbjct: 14 SRRPKKNPLKAEGIETVDYKNYDLLRKFISERGKIRSRRVTGLTPQQQRQVATAVKNARE 73

Query: 75 LGLIAY 80
          + L+ +
Sbjct: 74 MALLPF 79


>gi|325003294|ref|ZP_08124406.1| 30S ribosomal protein S18 [Pseudonocardia sp. P1]
          Length = 80

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 43/64 (67%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK+ PL  +G   +D+KD  LL  F+S RGKI   R++ ++ ++QR++A AI+ AR + 
Sbjct: 12 RRKANPLKVRGIEHVDWKDAALLRTFISDRGKIRARRVTGLTGRQQRQVALAIRNAREMA 71

Query: 77 LIAY 80
          L+ Y
Sbjct: 72 LLPY 75


>gi|302538024|ref|ZP_07290366.1| ribosomal protein S18 [Streptomyces sp. C]
 gi|302446919|gb|EFL18735.1| ribosomal protein S18 [Streptomyces sp. C]
          Length = 78

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          PL   G   IDYKD  LL +F+S RGKI   R++ V+ ++QR LA AIK AR + L+ Y 
Sbjct: 17 PLDTAGITYIDYKDTDLLRKFISDRGKIRSRRVTRVTAQQQRRLALAIKNAREMALLPYA 76


>gi|225023067|ref|ZP_03712259.1| hypothetical protein CORMATOL_03115 [Corynebacterium matruchotii
          ATCC 33806]
 gi|305681805|ref|ZP_07404609.1| ribosomal protein S18 [Corynebacterium matruchotii ATCC 14266]
 gi|224944290|gb|EEG25499.1| hypothetical protein CORMATOL_03115 [Corynebacterium matruchotii
          ATCC 33806]
 gi|305658278|gb|EFM47781.1| ribosomal protein S18 [Corynebacterium matruchotii ATCC 14266]
          Length = 82

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 46/76 (60%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          T  +R   S R K  PL   G  ++DYKDI  L +F+S R KI   R++ ++ ++QR++A
Sbjct: 6  TKKVRMEQSRRPKKNPLKAAGIEKVDYKDINTLRQFISDRHKIRSRRVTGLTPQQQRQVA 65

Query: 67 KAIKRARYLGLIAYVN 82
           A+K AR + L+ + +
Sbjct: 66 TAVKNAREMALLPFTS 81


>gi|159161272|ref|YP_001542550.1| ribosomal protein S18 [Cuscuta exaltata]
 gi|205831384|sp|A8W3E3|RR18_CUSEX RecName: Full=Plastid 30S ribosomal protein S18
 gi|158938697|gb|ABW83714.1| ribosomal protein S18 [Cuscuta exaltata]
          Length = 117

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 49/74 (66%), Gaps = 2/74 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P ++   S RR+  P+  K   RIDY++I L++RFLS++GKI+  R++  + K+QR +  
Sbjct: 7  PFIKSKRSFRRRLPPI--KSGDRIDYRNISLISRFLSEQGKILSKRVNRFTLKQQRLITL 64

Query: 68 AIKRARYLGLIAYV 81
          AIK+AR L L+ + 
Sbjct: 65 AIKQARILSLLPFT 78


>gi|238917873|ref|YP_002931390.1| small subunit ribosomal protein S18 [Eubacterium eligens ATCC
          27750]
 gi|238873233|gb|ACR72943.1| small subunit ribosomal protein S18 [Eubacterium eligens ATCC
          27750]
          Length = 87

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C         +DYKD+  L  ++S+RGKI+P RI+    K QR L  A+KRAR++ L
Sbjct: 22 KKVCAFCADANKVLDYKDVATLKHYVSERGKILPRRITGNCAKHQRALTVAVKRARHVAL 81

Query: 78 IAY 80
          + Y
Sbjct: 82 LPY 84


>gi|269217871|ref|ZP_06161725.1| ribosomal protein S18 [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269212806|gb|EEZ79146.1| ribosomal protein S18 [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 78

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 47/73 (64%), Gaps = 3/73 (4%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P+LR+    ++K+ PL       IDYKD   L +F+S RGKI   R++ V+ ++QR++A+
Sbjct: 4  PVLRK---PKKKANPLKSAKIENIDYKDTATLRKFISDRGKIRARRVTGVTVQEQRKIAR 60

Query: 68 AIKRARYLGLIAY 80
          A+K AR + L+ Y
Sbjct: 61 AVKNAREMALLPY 73


>gi|257439412|ref|ZP_05615167.1| ribosomal protein S18 [Faecalibacterium prausnitzii A2-165]
 gi|257198071|gb|EEU96355.1| ribosomal protein S18 [Faecalibacterium prausnitzii A2-165]
          Length = 71

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C         IDYKD+  L +++S+R KI+P R++      QR L  AIKRAR++ 
Sbjct: 5  RKKVCSFCVDRIDTIDYKDVPRLRKYVSERAKIIPRRVTGTCAYHQRALTTAIKRARHVA 64

Query: 77 LIAYVN 82
          L+ YV+
Sbjct: 65 LMPYVS 70


>gi|255321378|ref|ZP_05362538.1| ribosomal protein S18 [Campylobacter showae RM3277]
 gi|255301531|gb|EET80788.1| ribosomal protein S18 [Campylobacter showae RM3277]
          Length = 86

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 38/66 (57%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          + RK C  +      IDYKD  LL   LS+R KI+P R++  S K Q  + KAIKRAR  
Sbjct: 7  YSRKYCKFTEAKIDFIDYKDTSLLKYCLSERFKIMPRRLTGTSKKYQEMVEKAIKRARQA 66

Query: 76 GLIAYV 81
           LI YV
Sbjct: 67 ALIPYV 72


>gi|255035775|ref|YP_003086396.1| 30S ribosomal protein S18 [Dyadobacter fermentans DSM 18053]
 gi|254948531|gb|ACT93231.1| ribosomal protein S18 [Dyadobacter fermentans DSM 18053]
          Length = 83

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 45/66 (68%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R+K C     G   IDYK+   L + ++++GKI+P R++  S K QR++++AIKRAR+L
Sbjct: 13 NRKKYCRFKKAGIKYIDYKNPDFLLKLVNEQGKILPRRLTGTSLKYQRKVSQAIKRARHL 72

Query: 76 GLIAYV 81
           L+ +V
Sbjct: 73 ALLPFV 78


>gi|33519564|ref|NP_878396.1| 30S ribosomal protein S18 [Candidatus Blochmannia floridanus]
 gi|59798862|sp|Q7VQN8|RS18_BLOFL RecName: Full=30S ribosomal protein S18
 gi|33517227|emb|CAD83609.1| 30S ribosomal subunit protein S18 [Candidatus Blochmannia
          floridanus]
          Length = 78

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +L R + HR K C  +      +DYKD+  +   + +  KI+PSRI+    K QR+LA+A
Sbjct: 3  ILPRYIRHR-KFCRFTADKCIYVDYKDLSKIQHSIIENAKIIPSRITGTRSKYQRQLARA 61

Query: 69 IKRARYLGLIAYVN 82
          IK AR+L L+ Y++
Sbjct: 62 IKIARFLSLLPYID 75


>gi|304373311|ref|YP_003856520.1| 30S ribosomal protein S18 [Mycoplasma hyorhinis HUB-1]
 gi|304309502|gb|ADM21982.1| 30S ribosomal protein S18 [Mycoplasma hyorhinis HUB-1]
          Length = 80

 Score = 56.6 bits (135), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         IDYK++ +L +F++  GKI PSRI+    K QR+++ AIKRAR + L+A+
Sbjct: 14 CHFCETQTVYIDYKNVEVLEKFVNPHGKIQPSRITGSCSKHQRQVSLAIKRARMIALMAF 73

Query: 81 V 81
          V
Sbjct: 74 V 74


>gi|302527614|ref|ZP_07279956.1| ribosomal protein S18 [Streptomyces sp. AA4]
 gi|302436509|gb|EFL08325.1| ribosomal protein S18 [Streptomyces sp. AA4]
          Length = 81

 Score = 56.6 bits (135), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 43/66 (65%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + RR+       G  R+D+KD+ LL +F+S RGKI   R++ ++ ++Q+++A AIK AR 
Sbjct: 10 TPRRRPNAFHAAGITRVDWKDVDLLRKFISDRGKIRARRVTGLTPQQQKQVATAIKNARE 69

Query: 75 LGLIAY 80
          + L+ Y
Sbjct: 70 MALLPY 75


>gi|294787280|ref|ZP_06752533.1| ribosomal protein S18 [Parascardovia denticolens F0305]
 gi|315227162|ref|ZP_07868949.1| 30S ribosomal protein S18 [Parascardovia denticolens DSM 10105]
 gi|294484636|gb|EFG32271.1| ribosomal protein S18 [Parascardovia denticolens F0305]
 gi|315119612|gb|EFT82745.1| 30S ribosomal protein S18 [Parascardovia denticolens DSM 10105]
          Length = 91

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          IDYKD+ LL +F+S RGKI   RI+ VS ++QR++A+AIK AR + L+ Y
Sbjct: 28 IDYKDVALLRKFISDRGKIRSRRITGVSVQEQRKIARAIKNAREMALLPY 77


>gi|38258439|sp|Q85UY0|RR18_PSEMZ RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|30171142|gb|AAN18254.1| Rps18 [Pseudotsuga menziesii]
          Length = 86

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 50/76 (65%), Gaps = 1/76 (1%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P    RRN++  R+     G G  RIDYK++ L++RF+S++G I+  R++ ++ K+QR +
Sbjct: 8  PKRSFRRNLTPIRRHLSPIGSGD-RIDYKNMSLISRFISEQGXILSGRVNRLTSKQQRLM 66

Query: 66 AKAIKRARYLGLIAYV 81
            AIKRAR L L+ ++
Sbjct: 67 TNAIKRARILSLLPFL 82


>gi|188587503|ref|YP_001919048.1| SSU ribosomal protein S18P [Natranaerobius thermophilus
          JW/NM-WN-LF]
 gi|205558577|sp|B2A454|RS18_NATTJ RecName: Full=30S ribosomal protein S18
 gi|179352190|gb|ACB86460.1| SSU ribosomal protein S18P [Natranaerobius thermophilus
          JW/NM-WN-LF]
          Length = 74

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R K C    +    + YKD+  L +++++RGKI+P RI+    K QR+L  AIK+AR L 
Sbjct: 7  RNKVCSFCAEKTTTVSYKDLDRLKKYITERGKILPRRINGNCAKHQRQLTTAIKKARQLA 66

Query: 77 LIAYV 81
          L+ Y 
Sbjct: 67 LLPYT 71


>gi|166235789|gb|ABY85693.1| ribosomal protein S18 [Silene fruticosa]
          Length = 113

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 50/73 (68%), Gaps = 2/73 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P ++   S RR+  P+  +   RIDY+++RL+NRF S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFIKSKRSFRRRLPPI--QPGDRIDYRNMRLINRFSSEQGKILSRRVNRLTLKQQRLITI 64

Query: 68 AIKRARYLGLIAY 80
          AIKRAR L L+ +
Sbjct: 65 AIKRARILALLPF 77


>gi|114777954|ref|ZP_01452868.1| ribosomal protein S18 [Mariprofundus ferrooxydans PV-1]
 gi|114551741|gb|EAU54293.1| ribosomal protein S18 [Mariprofundus ferrooxydans PV-1]
          Length = 119

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 39/67 (58%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           RRK C    +    IDYK+  LL  F+++R KI+PSR++      QR L  AIKRAR L 
Sbjct: 50  RRKFCKFCAEKNVTIDYKNPDLLRGFITERYKILPSRVTGTCSSHQRRLTTAIKRARVLA 109

Query: 77  LIAYVNL 83
           LI +  L
Sbjct: 110 LIPFTPL 116


>gi|332298063|ref|YP_004439985.1| 30S ribosomal protein S18 [Treponema brennaborense DSM 12168]
 gi|332181166|gb|AEE16854.1| 30S ribosomal protein S18 [Treponema brennaborense DSM 12168]
          Length = 103

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 1/65 (1%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
           R+K C    + A +IDYKD   L R+ ++RGKI+P RI+    K QR LA  IKRAR + 
Sbjct: 38  RKKVCRFCAQKA-KIDYKDADALRRYTTERGKILPRRITGTCAKHQRRLALEIKRARAIC 96

Query: 77  LIAYV 81
           L+ +V
Sbjct: 97  LLPFV 101


>gi|160892971|ref|ZP_02073759.1| hypothetical protein CLOL250_00508 [Clostridium sp. L2-50]
 gi|156865054|gb|EDO58485.1| hypothetical protein CLOL250_00508 [Clostridium sp. L2-50]
          Length = 87

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (59%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          A  P+ RRN+  R+K C         IDYKD   L R++S+RGKI+P RI+    K QR 
Sbjct: 9  ADAPMKRRNIRRRKKVCVFCADKTAVIDYKDANKLKRYISERGKILPRRITGNCAKHQRA 68

Query: 65 LAKAIKRARYLGLIAYV 81
          L  A+KRAR + ++ YV
Sbjct: 69 LTVAVKRARQIAILPYV 85


>gi|150020533|ref|YP_001305887.1| 30S ribosomal protein S18 [Thermosipho melanesiensis BI429]
 gi|166222253|sp|A6LKQ1|RS18_THEM4 RecName: Full=30S ribosomal protein S18
 gi|149793054|gb|ABR30502.1| ribosomal protein S18 [Thermosipho melanesiensis BI429]
          Length = 75

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (60%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C L       +DYKD++LL  FL+++ KI+P R++    K QR +  AIKRAR + L+
Sbjct: 11 KVCKLCQSKIDYVDYKDVKLLREFLTEKEKIIPRRVTGNCAKHQRMVKIAIKRARQMALL 70

Query: 79 AYVN 82
           YV 
Sbjct: 71 PYVK 74


>gi|19552092|ref|NP_600094.1| 30S ribosomal protein S18 [Corynebacterium glutamicum ATCC 13032]
 gi|25027496|ref|NP_737550.1| 30S ribosomal protein S18 [Corynebacterium efficiens YS-314]
 gi|62389755|ref|YP_225157.1| 30S ribosomal protein S18 [Corynebacterium glutamicum ATCC 13032]
 gi|145295036|ref|YP_001137857.1| 30S ribosomal protein S18 [Corynebacterium glutamicum R]
 gi|259507096|ref|ZP_05749996.1| 30S ribosomal protein S18 [Corynebacterium efficiens YS-314]
 gi|54039410|sp|P66456|RS18_COREF RecName: Full=30S ribosomal protein S18
 gi|54042145|sp|P66455|RS18_CORGL RecName: Full=30S ribosomal protein S18
 gi|166220949|sp|A4QCK8|RS18_CORGB RecName: Full=30S ribosomal protein S18
 gi|21323632|dbj|BAB98259.1| Ribosomal protein S18 [Corynebacterium glutamicum ATCC 13032]
 gi|23492778|dbj|BAC17750.1| putative 30S ribosomal protein S18 [Corynebacterium efficiens
          YS-314]
 gi|41325090|emb|CAF19571.1| 30S RIBOSOMAL PROTEIN S18 [Corynebacterium glutamicum ATCC 13032]
 gi|140844956|dbj|BAF53955.1| hypothetical protein [Corynebacterium glutamicum R]
 gi|259165374|gb|EEW49928.1| 30S ribosomal protein S18 [Corynebacterium efficiens YS-314]
          Length = 83

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 42/67 (62%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + R K  PL   G  ++DYKDI  L +F+S R KI   R++ ++ ++QRE+A A+K AR 
Sbjct: 15 TRRPKKNPLKAAGIEKVDYKDINTLRQFISDRHKIRSRRVTGLTPQQQREVATAVKNARE 74

Query: 75 LGLIAYV 81
          + L+ + 
Sbjct: 75 MALLPFT 81


>gi|296131515|ref|YP_003638765.1| ribosomal protein S18 [Cellulomonas flavigena DSM 20109]
 gi|296023330|gb|ADG76566.1| ribosomal protein S18 [Cellulomonas flavigena DSM 20109]
          Length = 78

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          PL       +DYKD  LL +F+S RGKI   R++ VS ++QR++A+A+K AR + L+ Y
Sbjct: 15 PLKAAKIETVDYKDTALLRKFISDRGKIRARRVTGVSVQEQRQIARAVKNAREMALLPY 73


>gi|146216940|ref|NP_904178.2| ribosomal protein S18 [Physcomitrella patens subsp. patens]
          Length = 75

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 47/68 (69%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S RR+  P+  +    IDYK+I LL RF+S++GKI+  R++ ++ K+QR +  AIKRAR 
Sbjct: 7  SSRRRLPPI--RSGEIIDYKNINLLRRFISEQGKILSRRMNRLTSKQQRLMTIAIKRARV 64

Query: 75 LGLIAYVN 82
          L L+ ++N
Sbjct: 65 LALLPFLN 72


>gi|260893966|ref|YP_003240063.1| ribosomal protein S18 [Ammonifex degensii KC4]
 gi|260866107|gb|ACX53213.1| ribosomal protein S18 [Ammonifex degensii KC4]
          Length = 76

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C    +   ++DYKD+  L +F+S RGKI+P RI+    + QR L  AIKRAR + L+ +
Sbjct: 14 CSFCVEKIDKVDYKDVNRLKKFISDRGKILPRRITGNCARHQRMLTVAIKRARIMALLPF 73

Query: 81 VN 82
          V+
Sbjct: 74 VS 75


>gi|298208563|ref|YP_003716742.1| ribosomal protein S18 [Croceibacter atlanticus HTCC2559]
 gi|83848486|gb|EAP86355.1| ribosomal protein S18 [Croceibacter atlanticus HTCC2559]
          Length = 100

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL     S + K C     G   IDYK+   L   ++++GK++P R++  S K QR++A
Sbjct: 21 TPL-NIETSKKEKYCRFKKNGIKYIDYKNPDFLGMLVNEQGKLLPRRLTGTSLKYQRKVA 79

Query: 67 KAIKRARYLGLIAYVN 82
          +A+KRAR++ L+ YV 
Sbjct: 80 QAVKRARHIALMPYVT 95


>gi|315925593|ref|ZP_07921803.1| 30S ribosomal protein S18 [Pseudoramibacter alactolyticus ATCC
          23263]
 gi|315621134|gb|EFV01105.1| 30S ribosomal protein S18 [Pseudoramibacter alactolyticus ATCC
          23263]
          Length = 74

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C         +DYKDI  L +++S+RGKI+P R +    K QR++ +A+ RAR + 
Sbjct: 8  RRKVCEFCEHEDMVVDYKDIATLKKYISERGKILPRRATGACAKHQRKITQAVNRARNMA 67

Query: 77 LIAY 80
          L+ Y
Sbjct: 68 LLPY 71


>gi|326774854|ref|ZP_08234119.1| ribosomal protein S18 [Streptomyces cf. griseus XylebKG-1]
 gi|326655187|gb|EGE40033.1| ribosomal protein S18 [Streptomyces cf. griseus XylebKG-1]
          Length = 82

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 38/60 (63%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          PL       IDYKD  LL RF+S RGKI   R++ +S ++QR++A AIK AR + L+ Y 
Sbjct: 17 PLDAAENTYIDYKDTDLLRRFVSDRGKIRGRRVTRISARQQRQVAAAIKNAREMALLPYT 76


>gi|330723815|gb|AEC46185.1| 30S ribosomal protein S18 [Mycoplasma hyorhinis MCLD]
          Length = 80

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         IDYK++ +L +F++  GKI PSRI+    K QR+++ AIKRAR + L+A+
Sbjct: 14 CHFCETQTVYIDYKNVEVLEKFVNPHGKIQPSRITGSCSKHQRQVSLAIKRARMIALMAF 73

Query: 81 V 81
          V
Sbjct: 74 V 74


>gi|86130271|ref|ZP_01048871.1| 30S ribosomal protein S18 [Dokdonia donghaensis MED134]
 gi|332293237|ref|YP_004431846.1| ribosomal protein S18 [Krokinobacter diaphorus 4H-3-7-5]
 gi|85818946|gb|EAQ40105.1| 30S ribosomal protein S18 [Dokdonia donghaensis MED134]
 gi|332171323|gb|AEE20578.1| ribosomal protein S18 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 98

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (64%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C     G   +DYKD   L  F++++GK++P R++  S K QR+++ A+KRAR+L L
Sbjct: 30 KKYCRFKKSGIKYVDYKDADWLAGFVNEQGKLLPRRLTGTSLKYQRKVSVAVKRARHLAL 89

Query: 78 IAYVN 82
          + YV 
Sbjct: 90 MPYVT 94


>gi|260891623|ref|ZP_05902886.1| ribosomal protein S18 [Leptotrichia hofstadii F0254]
 gi|260858633|gb|EEX73133.1| ribosomal protein S18 [Leptotrichia hofstadii F0254]
          Length = 79

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          I+YK++ LL  F++ +GKI P+R++ +  K QR++AKAIKRAR + L+ Y  +
Sbjct: 25 INYKNVELLKNFMNDKGKISPARVTGLEAKVQRKIAKAIKRARQIALMPYTKI 77


>gi|62287445|sp|Q6YXM4|RR18_PHYPA RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|34494761|dbj|BAC85028.1| ribosomal protein S18 [Physcomitrella patens subsp. patens]
          Length = 79

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 47/68 (69%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S RR+  P+  +    IDYK+I LL RF+S++GKI+  R++ ++ K+QR +  AIKRAR 
Sbjct: 11 SSRRRLPPI--RSGEIIDYKNINLLRRFISEQGKILSRRMNRLTSKQQRLMTIAIKRARV 68

Query: 75 LGLIAYVN 82
          L L+ ++N
Sbjct: 69 LALLPFLN 76


>gi|256370726|ref|YP_003108551.1| 30S ribosomal protein S18 [Candidatus Sulcia muelleri SMDSEM]
 gi|256009518|gb|ACU52878.1| ribosomal protein S18 [Candidatus Sulcia muelleri SMDSEM]
          Length = 165

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 41/65 (63%)

Query: 17  RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
            +K C         IDYK+ + L +FL++RG+I+P RI+  S K Q+ L KAIKR + +G
Sbjct: 96  EKKYCFFLKNKIKYIDYKNPKFLIKFLNERGEILPRRITGTSKKFQKRLTKAIKRCKQIG 155

Query: 77  LIAYV 81
           L+ Y+
Sbjct: 156 LLPYI 160


>gi|160931686|ref|ZP_02079080.1| hypothetical protein CLOLEP_00517 [Clostridium leptum DSM 753]
 gi|156869331|gb|EDO62703.1| hypothetical protein CLOLEP_00517 [Clostridium leptum DSM 753]
          Length = 86

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (61%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         IDYKD+  L R++S+R KI+P R++    + QREL  AIKRAR+L L+ +
Sbjct: 24 CGFCVDKVESIDYKDVARLRRYISERAKILPRRVTGTCARHQRELTVAIKRARHLALLPF 83


>gi|139389972|ref|YP_001123572.1| ribosomal protein S18 [Draba nemorosa]
 gi|205831390|sp|A4QL41|RR18_DRANE RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|134286774|dbj|BAF50396.1| ribosomal protein S18 [Draba nemorosa]
 gi|262400742|gb|ACY66231.1| ribosomal protein S18 [Brassica napus]
          Length = 101

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 51/75 (68%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P  +   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ V+ K+QR +  
Sbjct: 7  PFTKSKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRVTLKQQRLITI 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|283782810|ref|YP_003373564.1| ribosomal protein S18 [Gardnerella vaginalis 409-05]
 gi|297242912|ref|ZP_06926850.1| ribosomal protein S18 [Gardnerella vaginalis AMD]
 gi|298253290|ref|ZP_06977082.1| ribosomal protein S18 [Gardnerella vaginalis 5-1]
 gi|308235864|ref|ZP_07666601.1| 30S ribosomal protein S18 [Gardnerella vaginalis ATCC 14018]
 gi|311115041|ref|YP_003986262.1| 30S ribosomal protein S18 [Gardnerella vaginalis ATCC 14019]
 gi|283441410|gb|ADB13876.1| ribosomal protein S18 [Gardnerella vaginalis 409-05]
 gi|296889123|gb|EFH27857.1| ribosomal protein S18 [Gardnerella vaginalis AMD]
 gi|297532685|gb|EFH71571.1| ribosomal protein S18 [Gardnerella vaginalis 5-1]
 gi|310946535|gb|ADP39239.1| 30S ribosomal protein S18 [Gardnerella vaginalis ATCC 14019]
          Length = 82

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKD+ LL +F+S RGKI   RI+ V+ ++QR++AKA+K AR + L+ Y  
Sbjct: 28 IDYKDVALLRKFVSDRGKIRSRRITGVTVQEQRKIAKAVKNAREMALLPYAT 79


>gi|331268135|ref|YP_004347784.1| ribosomal protein S18 [Chlorella variabilis]
 gi|325296312|gb|ADZ05032.1| ribosomal protein S18 [Chlorella variabilis]
          Length = 105

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 42/57 (73%), Gaps = 2/57 (3%)

Query: 28 APR--IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          APR  IDYK+ +LL +F+S +GKI+  R + ++ K+QR +A AIKRAR  GL+ +VN
Sbjct: 40 APRYTIDYKNTKLLVKFISPQGKILSRRATGLTAKQQRVMANAIKRARMGGLLPFVN 96


>gi|282862689|ref|ZP_06271750.1| ribosomal protein S18 [Streptomyces sp. ACTE]
 gi|282562375|gb|EFB67916.1| ribosomal protein S18 [Streptomyces sp. ACTE]
          Length = 78

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR    + +  PL   G   IDYKD  LL +F+S RGKI   R++ VS ++QR +A A
Sbjct: 1  MTRRTDPRKPRPNPLDAAGITYIDYKDTDLLRKFVSDRGKIRSRRVTRVSARQQRHIATA 60

Query: 69 IKRARYLGLI 78
          +K AR + L+
Sbjct: 61 VKNAREMALL 70


>gi|320012231|gb|ADW07081.1| ribosomal protein S18 [Streptomyces flavogriseus ATCC 33331]
          Length = 77

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          PL   G   +DYKD  LL +F+S RGKI   R++ ++ ++QR++A A+K AR + L+ Y
Sbjct: 15 PLDTAGITYVDYKDTDLLRKFVSDRGKIRSRRVTRITARQQRQVATAVKNAREMALLPY 73


>gi|313199617|ref|YP_004021233.1| ribosomal protein S18 [Isoetes flaccida]
 gi|291575346|gb|ADE18059.1| ribosomal protein S18 [Isoetes flaccida]
          Length = 75

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 47/68 (69%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S R++S P+  +    +DYK+I LL  F+S+RGKI+  R++ ++ K+QR +  A+KRAR 
Sbjct: 7  SSRKRSPPI--RSGETVDYKNISLLCGFISKRGKILSKRMNRLTSKQQRLMTIAVKRARI 64

Query: 75 LGLIAYVN 82
          L L+ +VN
Sbjct: 65 LALLPFVN 72


>gi|222084106|ref|YP_002519559.1| ribosomal protein S18 [Keteleeria davidiana]
 gi|220983658|dbj|BAH11424.1| ribosomal protein S18 [Keteleeria davidiana]
          Length = 86

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 51/76 (67%), Gaps = 1/76 (1%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P    RR+++  R+     G G  RIDYK++ L++RF+S++GKI+  R++ ++ K+QR +
Sbjct: 8  PKRSFRRHLTPIRRHLSPIGSGD-RIDYKNMSLISRFISEQGKILSGRVNRLTSKQQRLM 66

Query: 66 AKAIKRARYLGLIAYV 81
            AIKRAR L L+ ++
Sbjct: 67 TNAIKRARILSLLPFL 82


>gi|139390370|ref|YP_001122968.1| ribosomal protein S18 [Aethionema cordifolium]
 gi|205831412|sp|A4QJD7|RR18_AETCO RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|134286163|dbj|BAF49792.1| ribosomal protein S18 [Aethionema cordifolium]
          Length = 101

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 49/68 (72%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ V+ K+QR +  AIK+AR 
Sbjct: 14 SFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRVTLKQQRLITIAIKQARI 71

Query: 75 LGLIAYVN 82
          L L+ ++N
Sbjct: 72 LSLLPFIN 79


>gi|257461419|ref|ZP_05626515.1| ribosomal protein S18 [Campylobacter gracilis RM3268]
 gi|257441142|gb|EEV16289.1| ribosomal protein S18 [Campylobacter gracilis RM3268]
          Length = 86

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (57%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          + RK C  +      IDYKD  LL   LS+R KI+P R++  S K Q  + KAIKRAR  
Sbjct: 7  YTRKYCKFTEAKIEFIDYKDTALLKHCLSERFKIMPRRLTGTSKKYQEMVEKAIKRARQA 66

Query: 76 GLIAYV 81
           LI Y+
Sbjct: 67 ALIPYI 72


>gi|309322356|ref|YP_003934207.1| ribosomal protein S18 [Cedrus deodara]
 gi|62287468|sp|Q85UZ5|RR18_LAROX RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|62287469|sp|Q85UZ8|RR18_LARLA RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|62287470|sp|Q85V01|RR18_LARDC RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|30171092|gb|AAN18224.1| Rps18 [Larix sibirica]
 gi|30171097|gb|AAN18227.1| Rps18 [Larix gmelinii]
 gi|30171102|gb|AAN18230.1| Rps18 [Larix kaempferi]
 gi|30171107|gb|AAN18233.1| Rps18 [Larix decidua]
 gi|30171112|gb|AAN18236.1| Rps18 [Larix laricina]
 gi|30171117|gb|AAN18239.1| Rps18 [Larix occidentalis]
 gi|30171122|gb|AAN18242.1| Rps18 [Larix lyallii]
 gi|30171127|gb|AAN18245.1| Rps18 [Larix potaninii]
 gi|30171132|gb|AAN18248.1| Rps18 [Larix mastersiana]
 gi|30171137|gb|AAN18251.1| Rps18 [Larix griffithiana]
 gi|228017072|gb|ACP51894.1| ribosomal protein S18 [Cedrus deodara]
 gi|228017382|gb|ACP52199.1| ribosomal protein S18 [Larix occidentalis]
 gi|307683282|dbj|BAJ19590.1| ribosomal protein S18 [Cedrus deodara]
 gi|307683585|dbj|BAJ19771.1| ribosomal protein S18 [Larix decidua]
          Length = 86

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 51/76 (67%), Gaps = 1/76 (1%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P    RR+++  R+     G G  RIDYK++ L++RF+S++GKI+  R++ ++ K+QR +
Sbjct: 8  PKRSFRRHLTPIRRHLSPIGSGD-RIDYKNMSLISRFISEQGKILSGRVNRLTSKQQRLM 66

Query: 66 AKAIKRARYLGLIAYV 81
            AIKRAR L L+ ++
Sbjct: 67 TNAIKRARILSLLPFL 82


>gi|325474233|gb|EGC77421.1| 30S ribosomal protein S18 [Treponema denticola F0402]
          Length = 99

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 43/66 (65%), Gaps = 1/66 (1%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R+K C    +   +IDYK+   L RF+++RGKI+P RI+    K QR+LA  IKRAR +
Sbjct: 32 YRKKVCRFCAQKV-KIDYKEPDALRRFITERGKILPRRITGTCAKHQRKLAVEIKRARAV 90

Query: 76 GLIAYV 81
           L+ +V
Sbjct: 91 ALLPFV 96


>gi|257125009|ref|YP_003163123.1| ribosomal protein S18 [Leptotrichia buccalis C-1013-b]
 gi|257048948|gb|ACV38132.1| ribosomal protein S18 [Leptotrichia buccalis C-1013-b]
          Length = 79

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (73%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          I+YK++ LL  F++ +GKI P+R++ +  K QR++AKAIKRAR + L+ Y  +
Sbjct: 25 INYKNVELLKNFMNDKGKISPARVTGLEAKIQRKIAKAIKRARQIALMPYTKI 77


>gi|313183909|ref|YP_004021763.1| ribosomal protein S18 [Equisetum arvense]
 gi|281371629|gb|ADA63562.1| ribosomal protein S18 [Equisetum arvense]
          Length = 75

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 40/52 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYK+I LL RF+S++GKI+  R++ ++ K+QR +  AIKRAR L L+ ++N
Sbjct: 21 IDYKNISLLRRFISEQGKILSRRLNKLTSKQQRLMTVAIKRARVLALLPFLN 72


>gi|227876513|ref|ZP_03994625.1| possible ribosomal protein S18 [Mobiluncus mulieris ATCC 35243]
 gi|269977715|ref|ZP_06184675.1| ribosomal protein S18 [Mobiluncus mulieris 28-1]
 gi|306817474|ref|ZP_07451218.1| 30S ribosomal protein S18 [Mobiluncus mulieris ATCC 35239]
 gi|307699854|ref|ZP_07636905.1| ribosomal protein S18 [Mobiluncus mulieris FB024-16]
 gi|227843054|gb|EEJ53251.1| possible ribosomal protein S18 [Mobiluncus mulieris ATCC 35243]
 gi|269934019|gb|EEZ90593.1| ribosomal protein S18 [Mobiluncus mulieris 28-1]
 gi|304649698|gb|EFM46979.1| 30S ribosomal protein S18 [Mobiluncus mulieris ATCC 35239]
 gi|307614892|gb|EFN94110.1| ribosomal protein S18 [Mobiluncus mulieris FB024-16]
          Length = 81

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K  P+       IDYKD  LL +F+S RGKI   R++ V+ ++QR +AKA+K AR + 
Sbjct: 13 RKKFTPVKAHKVGPIDYKDTALLRKFISDRGKIRARRVTGVTTQEQRLIAKAVKNAREMA 72

Query: 77 LIAY 80
          L+ Y
Sbjct: 73 LLPY 76


>gi|307299235|ref|ZP_07579036.1| ribosomal protein S18 [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306915031|gb|EFN45417.1| ribosomal protein S18 [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 77

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query: 23 LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          L G     IDYK+I LL  +++++GKI+P RI+    K QR + +AI+RAR++ L+ Y 
Sbjct: 17 LCGTKTTYIDYKNISLLRDYVTEKGKIIPKRITGNCAKHQRMVKEAIQRARFMALLPYT 75


>gi|215400694|ref|YP_002327457.1| ribosomal protein S18 [Vaucheria litorea]
 gi|194441144|gb|ACF70872.1| ribosomal protein S18 [Vaucheria litorea]
          Length = 92

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 42/51 (82%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          IDYK+I LL+ FL+++GKI P R + ++ K+QR+LAK++K+AR+L L+ ++
Sbjct: 17 IDYKNIDLLHSFLNRQGKIRPRRSTKLTLKQQRKLAKSVKQARFLNLLPFI 67


>gi|325285226|ref|YP_004261016.1| 30S ribosomal protein S18 [Cellulophaga lytica DSM 7489]
 gi|324320680|gb|ADY28145.1| 30S ribosomal protein S18 [Cellulophaga lytica DSM 7489]
          Length = 98

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          TPL     + ++K C     G   +DYKD   L + ++++GK++P R++  S K QR++A
Sbjct: 20 TPL-NIETNKQKKYCRFKKSGIKYVDYKDPDFLIKLVNEQGKLLPRRLTGTSLKYQRKVA 78

Query: 67 KAIKRARYLGLIAYVN 82
           A+KRAR+L L+ YV 
Sbjct: 79 VAVKRARHLALMPYVG 94


>gi|42527183|ref|NP_972281.1| 30S ribosomal protein S18 [Treponema denticola ATCC 35405]
 gi|59798792|sp|Q73M34|RS18_TREDE RecName: Full=30S ribosomal protein S18
 gi|41817607|gb|AAS12192.1| ribosomal protein S18 [Treponema denticola ATCC 35405]
          Length = 89

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 43/66 (65%), Gaps = 1/66 (1%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R+K C    +   +IDYK+   L RF+++RGKI+P RI+    K QR+LA  IKRAR +
Sbjct: 22 YRKKVCRFCAQKV-KIDYKEPDALRRFITERGKILPRRITGTCAKHQRKLAVEIKRARAV 80

Query: 76 GLIAYV 81
           L+ +V
Sbjct: 81 ALLPFV 86


>gi|290487240|gb|ADD30004.1| ribosomal protein S18 [Ehretia acuminata]
          Length = 101

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P L+   S R++  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFLKSKRSFRKRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITI 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|166239996|gb|ABY86523.1| ribosomal protein S18 [Heliosperma alpestre]
          Length = 101

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P ++   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFIKSKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITI 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79


>gi|154148306|ref|YP_001405849.1| 30S ribosomal protein S18 [Campylobacter hominis ATCC BAA-381]
 gi|166220939|sp|A7I008|RS18_CAMHC RecName: Full=30S ribosomal protein S18
 gi|153804315|gb|ABS51322.1| ribosomal protein S18 [Campylobacter hominis ATCC BAA-381]
          Length = 87

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (57%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          + RK C  +      IDYKD  LL   LS+R KI+P R++  S K Q  + KAIKRAR  
Sbjct: 7  YTRKYCKFTEAKIEFIDYKDTALLKYCLSERFKIMPRRLTGTSKKYQEMVEKAIKRARQA 66

Query: 76 GLIAYV 81
           LI Y+
Sbjct: 67 ALIPYI 72


>gi|302330353|gb|ADL20547.1| 30S ribosomal protein S18 [Corynebacterium pseudotuberculosis
          1002]
          Length = 72

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 43/68 (63%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S R K  PL   G  ++DYKDI  L +F+S R KI   R++ ++ ++QR++A A+K AR 
Sbjct: 4  SRRPKKNPLKAAGIEKVDYKDINTLRQFISDRHKIRSRRVTGLTPQQQRQVATAVKNARE 63

Query: 75 LGLIAYVN 82
          + L+ + +
Sbjct: 64 MALLPFTS 71


>gi|332704307|ref|ZP_08424395.1| 30S ribosomal protein S18 [Desulfovibrio africanus str. Walvis
          Bay]
 gi|332554456|gb|EGJ51500.1| 30S ribosomal protein S18 [Desulfovibrio africanus str. Walvis
          Bay]
          Length = 86

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +R  + R+K C         IDYK+  LL  F++ RGKI+  RI+    K QR L  AI
Sbjct: 3  FKRRFAPRKKYCRFCADKNVAIDYKNADLLRDFITDRGKIIARRITGTCAKHQRRLTTAI 62

Query: 70 KRARYLGLIAYVN 82
          KR+R + L+ Y  
Sbjct: 63 KRSRQMALLFYTT 75


>gi|313679095|ref|YP_004056834.1| SSU ribosomal protein s18p [Oceanithermus profundus DSM 14977]
 gi|313151810|gb|ADR35661.1| SSU ribosomal protein S18P [Oceanithermus profundus DSM 14977]
          Length = 84

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 36/64 (56%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C          DYKD ++L RF+S+ GKI+P R + V  K QR LA  IKRAR L +I
Sbjct: 16 KVCQFCTGELEITDYKDAKMLKRFISETGKILPRRRTGVCAKHQRRLATTIKRARILAII 75

Query: 79 AYVN 82
           +  
Sbjct: 76 PFTE 79


>gi|309322155|ref|YP_003934070.1| ribosomal protein S18 [Geranium palmatum]
 gi|300069248|gb|ADJ66369.1| ribosomal protein S18 [Geranium palmatum]
          Length = 136

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 47/66 (71%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S RR+  P+  K   +I Y+++ L++RF+SQ+GKIV  R++ ++ K+QR L  AIK+AR 
Sbjct: 28 SVRRRMSPIKLKRGDQIQYRNVWLISRFISQQGKIVSRRMTRLTLKQQRLLTIAIKQARI 87

Query: 75 LGLIAY 80
          L L+++
Sbjct: 88 LSLLSF 93


>gi|182434342|ref|YP_001822061.1| putative 30S ribosomal protein S18 [Streptomyces griseus subsp.
          griseus NBRC 13350]
 gi|205556519|sp|B1VRG0|RS181_STRGG RecName: Full=30S ribosomal protein S18 1
 gi|113208307|dbj|BAF03512.1| putative ribosomal protein S18 [Streptomyces griseus]
 gi|178462858|dbj|BAG17378.1| putative 30S ribosomal protein S18 [Streptomyces griseus subsp.
          griseus NBRC 13350]
          Length = 82

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 38/61 (62%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          PL       IDYKD  LL RF+S RGKI   R++ +S ++QR++A AIK AR + L+ Y 
Sbjct: 17 PLDAAEITYIDYKDTDLLRRFVSDRGKIRGRRVTRISARQQRQVAAAIKNAREMALLPYT 76

Query: 82 N 82
           
Sbjct: 77 G 77


>gi|108796744|ref|YP_636554.1| ribosomal protein S18 [Zygnema circumcarinatum]
 gi|122226719|sp|Q32RH2|RR18_ZYGCR RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|61393728|gb|AAX45870.1| ribosomal protein S18 [Zygnema circumcarinatum]
          Length = 85

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 40/53 (75%)

Query: 30 RIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          RIDYK++RLL RF+S++ KI+  R+S ++ K+QR +A+ IK AR L  + +VN
Sbjct: 30 RIDYKNLRLLCRFVSKQAKILSRRVSRLTSKQQRTVARYIKSARVLAFMPFVN 82


>gi|186914926|gb|ACC95219.1| ribosomal protein S18 [Eudianthe laeta]
          Length = 101

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P L+   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFLKSKRSFRRRLPPI--QPGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITI 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILALLPFLN 79


>gi|291280361|ref|YP_003497196.1| 30S ribosomal protein S18 [Deferribacter desulfuricans SSM1]
 gi|290755063|dbj|BAI81440.1| 30S ribosomal protein S18 [Deferribacter desulfuricans SSM1]
          Length = 76

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 1/66 (1%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           R+K C    +    IDYKD  LL +F ++RGKI+P R++    K QR LA AIK AR +
Sbjct: 9  QRQKVCKFCTEHID-IDYKDANLLKQFTTERGKIMPRRLTGTCAKHQRRLADAIKTARIM 67

Query: 76 GLIAYV 81
           L+ + 
Sbjct: 68 ALLPFT 73


>gi|291296158|ref|YP_003507556.1| 30S ribosomal protein S18 [Meiothermus ruber DSM 1279]
 gi|290471117|gb|ADD28536.1| ribosomal protein S18 [Meiothermus ruber DSM 1279]
          Length = 92

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 39/51 (76%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
           D+K++ +L RFLS+ GKI+P R + ++ ++QR+LA+ IKRAR LGL+ + 
Sbjct: 36 TDFKNVEVLRRFLSETGKILPRRRTGLNAQEQRKLARTIKRARMLGLLPFT 86


>gi|117929338|ref|YP_873889.1| 30S ribosomal protein S18 [Acidothermus cellulolyticus 11B]
 gi|166220918|sp|A0LWU3|RS18_ACIC1 RecName: Full=30S ribosomal protein S18
 gi|117649801|gb|ABK53903.1| SSU ribosomal protein S18P [Acidothermus cellulolyticus 11B]
          Length = 78

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C    +G   +DYKD  LL +F+S RGKI   R++    + QR++A AIK +R + L+ Y
Sbjct: 14 CVFCKEGITYVDYKDTNLLRKFISDRGKIRARRVTGNCAQHQRDVATAIKNSREMALLPY 73

Query: 81 VN 82
           N
Sbjct: 74 TN 75


>gi|320449317|ref|YP_004201413.1| 30S ribosomal protein S18 [Thermus scotoductus SA-01]
 gi|320149486|gb|ADW20864.1| 30S ribosomal protein S18 [Thermus scotoductus SA-01]
          Length = 88

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 38/51 (74%)

Query: 32 DYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          DY+++ +L RFLS+ GKI+P R + ++ K+QR LA+ IKRAR LGL+ +  
Sbjct: 33 DYRNVEVLKRFLSETGKILPRRRTGLTAKEQRILARTIKRARILGLLPFTE 83


>gi|124302928|ref|YP_001023723.1| ribosomal protein S18 [Angiopteris evecta]
 gi|205831415|sp|A2T355|RR18_ANGEV RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|110628326|gb|ABG79622.1| ribosomal protein S18 [Angiopteris evecta]
          Length = 75

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 46/68 (67%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S RR+  P+  +    IDYK+I LL RF+S++GKI+  RI+ ++ K+QR +  AIKRAR 
Sbjct: 7  SSRRRLPPI--RSGEIIDYKNISLLRRFMSEQGKILSRRINRLTSKQQRLMTVAIKRARI 64

Query: 75 LGLIAYVN 82
          L L  ++N
Sbjct: 65 LALSPFLN 72


>gi|302205794|gb|ADL10136.1| 30S ribosomal protein S18 [Corynebacterium pseudotuberculosis
          C231]
 gi|308276029|gb|ADO25928.1| 30S ribosomal protein S18 [Corynebacterium pseudotuberculosis
          I19]
          Length = 77

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 43/68 (63%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S R K  PL   G  ++DYKDI  L +F+S R KI   R++ ++ ++QR++A A+K AR 
Sbjct: 9  SRRPKKNPLKAAGIEKVDYKDINTLRQFISDRHKIRSRRVTGLTPQQQRQVATAVKNARE 68

Query: 75 LGLIAYVN 82
          + L+ + +
Sbjct: 69 MALLPFTS 76


>gi|145652240|gb|ABP88170.1| hypothetical protein [Borrelia lonestari]
          Length = 124

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 17  RRKSCPLSG-KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           ++K+C        P  DYKD   L +F++ +