PSIBLAST alignment of GI: 254780330 and protein with PDB id: 1vs5

gi|116666565|pdb|1VS5|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 75
>gi|116666617|pdb|1VS7|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 75
 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72