PSIBLAST alignment of GI: 254780330 and protein with PDB id: 3e1a

gi|256032361|pdb|3E1A|K Chain K, Structure Of The 30s Subunit And The Trnas Of E. Coli Ribosome In Pre-Accommodation State Length = 75
>gi|256032418|pdb|3E1C|K Chain K, Structure Of The 30s Subunit And The Trnas Of E. Coli Ribosome In Post-Accommodation State Length = 75
 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTTEGVVEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72