PSIBLAST alignment of GI: 254780330 and protein with PDB id: 3bbn

>gi|188036219|pdb|3BBN|R Chain R, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 103
 Score = 79.6 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 54/81 (66%), Gaps = 2/81 (2%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
           + +  P ++   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+
Sbjct: 1  MDKSKRPFIKSKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQ 58

Query: 62 QRELAKAIKRARYLGLIAYVN 82
          QR +  AIK+AR L L+ ++N
Sbjct: 59 QRLITSAIKQARILSLLPFLN 79