BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780330|ref|YP_003064743.1| 30S ribosomal protein S18
[Candidatus Liberibacter asiaticus str. psy62]
         (83 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|300087857|ref|YP_003758379.1| 30S ribosomal protein S18 [Dehalogenimonas lykanthroporepellens
          BL-DC-9]
 gi|299527590|gb|ADJ26058.1| ribosomal protein S18 [Dehalogenimonas lykanthroporepellens
          BL-DC-9]
          Length = 153

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/65 (47%), Positives = 39/65 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C         IDYKD   L+R++S+RGKI P R S    K QR LA AIK+AR + 
Sbjct: 27 RRKVCAFCADKNLVIDYKDTARLSRYISERGKINPRRRSGTCAKHQRALANAIKQARMIA 86

Query: 77 LIAYV 81
          L+ +V
Sbjct: 87 LLPFV 91


>gi|323142969|ref|ZP_08077677.1| ribosomal protein S18 [Succinatimonas hippei YIT 12066]
 gi|322417242|gb|EFY07868.1| ribosomal protein S18 [Succinatimonas hippei YIT 12066]
          Length = 76

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 38/71 (53%), Positives = 49/71 (69%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
             HRRK C  + +G   IDYKD+ LL  ++++ GKIVPSRI+  S K QR+LA AIKRA
Sbjct: 3  RYFHRRKFCRFTAEGVTEIDYKDVALLKNYVTESGKIVPSRITGTSAKYQRQLATAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLALLPYTDL 73


>gi|308048250|ref|YP_003911816.1| 30S ribosomal protein S18P [Ferrimonas balearica DSM 9799]
 gi|307630440|gb|ADN74742.1| SSU ribosomal protein S18P [Ferrimonas balearica DSM 9799]
          Length = 75

 Score =  106 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 48/71 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVTEIDYKDIATLKNYVTESGKIVPSRITGTSAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLALLPYTDL 73


>gi|94971562|ref|YP_593610.1| 30S ribosomal protein S18 [Candidatus Koribacter versatilis
           Ellin345]
 gi|123079320|sp|Q1IHW4|RS18_ACIBL RecName: Full=30S ribosomal protein S18
 gi|94553612|gb|ABF43536.1| SSU ribosomal protein S18P [Candidatus Koribacter versatilis
           Ellin345]
          Length = 123

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 44/71 (61%)

Query: 12  RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
           R    R+K C    +    IDYKD+RLL +F+++ GKIVP R++ V    QR L+ AIK+
Sbjct: 51  RKFFRRKKVCKFCVEKIDAIDYKDVRLLGQFVAESGKIVPRRLTGVCTPHQRRLSDAIKQ 110

Query: 72  ARYLGLIAYVN 82
           AR + L+ + +
Sbjct: 111 ARNIALLPFAS 121


>gi|259047889|ref|ZP_05738290.1| 30S ribosomal protein S18 [Granulicatella adiacens ATCC 49175]
 gi|259035566|gb|EEW36821.1| 30S ribosomal protein S18 [Granulicatella adiacens ATCC 49175]
          Length = 80

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 41/66 (62%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C         IDYKD+ LL R++S++GKI+P R++    K QR L  AIKRAR +GL
Sbjct: 14 KKVCYFCANHVDYIDYKDVELLKRYISEKGKILPRRVTGTCAKHQRTLTVAIKRARIMGL 73

Query: 78 IAYVNL 83
          + +  +
Sbjct: 74 LPFTTV 79


>gi|298291082|ref|YP_003693021.1| ribosomal protein S18 [Starkeya novella DSM 506]
 gi|296927593|gb|ADH88402.1| ribosomal protein S18 [Starkeya novella DSM 506]
          Length = 88

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 16 RRPFFRRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSAKKQRELAQAIK 75

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ +V
Sbjct: 76 RARFLGLLPFV 86


>gi|71065895|ref|YP_264622.1| 30S ribosomal protein S18 [Psychrobacter arcticus 273-4]
 gi|93005859|ref|YP_580296.1| 30S ribosomal protein S18 [Psychrobacter cryohalolentis K5]
 gi|123264648|sp|Q1QBZ1|RS18_PSYCK RecName: Full=30S ribosomal protein S18
 gi|123748116|sp|Q4FS20|RS18_PSYA2 RecName: Full=30S ribosomal protein S18
 gi|71038880|gb|AAZ19188.1| SSU ribosomal protein S18P [Psychrobacter arcticus 273-4]
 gi|92393537|gb|ABE74812.1| SSU ribosomal protein S18P [Psychrobacter cryohalolentis K5]
          Length = 76

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 47/70 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+ LL +++S  GKIVPSRI+  S K QR+LA AIK+A
Sbjct: 3  RFYRRRKFCRFTAEGITHIDYKDVELLKQYISDNGKIVPSRITGTSTKYQRQLATAIKQA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|148653438|ref|YP_001280531.1| 30S ribosomal protein S18 [Psychrobacter sp. PRwf-1]
 gi|172048535|sp|A5WFZ0|RS18_PSYWF RecName: Full=30S ribosomal protein S18
 gi|148572522|gb|ABQ94581.1| SSU ribosomal protein S18P [Psychrobacter sp. PRwf-1]
 gi|332971480|gb|EGK10431.1| 50S ribosomal protein L21 [Psychrobacter sp. 1501(2011)]
          Length = 75

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 48/70 (68%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+ LL +++S  GKIVPSRI+  S+K QR+LA AIK+A
Sbjct: 3  RFYRRRKFCRFTAEGITHIDYKDVELLKQYISDNGKIVPSRITGTSNKYQRQLATAIKQA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|288941715|ref|YP_003443955.1| 30S ribosomal protein S18 [Allochromatium vinosum DSM 180]
 gi|288897087|gb|ADC62923.1| ribosomal protein S18 [Allochromatium vinosum DSM 180]
          Length = 74

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 48/71 (67%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               R++ C  + +G   IDYKD+ LL  ++S+ GKIVPSRI+  S K QR+LA+AIKR
Sbjct: 2  SRFFRRKRYCRFTAEGITEIDYKDLNLLKAYISESGKIVPSRITGTSAKYQRQLAQAIKR 61

Query: 72 ARYLGLIAYVN 82
          ARYL L+ Y +
Sbjct: 62 ARYLALLPYTD 72


>gi|326568102|gb|EGE18186.1| 30S ribosomal protein S18 [Moraxella catarrhalis BC7]
          Length = 75

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+ LL +++S+ GKI PSRI+  S K QR+L  AIK+A
Sbjct: 3  RFYRRRKFCRFTAEGITHIDYKDVELLKQYISENGKITPSRITGTSTKYQRQLTVAIKQA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|304312012|ref|YP_003811610.1| 30S ribosomal protein S18 [gamma proteobacterium HdN1]
 gi|301797745|emb|CBL45967.1| 30S ribosomal protein S18 [gamma proteobacterium HdN1]
          Length = 75

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 47/70 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+ LL  ++++ GKIVPSRI+  S + QR+LA A+KRA
Sbjct: 3  RFYRRRKFCRFTAEGVQEIDYKDLELLKNYITETGKIVPSRITGTSARYQRQLATAVKRA 62

Query: 73 RYLGLIAYVN 82
          R+L L+ Y +
Sbjct: 63 RFLALLPYTD 72


>gi|256821795|ref|YP_003145758.1| 30S ribosomal protein S18 [Kangiella koreensis DSM 16069]
 gi|256795334|gb|ACV25990.1| ribosomal protein S18 [Kangiella koreensis DSM 16069]
          Length = 75

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
            + RRK C  S +G   IDYKD   L  ++++ GKIVPSRI+  S K QR+LA A+KRA
Sbjct: 3  RFNRRRKFCRFSAEGVVEIDYKDTATLKNYITETGKIVPSRITGTSAKYQRQLASAVKRA 62

Query: 73 RYLGLIAYVN 82
          R+L L+ Y +
Sbjct: 63 RFLALLPYTD 72


>gi|312113718|ref|YP_004011314.1| ribosomal protein S18 [Rhodomicrobium vannielii ATCC 17100]
 gi|311218847|gb|ADP70215.1| ribosomal protein S18 [Rhodomicrobium vannielii ATCC 17100]
          Length = 83

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 64/81 (79%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M+    +   RR    RRK+CP SG+ AP IDYKD+RLL RF+S+RGKIVPSRI++VS K
Sbjct: 1  MSMQGTSGGARRPFYRRRKTCPFSGENAPVIDYKDVRLLQRFVSERGKIVPSRITAVSAK 60

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 61 KQRELAKAIKRARFLGLLPYV 81


>gi|212640664|ref|YP_002317184.1| 30S ribosomal protein S18 [Anoxybacillus flavithermus WK1]
 gi|212562144|gb|ACJ35199.1| Ribosomal protein S18 [Anoxybacillus flavithermus WK1]
          Length = 84

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 46/72 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +   + RRK C  +  G   IDYKD+  L +F+S+RGKI+P R++  S K QR+L  AI
Sbjct: 10 RKGGRTKRRKVCYFTANGITHIDYKDVDTLKKFISERGKILPRRVTGTSAKYQRKLTIAI 69

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 70 KRARQMALLPYV 81


>gi|296113491|ref|YP_003627429.1| 30S ribosomal protein S18 [Moraxella catarrhalis RH4]
 gi|295921185|gb|ADG61536.1| 30S ribosomal protein S18 [Moraxella catarrhalis RH4]
 gi|326559388|gb|EGE09813.1| 30S ribosomal protein S18 [Moraxella catarrhalis 46P47B1]
 gi|326559759|gb|EGE10169.1| 30S ribosomal protein S18 [Moraxella catarrhalis 7169]
 gi|326565023|gb|EGE15223.1| 30S ribosomal protein S18 [Moraxella catarrhalis 103P14B1]
 gi|326566025|gb|EGE16185.1| 30S ribosomal protein S18 [Moraxella catarrhalis 12P80B1]
 gi|326568519|gb|EGE18591.1| 30S ribosomal protein S18 [Moraxella catarrhalis BC1]
 gi|326572422|gb|EGE22414.1| 30S ribosomal protein S18 [Moraxella catarrhalis BC8]
 gi|326572532|gb|EGE22521.1| 30S ribosomal protein S18 [Moraxella catarrhalis CO72]
 gi|326574129|gb|EGE24077.1| 30S ribosomal protein S18 [Moraxella catarrhalis 101P30B1]
 gi|326575565|gb|EGE25489.1| 30S ribosomal protein S18 [Moraxella catarrhalis O35E]
          Length = 75

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 47/70 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+ LL +++S+ GKI PSRI+  S K QR+LA AIK+A
Sbjct: 3  RFYRRRKFCRFTAEGITHIDYKDVELLKQYISENGKITPSRITGTSTKYQRQLAVAIKQA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|220934100|ref|YP_002512999.1| ribosomal protein S18 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254812963|sp|B8GNS3|RS18_THISH RecName: Full=30S ribosomal protein S18
 gi|219995410|gb|ACL72012.1| ribosomal protein S18 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 74

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 46/71 (64%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+  S + QR+LA A+KR
Sbjct: 2  SRFFRRRKYCRFTAEGVEFIDYKDLNTLKNYITETGKIVPSRITGTSARYQRQLATAVKR 61

Query: 72 ARYLGLIAYVN 82
          ARYL L+ Y +
Sbjct: 62 ARYLALLPYCD 72


>gi|254448156|ref|ZP_05061619.1| ribosomal protein S18 [gamma proteobacterium HTCC5015]
 gi|198262282|gb|EDY86564.1| ribosomal protein S18 [gamma proteobacterium HTCC5015]
          Length = 74

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/69 (52%), Positives = 49/69 (71%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             RRK C  + +G  +IDYKD  LL +++++ GKIVPSRI+  S K QR+LAKAIKRAR
Sbjct: 4  YFRRRKYCRFTAEGITQIDYKDTDLLKQYITETGKIVPSRITGTSAKYQRQLAKAIKRAR 63

Query: 74 YLGLIAYVN 82
          Y+ L+ Y +
Sbjct: 64 YVALLPYSD 72


>gi|302383705|ref|YP_003819528.1| ribosomal protein S18 [Brevundimonas subvibrioides ATCC 15264]
 gi|302194333|gb|ADL01905.1| ribosomal protein S18 [Brevundimonas subvibrioides ATCC 15264]
          Length = 90

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR  + RRK CP +G+GAP+IDYKD++LL R++S+RGKIVPSRI++VS  KQRELAKAIK
Sbjct: 18 RRPFNRRRKVCPFTGEGAPKIDYKDVKLLQRYISERGKIVPSRITAVSQIKQRELAKAIK 77

Query: 71 RARYLGLIAYV 81
          RARYL L+ YV
Sbjct: 78 RARYLALLPYV 88


>gi|222085435|ref|YP_002543965.1| ribosomal protein S18 [Agrobacterium radiobacter K84]
 gi|254765402|sp|B9JCB8|RS18_AGRRK RecName: Full=30S ribosomal protein S18
 gi|221722883|gb|ACM26039.1| ribosomal protein S18 [Agrobacterium radiobacter K84]
          Length = 82

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 68/81 (83%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M+EV+  P+ RR    RRK+CP SG  APRIDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MSEVSSAPV-RRPFHRRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA+AIKRAR+LGL+ YV
Sbjct: 60 KQRELAQAIKRARFLGLLPYV 80


>gi|330720458|gb|EGG98765.1| SSU ribosomal protein S18p [gamma proteobacterium IMCC2047]
          Length = 75

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G  +IDYKD+  L  F+++ GKIVPSRI+    + QR+LA AIKRA
Sbjct: 3  RFFRRRKYCRFTAEGVDQIDYKDLDTLKGFVTETGKIVPSRITGTKARYQRQLATAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|300023234|ref|YP_003755845.1| ribosomal protein S18 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525055|gb|ADJ23524.1| ribosomal protein S18 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 84

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 62/71 (87%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG+GAP+IDYKD+R L R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 12 RRPFQRRRKTCPFSGEGAPKIDYKDVRTLGRYISERGKIVPSRITAVSAKKQRELAQAIK 71

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 72 RARFLGLLPYV 82


>gi|304413760|ref|ZP_07395204.1| 30S ribosomal subunit protein S18 [Candidatus Regiella
          insecticola LSR1]
 gi|304283851|gb|EFL92245.1| 30S ribosomal subunit protein S18 [Candidatus Regiella
          insecticola LSR1]
          Length = 75

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  PYFRRRKFCRFTAEGTLEIDYKDIVTLKNYITESGKIVPSRITGTCAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|58038780|ref|YP_190744.1| 30S ribosomal protein S18 [Gluconobacter oxydans 621H]
 gi|81672744|sp|Q5FU58|RS18_GLUOX RecName: Full=30S ribosomal protein S18
 gi|58001194|gb|AAW60088.1| SSU ribosomal protein S18P [Gluconobacter oxydans 621H]
          Length = 96

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 24 RRPFYRRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIK 83

Query: 71 RARYLGLIAYV 81
          RAR+L L+ YV
Sbjct: 84 RARFLALLPYV 94


>gi|257458034|ref|ZP_05623193.1| 30S ribosomal protein S18 [Treponema vincentii ATCC 35580]
 gi|257444747|gb|EEV19831.1| 30S ribosomal protein S18 [Treponema vincentii ATCC 35580]
          Length = 103

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 10  LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
            +  +  R+K C    + A  IDYKD   L RF+++RGKI+P RI+    K QR+LA  I
Sbjct: 31  KKGKMFFRKKVCRFCSQKAK-IDYKDPDSLRRFITERGKILPRRITGTCAKHQRKLALEI 89

Query: 70  KRARYLGLIAYV 81
           KRAR L L+ YV
Sbjct: 90  KRARALALLPYV 101


>gi|221633229|ref|YP_002522454.1| 30S ribosomal protein S18 [Thermomicrobium roseum DSM 5159]
 gi|221155713|gb|ACM04840.1| 30S ribosomal protein S18 [Thermomicrobium roseum DSM 5159]
          Length = 106

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 42/76 (55%)

Query: 6   PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
           P          R+K C     G  +IDYKD   L R+LS + KI P R +    K QR+L
Sbjct: 28  PARSAATRYYPRKKVCSFCMDGIKKIDYKDFGRLRRYLSPQAKIEPRRATGTCAKHQRQL 87

Query: 66  AKAIKRARYLGLIAYV 81
           A+AIKRAR+L L+ +V
Sbjct: 88  ARAIKRARHLALLPFV 103


>gi|294102403|ref|YP_003554261.1| ribosomal protein S18 [Aminobacterium colombiense DSM 12261]
 gi|293617383|gb|ADE57537.1| ribosomal protein S18 [Aminobacterium colombiense DSM 12261]
          Length = 87

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 42/70 (60%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    R K C         +DYKD+  L +++S+RGKI+P R++    K QR+L  AIK
Sbjct: 15 RRGGKRRPKVCFYCVDKIDYVDYKDVERLRKYISERGKIMPRRVTGNCAKHQRQLTTAIK 74

Query: 71 RARYLGLIAY 80
          RAR++ L+ Y
Sbjct: 75 RARFMALLPY 84


>gi|227821459|ref|YP_002825429.1| 30S ribosomal protein S18 [Sinorhizobium fredii NGR234]
 gi|254812951|sp|C3M9B0|RS18_RHISN RecName: Full=30S ribosomal protein S18
 gi|227340458|gb|ACP24676.1| 30S ribosomal protein S18 [Sinorhizobium fredii NGR234]
          Length = 82

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 68/81 (83%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MAEV+  P+ RR    RRK+CP SG  APRIDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MAEVSSAPV-RRPFHRRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA+AIKRAR+LGL+ YV
Sbjct: 60 KQRELAQAIKRARFLGLLPYV 80


>gi|116251320|ref|YP_767158.1| 30S ribosomal protein S18 [Rhizobium leguminosarum bv. viciae
          3841]
 gi|209548656|ref|YP_002280573.1| 30S ribosomal protein S18 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|241203934|ref|YP_002975030.1| 30S ribosomal protein S18 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|122988597|sp|Q1MJ11|RS18_RHIL3 RecName: Full=30S ribosomal protein S18
 gi|229560056|sp|B5ZWC8|RS18_RHILW RecName: Full=30S ribosomal protein S18
 gi|115255968|emb|CAK07049.1| putative 30S ribosomal protein S18 [Rhizobium leguminosarum bv.
          viciae 3841]
 gi|209534412|gb|ACI54347.1| ribosomal protein S18 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|240857824|gb|ACS55491.1| ribosomal protein S18 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 82

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 67/81 (82%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M+E +  P+ RR    RRK+CP SG  APRIDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MSETSSAPV-RRPFHRRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA+AIKRAR+LGL+ YV
Sbjct: 60 KQRELAQAIKRARFLGLLPYV 80


>gi|320537662|ref|ZP_08037595.1| ribosomal protein S18 [Treponema phagedenis F0421]
 gi|320145503|gb|EFW37186.1| ribosomal protein S18 [Treponema phagedenis F0421]
          Length = 102

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +  + +R+K C    +    IDYKD   L RF+++RGKI+P RI+    K QR+LA  I
Sbjct: 29 RKNKLFYRKKVCRFCSQKIK-IDYKDPDALRRFITERGKILPRRITGTCAKHQRKLATEI 87

Query: 70 KRARYLGLIAYV 81
          KRAR L L+ +V
Sbjct: 88 KRARALALLPFV 99


>gi|289209095|ref|YP_003461161.1| ribosomal protein S18 [Thioalkalivibrio sp. K90mix]
 gi|288944726|gb|ADC72425.1| ribosomal protein S18 [Thioalkalivibrio sp. K90mix]
          Length = 74

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 47/70 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+ LL  F+++ GKIVPSR++  S K QR+LA A+KRA
Sbjct: 3  RFPRRRKYCKFTAEGIDYIDYKDLNLLKGFVTETGKIVPSRVTGTSAKYQRQLATAVKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYSD 72


>gi|144899044|emb|CAM75908.1| 30S ribosomal protein S18 [Magnetospirillum gryphiswaldense
          MSR-1]
          Length = 90

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 51/71 (71%), Positives = 63/71 (88%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG+GAP+IDYKD +LL+RF+S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 18 RRPFFRRRKTCPFSGEGAPKIDYKDTKLLSRFISERGKIVPSRITAVSAKKQRELAQAIK 77

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 78 RARFLGLLPYV 88


>gi|119947024|ref|YP_944704.1| ribosomal protein S18 [Psychromonas ingrahamii 37]
 gi|166220979|sp|A1T040|RS18_PSYIN RecName: Full=30S ribosomal protein S18
 gi|119865628|gb|ABM05105.1| SSU ribosomal protein S18P [Psychromonas ingrahamii 37]
          Length = 75

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 47/71 (66%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVSEIDYKDVVTLKNYITESGKIVPSRITGTCAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLSLLPYTDL 73


>gi|295112204|emb|CBL28954.1| SSU ribosomal protein S18P [Synergistetes bacterium SGP1]
          Length = 92

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 47/76 (61%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          AP   +RR    R K C    +   ++DYKD+  L +++S+RGKIVP R++    K QR 
Sbjct: 14 APRGGMRRGSKRRPKFCYYCVEKQEKVDYKDVEKLRKYISERGKIVPRRVTGNCAKHQRL 73

Query: 65 LAKAIKRARYLGLIAY 80
          L +AIKRARY+ L+ Y
Sbjct: 74 LTEAIKRARYMALLPY 89


>gi|282855813|ref|ZP_06265115.1| ribosomal protein S18 [Pyramidobacter piscolens W5455]
 gi|282586327|gb|EFB91593.1| ribosomal protein S18 [Pyramidobacter piscolens W5455]
          Length = 82

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 8  PLLRRNVSHRR-KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          P+ +R    RR K C         +DYKD+  L +++S+RGKI+P R++    K QR+L 
Sbjct: 6  PMRKRGGGKRRPKVCFFCVDKLDEVDYKDVERLKKYVSERGKIIPRRVTGNCAKHQRQLT 65

Query: 67 KAIKRARYLGLIAYV 81
           A+KRAR++ L+ Y 
Sbjct: 66 IAVKRARFMALLPYT 80


>gi|86357077|ref|YP_468969.1| 30S ribosomal protein S18 [Rhizobium etli CFN 42]
 gi|190891121|ref|YP_001977663.1| 30S ribosomal protein S18 [Rhizobium etli CIAT 652]
 gi|123724812|sp|Q2KA94|RS18_RHIEC RecName: Full=30S ribosomal protein S18
 gi|229560055|sp|B3PUT6|RS18_RHIE6 RecName: Full=30S ribosomal protein S18
 gi|86281179|gb|ABC90242.1| 30S ribosomal protein S18 [Rhizobium etli CFN 42]
 gi|190696400|gb|ACE90485.1| 30S ribosomal protein S18 [Rhizobium etli CIAT 652]
 gi|327188000|gb|EGE55230.1| 30S ribosomal protein S18 [Rhizobium etli CNPAF512]
          Length = 82

 Score =  103 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 67/81 (82%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M+E +  P+ RR    RRK+CP SG  APRIDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MSEASSAPV-RRPFHRRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA+AIKRAR+LGL+ YV
Sbjct: 60 KQRELAQAIKRARFLGLLPYV 80


>gi|119776194|ref|YP_928934.1| 30S ribosomal protein S18 [Shewanella amazonensis SB2B]
 gi|166222237|sp|A1SA58|RS18_SHEAM RecName: Full=30S ribosomal protein S18
 gi|119768694|gb|ABM01265.1| SSU ribosomal protein S18P [Shewanella amazonensis SB2B]
          Length = 75

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 48/71 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVAEIDYKDIATLKNYITESGKIVPSRITGTSAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLSLLPYTDL 73


>gi|152977671|ref|YP_001377188.1| 30S ribosomal protein S18 [Bacillus cereus subsp. cytotoxis NVH
          391-98]
 gi|189029666|sp|A7GVN5|RS18_BACCN RecName: Full=30S ribosomal protein S18
 gi|152026423|gb|ABS24193.1| ribosomal protein S18 [Bacillus cytotoxicus NVH 391-98]
          Length = 77

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 35/72 (48%), Positives = 47/72 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +   + RRK C  +  G   IDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AI
Sbjct: 4  RKGGRAKRRKVCFFTANGITHIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAI 63

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 64 KRARQMALLPYV 75


>gi|229014638|ref|ZP_04171752.1| 30S ribosomal protein S18 [Bacillus mycoides DSM 2048]
 gi|229020697|ref|ZP_04177424.1| 30S ribosomal protein S18 [Bacillus cereus AH1273]
 gi|229026913|ref|ZP_04183236.1| 30S ribosomal protein S18 [Bacillus cereus AH1272]
 gi|229065131|ref|ZP_04200424.1| 30S ribosomal protein S18 [Bacillus cereus AH603]
 gi|229106064|ref|ZP_04236679.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-28]
 gi|229136297|ref|ZP_04265044.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-ST196]
 gi|229176148|ref|ZP_04303640.1| 30S ribosomal protein S18 [Bacillus cereus MM3]
 gi|228607307|gb|EEK64637.1| 30S ribosomal protein S18 [Bacillus cereus MM3]
 gi|228647169|gb|EEL03257.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-ST196]
 gi|228677350|gb|EEL31612.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-28]
 gi|228716160|gb|EEL67879.1| 30S ribosomal protein S18 [Bacillus cereus AH603]
 gi|228734371|gb|EEL85042.1| 30S ribosomal protein S18 [Bacillus cereus AH1272]
 gi|228740592|gb|EEL90863.1| 30S ribosomal protein S18 [Bacillus cereus AH1273]
 gi|228746649|gb|EEL96538.1| 30S ribosomal protein S18 [Bacillus mycoides DSM 2048]
          Length = 82

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 48/72 (66%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +   + RRK C  +  G  RIDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AI
Sbjct: 9  RKGGRAKRRKVCFFTSNGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAI 68

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 69 KRARQMALLPYV 80


>gi|239828694|ref|YP_002951318.1| 30S ribosomal protein S18 [Geobacillus sp. WCH70]
 gi|295402141|ref|ZP_06812100.1| ribosomal protein S18 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312112738|ref|YP_003991054.1| ribosomal protein S18 [Geobacillus sp. Y4.1MC1]
 gi|259494811|sp|C5D9X4|RS18_GEOSW RecName: Full=30S ribosomal protein S18
 gi|239808987|gb|ACS26052.1| ribosomal protein S18 [Geobacillus sp. WCH70]
 gi|294975824|gb|EFG51443.1| ribosomal protein S18 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311217839|gb|ADP76443.1| ribosomal protein S18 [Geobacillus sp. Y4.1MC1]
          Length = 78

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 47/72 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +   + RRK C  +  G   IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AI
Sbjct: 4  RKGGRAKRRKVCYFTANGITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAI 63

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 64 KRARQMALLPYV 75


>gi|56965862|ref|YP_177596.1| 30S ribosomal protein S18 [Bacillus clausii KSM-K16]
 gi|59798604|sp|Q5WAH5|RS18_BACSK RecName: Full=30S ribosomal protein S18
 gi|56912108|dbj|BAD66636.1| 30S ribosomal protein S18 [Bacillus clausii KSM-K16]
          Length = 77

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 48/74 (64%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR    RRK C  +      IDYKD+ LL RF+S+RGKI+P R++  S K QR+L  A
Sbjct: 1  MARRGRPKRRKVCFFTANKITHIDYKDVDLLKRFISERGKILPRRVTGTSAKYQRKLTVA 60

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ YVN
Sbjct: 61 IKRARQVALLPYVN 74


>gi|15616610|ref|NP_244916.1| 30S ribosomal protein S18 [Bacillus halodurans C-125]
 gi|11387101|sp|Q9K5P0|RS18_BACHD RecName: Full=30S ribosomal protein S18
 gi|10176673|dbj|BAB07767.1| 30S ribosomal protein S18 [Bacillus halodurans C-125]
          Length = 77

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 48/74 (64%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR    RRK C  +     +IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  A
Sbjct: 1  MARRGRPKRRKVCYFTVNKIEKIDYKDVDLLKKFVSERGKILPRRVTGTSAKYQRQLTTA 60

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ YV 
Sbjct: 61 IKRARQIALLPYVT 74


>gi|269837478|ref|YP_003319706.1| 30S ribosomal protein S18 [Sphaerobacter thermophilus DSM 20745]
 gi|269786741|gb|ACZ38884.1| ribosomal protein S18 [Sphaerobacter thermophilus DSM 20745]
          Length = 128

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 40/68 (58%)

Query: 14  VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
              RRK C     G   +DYKDI  L R++S+RGKI P R +    K QR LA AIKRAR
Sbjct: 60  YYPRRKVCGFCMDGIGEVDYKDIGRLRRYISERGKIEPRRQTGTCAKHQRSLAVAIKRAR 119

Query: 74  YLGLIAYV 81
           ++ L+ + 
Sbjct: 120 HVALLPFT 127


>gi|119502819|ref|ZP_01624904.1| 30S ribosomal protein S18 [marine gamma proteobacterium HTCC2080]
 gi|119461165|gb|EAW42255.1| 30S ribosomal protein S18 [marine gamma proteobacterium HTCC2080]
          Length = 75

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 46/71 (64%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               RRK C  + +G   IDYKD+  L +++++ GKIVPSRI+    K QR+LA A+KR
Sbjct: 2  SRFFRRRKFCKFTAEGVKEIDYKDLETLKQYITETGKIVPSRITGTKAKYQRQLATAVKR 61

Query: 72 ARYLGLIAYVN 82
          AR+L L+ Y +
Sbjct: 62 ARFLALLPYTD 72


>gi|24375416|ref|NP_719459.1| 30S ribosomal protein S18 [Shewanella oneidensis MR-1]
 gi|113971590|ref|YP_735383.1| 30S ribosomal protein S18 [Shewanella sp. MR-4]
 gi|114046198|ref|YP_736748.1| 30S ribosomal protein S18 [Shewanella sp. MR-7]
 gi|117919155|ref|YP_868347.1| 30S ribosomal protein S18 [Shewanella sp. ANA-3]
 gi|120600212|ref|YP_964786.1| 30S ribosomal protein S18 [Shewanella sp. W3-18-1]
 gi|126175836|ref|YP_001051985.1| 30S ribosomal protein S18 [Shewanella baltica OS155]
 gi|146291860|ref|YP_001182284.1| 30S ribosomal protein S18 [Shewanella putrefaciens CN-32]
 gi|152999252|ref|YP_001364933.1| 30S ribosomal protein S18 [Shewanella baltica OS185]
 gi|160873865|ref|YP_001553181.1| 30S ribosomal protein S18 [Shewanella baltica OS195]
 gi|217971925|ref|YP_002356676.1| 30S ribosomal protein S18 [Shewanella baltica OS223]
 gi|304411184|ref|ZP_07392799.1| ribosomal protein S18 [Shewanella baltica OS183]
 gi|307306479|ref|ZP_07586222.1| ribosomal protein S18 [Shewanella baltica BA175]
 gi|59798905|sp|Q8EAH4|RS18_SHEON RecName: Full=30S ribosomal protein S18
 gi|122943538|sp|Q0HF41|RS18_SHESM RecName: Full=30S ribosomal protein S18
 gi|123030904|sp|Q0HYW4|RS18_SHESR RecName: Full=30S ribosomal protein S18
 gi|166222238|sp|A3D8Q3|RS18_SHEB5 RecName: Full=30S ribosomal protein S18
 gi|166222239|sp|A6WJ81|RS18_SHEB8 RecName: Full=30S ribosomal protein S18
 gi|166222241|sp|A4Y3F2|RS18_SHEPC RecName: Full=30S ribosomal protein S18
 gi|166222242|sp|A0KT22|RS18_SHESA RecName: Full=30S ribosomal protein S18
 gi|166222243|sp|A1RNI7|RS18_SHESW RecName: Full=30S ribosomal protein S18
 gi|189029687|sp|A9L122|RS18_SHEB9 RecName: Full=30S ribosomal protein S18
 gi|254812954|sp|B8E9N8|RS18_SHEB2 RecName: Full=30S ribosomal protein S18
 gi|24350257|gb|AAN56903.1|AE015825_2 ribosomal protein S18 [Shewanella oneidensis MR-1]
 gi|113886274|gb|ABI40326.1| SSU ribosomal protein S18P [Shewanella sp. MR-4]
 gi|113887640|gb|ABI41691.1| SSU ribosomal protein S18P [Shewanella sp. MR-7]
 gi|117611487|gb|ABK46941.1| SSU ribosomal protein S18P [Shewanella sp. ANA-3]
 gi|120560305|gb|ABM26232.1| SSU ribosomal protein S18P [Shewanella sp. W3-18-1]
 gi|125999041|gb|ABN63116.1| SSU ribosomal protein S18P [Shewanella baltica OS155]
 gi|145563550|gb|ABP74485.1| SSU ribosomal protein S18P [Shewanella putrefaciens CN-32]
 gi|151363870|gb|ABS06870.1| ribosomal protein S18 [Shewanella baltica OS185]
 gi|160859387|gb|ABX47921.1| ribosomal protein S18 [Shewanella baltica OS195]
 gi|217497060|gb|ACK45253.1| ribosomal protein S18 [Shewanella baltica OS223]
 gi|304350377|gb|EFM14780.1| ribosomal protein S18 [Shewanella baltica OS183]
 gi|306910770|gb|EFN41198.1| ribosomal protein S18 [Shewanella baltica BA175]
 gi|315266092|gb|ADT92945.1| ribosomal protein S18 [Shewanella baltica OS678]
 gi|319425094|gb|ADV53168.1| ribosomal protein S18 [Shewanella putrefaciens 200]
          Length = 75

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 48/71 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVAEIDYKDIVTLKNYITESGKIVPSRITGTSAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLSLLPYTDL 73


>gi|127514210|ref|YP_001095407.1| ribosomal protein S18 [Shewanella loihica PV-4]
 gi|166222240|sp|A3QI50|RS18_SHELP RecName: Full=30S ribosomal protein S18
 gi|126639505|gb|ABO25148.1| SSU ribosomal protein S18P [Shewanella loihica PV-4]
          Length = 75

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 48/71 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  + K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVTEIDYKDIATLKNYITESGKIVPSRITGTNAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLSLLPYTDL 73


>gi|78485707|ref|YP_391632.1| ribosomal protein S18 [Thiomicrospira crunogena XCL-2]
 gi|123741575|sp|Q31FW5|RS18_THICR RecName: Full=30S ribosomal protein S18
 gi|78363993|gb|ABB41958.1| SSU ribosomal protein S18P [Thiomicrospira crunogena XCL-2]
          Length = 75

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              R+K C  + +G   IDYKD+  L  ++++ GKIVPSRI+  S K QR+L+ AIKRA
Sbjct: 3  RGFGRKKFCRFTVEGVKEIDYKDLDTLKSYITETGKIVPSRITGTSAKYQRQLSTAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|159184609|ref|NP_529002.1| 30S ribosomal protein S18 [Agrobacterium tumefaciens str. C58]
 gi|325292469|ref|YP_004278333.1| 30S ribosomal protein S18 [Agrobacterium sp. H13-3]
 gi|23822149|sp|Q8UGE8|RS18_AGRT5 RecName: Full=30S ribosomal protein S18
 gi|17739485|gb|AAL42103.1| 30S ribosomal protein S18 [Agrobacterium tumefaciens str. C58]
 gi|325060322|gb|ADY64013.1| 30S ribosomal protein S18 [Agrobacterium sp. H13-3]
          Length = 82

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 66/81 (81%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA+ + +   RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MADTS-SSQARRPFHRRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA+AIKRAR+LGL+ YV
Sbjct: 60 KQRELAQAIKRARFLGLLPYV 80


>gi|291458693|ref|ZP_06598083.1| ribosomal protein S18 [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291418610|gb|EFE92329.1| ribosomal protein S18 [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 118

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 42/76 (55%)

Query: 5   APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
           +  P        RRK C      A  +D+KDI  L +++S+RGKI+P RI+      QR 
Sbjct: 40  SARPRRAGGFRSRRKVCVFCSDKAKPVDFKDIATLRKYISERGKILPRRITGTCATHQRA 99

Query: 65  LAKAIKRARYLGLIAY 80
           +  AIKRAR++ L+ Y
Sbjct: 100 ITTAIKRARHIALLPY 115


>gi|90408976|ref|ZP_01217108.1| ribosomal protein S18 [Psychromonas sp. CNPT3]
 gi|90309924|gb|EAS38077.1| ribosomal protein S18 [Psychromonas sp. CNPT3]
          Length = 75

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 47/71 (66%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVSEIDYKDVTTLKNYITESGKIVPSRITGTCAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL LI Y +L
Sbjct: 63 RYLSLIPYTDL 73


>gi|15964890|ref|NP_385243.1| 30S ribosomal protein S18 [Sinorhizobium meliloti 1021]
 gi|150395964|ref|YP_001326431.1| 30S ribosomal protein S18 [Sinorhizobium medicae WSM419]
 gi|307300961|ref|ZP_07580730.1| ribosomal protein S18 [Sinorhizobium meliloti BL225C]
 gi|307322231|ref|ZP_07601599.1| ribosomal protein S18 [Sinorhizobium meliloti AK83]
 gi|20978707|sp|Q92QZ8|RS18_RHIME RecName: Full=30S ribosomal protein S18
 gi|166222244|sp|A6U7G6|RS18_SINMW RecName: Full=30S ribosomal protein S18
 gi|15074069|emb|CAC45716.1| Putative 30S ribosomal protein S18 [Sinorhizobium meliloti 1021]
 gi|150027479|gb|ABR59596.1| ribosomal protein S18 [Sinorhizobium medicae WSM419]
 gi|306892118|gb|EFN22936.1| ribosomal protein S18 [Sinorhizobium meliloti AK83]
 gi|306903916|gb|EFN34502.1| ribosomal protein S18 [Sinorhizobium meliloti BL225C]
          Length = 82

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 68/81 (83%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MAEV+  P+ RR    RRK+CP SG  APRIDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MAEVSSAPV-RRPFHRRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA+AIKRAR+LGL+ Y+
Sbjct: 60 KQRELAQAIKRARFLGLLPYI 80


>gi|288554587|ref|YP_003426522.1| 30S ribosomal protein S18 [Bacillus pseudofirmus OF4]
 gi|288545747|gb|ADC49630.1| 30S ribosomal protein S18 [Bacillus pseudofirmus OF4]
          Length = 77

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 48/74 (64%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR    RRK C  +     +IDYKD  LL RF+S+RGKI+P R++  S K QR+L  A
Sbjct: 1  MARRGRPKRRKVCFFTVNKITKIDYKDTDLLKRFISERGKILPRRVTGTSAKYQRQLTTA 60

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ YVN
Sbjct: 61 IKRARQIALLPYVN 74


>gi|229824647|ref|ZP_04450716.1| hypothetical protein GCWU000282_01994 [Catonella morbi ATCC
          51271]
 gi|229786018|gb|EEP22132.1| hypothetical protein GCWU000282_01994 [Catonella morbi ATCC
          51271]
          Length = 81

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 38/63 (60%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C          DYKD+ LL RF+S++GKI+P R++    K QR L  AIKRAR +GL+
Sbjct: 16 KVCFFCANHIDHPDYKDVDLLKRFISEKGKILPRRVTGTCAKHQRALTVAIKRARIMGLL 75

Query: 79 AYV 81
           + 
Sbjct: 76 PFT 78


>gi|148260511|ref|YP_001234638.1| 30S ribosomal protein S18 [Acidiphilium cryptum JF-5]
 gi|326403703|ref|YP_004283785.1| 30S ribosomal protein S18 [Acidiphilium multivorum AIU301]
 gi|205556745|sp|A5FYN7|RS18_ACICJ RecName: Full=30S ribosomal protein S18
 gi|146402192|gb|ABQ30719.1| SSU ribosomal protein S18P [Acidiphilium cryptum JF-5]
 gi|325050565|dbj|BAJ80903.1| 30S ribosomal protein S18 [Acidiphilium multivorum AIU301]
          Length = 95

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 51/71 (71%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 23 RRPFYRRRKACPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELARAIK 82

Query: 71 RARYLGLIAYV 81
          RAR+L L+ YV
Sbjct: 83 RARFLALLPYV 93


>gi|291561870|emb|CBL40671.1| SSU ribosomal protein S18P [butyrate-producing bacterium SS3/4]
          Length = 88

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 45/75 (60%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          + + R  +  R+K C   G     IDYKD+  L R++S+RGKI+P RI+    K QR L 
Sbjct: 12 SRVRRGGMHRRKKVCVFCGDKNGEIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALT 71

Query: 67 KAIKRARYLGLIAYV 81
           AIKRAR++ L+ Y 
Sbjct: 72 VAIKRARHIALMPYT 86


>gi|157373898|ref|YP_001472498.1| ribosomal protein S18 [Shewanella sediminis HAW-EB3]
 gi|157963398|ref|YP_001503432.1| 30S ribosomal protein S18 [Shewanella pealeana ATCC 700345]
 gi|163749305|ref|ZP_02156554.1| ribosomal protein S18 [Shewanella benthica KT99]
 gi|167625579|ref|YP_001675873.1| 30S ribosomal protein S18 [Shewanella halifaxensis HAW-EB4]
 gi|170728535|ref|YP_001762561.1| 30S ribosomal protein S18 [Shewanella woodyi ATCC 51908]
 gi|212633591|ref|YP_002310116.1| 30S ribosomal protein S18 [Shewanella piezotolerans WP3]
 gi|294139216|ref|YP_003555194.1| 30S ribosomal protein S18 [Shewanella violacea DSS12]
 gi|189029688|sp|B0TUU7|RS18_SHEHH RecName: Full=30S ribosomal protein S18
 gi|189029689|sp|A8H8L0|RS18_SHEPA RecName: Full=30S ribosomal protein S18
 gi|189029690|sp|A8FR97|RS18_SHESH RecName: Full=30S ribosomal protein S18
 gi|226735124|sp|B8CIQ3|RS18_SHEPW RecName: Full=30S ribosomal protein S18
 gi|229560073|sp|B1KHY8|RS18_SHEWM RecName: Full=30S ribosomal protein S18
 gi|157316272|gb|ABV35370.1| ribosomal protein S18 [Shewanella sediminis HAW-EB3]
 gi|157848398|gb|ABV88897.1| ribosomal protein S18 [Shewanella pealeana ATCC 700345]
 gi|161331024|gb|EDQ01950.1| ribosomal protein S18 [Shewanella benthica KT99]
 gi|167355601|gb|ABZ78214.1| ribosomal protein S18 [Shewanella halifaxensis HAW-EB4]
 gi|169813882|gb|ACA88466.1| ribosomal protein S18 [Shewanella woodyi ATCC 51908]
 gi|212555075|gb|ACJ27529.1| Ribosomal protein S18 [Shewanella piezotolerans WP3]
 gi|293325685|dbj|BAJ00416.1| ribosomal protein S18 [Shewanella violacea DSS12]
          Length = 75

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 48/71 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  + K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVTEIDYKDIVTLKNYITESGKIVPSRITGTNAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLSLLPYTDL 73


>gi|83311200|ref|YP_421464.1| 30S ribosomal protein S18 [Magnetospirillum magneticum AMB-1]
 gi|123768010|sp|Q2W5H0|RS18_MAGMM RecName: Full=30S ribosomal protein S18
 gi|82946041|dbj|BAE50905.1| Ribosomal protein S18 [Magnetospirillum magneticum AMB-1]
          Length = 92

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 64/71 (90%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG+GAP+IDYKDI+LL+RF+S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 20 RRPFFRRRKTCPFSGEGAPKIDYKDIKLLSRFISERGKIVPSRITAVSAKKQRELAQAIK 79

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 80 RARFLGLLPYV 90


>gi|91791881|ref|YP_561532.1| 30S ribosomal protein S18 [Shewanella denitrificans OS217]
 gi|123166502|sp|Q12RW7|RS18_SHEDO RecName: Full=30S ribosomal protein S18
 gi|91713883|gb|ABE53809.1| SSU ribosomal protein S18P [Shewanella denitrificans OS217]
          Length = 75

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 48/71 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTSEGVAEIDYKDIVTLKNYITESGKIVPSRITGTSAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLSLLPYTDL 73


>gi|189425664|ref|YP_001952841.1| 30S ribosomal protein S18 [Geobacter lovleyi SZ]
 gi|226735121|sp|B3E6H4|RS18_GEOLS RecName: Full=30S ribosomal protein S18
 gi|189421923|gb|ACD96321.1| ribosomal protein S18 [Geobacter lovleyi SZ]
          Length = 110

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 44/77 (57%)

Query: 3   EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
           +  P    ++    RRK C    +    IDYKD R L  F+++RGKIVP RIS    K Q
Sbjct: 26  DRGPGGPRKKRPFQRRKVCRFCAEKDTTIDYKDPRTLRYFITERGKIVPRRISGNCSKHQ 85

Query: 63  RELAKAIKRARYLGLIA 79
           RE+ +AIKRAR L L+ 
Sbjct: 86  REITEAIKRARNLALLP 102


>gi|222148135|ref|YP_002549092.1| 30S ribosomal protein S18 [Agrobacterium vitis S4]
 gi|254765403|sp|B9JUU1|RS18_AGRVS RecName: Full=30S ribosomal protein S18
 gi|221735123|gb|ACM36086.1| 30S ribosomal protein S18 [Agrobacterium vitis S4]
          Length = 82

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 55/81 (67%), Positives = 68/81 (83%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MAEV+ +  +RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MAEVS-SSTVRRPFHRRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|296532305|ref|ZP_06895044.1| 30S ribosomal protein S18 [Roseomonas cervicalis ATCC 49957]
 gi|296267381|gb|EFH13267.1| 30S ribosomal protein S18 [Roseomonas cervicalis ATCC 49957]
          Length = 93

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 63/81 (77%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          +A   P    RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS K
Sbjct: 10 IAARRPAVGARRPFYRRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSGK 69

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA AIKRAR+L L+ YV
Sbjct: 70 KQRELANAIKRARFLALLPYV 90


>gi|197105008|ref|YP_002130385.1| RpsR, ribosomal protein S18 [Phenylobacterium zucineum HLK1]
 gi|196478428|gb|ACG77956.1| RpsR, ribosomal protein S18 [Phenylobacterium zucineum HLK1]
          Length = 96

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 55/63 (87%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELAKAIKRAR+L L+
Sbjct: 32 KVCPFSGANAPKIDYKDVKLLQRYVSERGKIVPSRITAVSAKKQRELAKAIKRARFLALL 91

Query: 79 AYV 81
           YV
Sbjct: 92 PYV 94


>gi|53803659|ref|YP_114469.1| 30S ribosomal protein S18 [Methylococcus capsulatus str. Bath]
 gi|59798627|sp|Q606H9|RS18_METCA RecName: Full=30S ribosomal protein S18
 gi|53757420|gb|AAU91711.1| ribosomal protein S18 [Methylococcus capsulatus str. Bath]
          Length = 76

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RR+ C  + +    IDYKD+  L  ++S+ GKIVPSRI+  S K QR+LA AIKRA
Sbjct: 3  RQFKRRRYCRFTAEDVKEIDYKDLDTLREYVSETGKIVPSRITGTSAKYQRQLATAIKRA 62

Query: 73 RYLGLIAYVN 82
          R+L L+ + +
Sbjct: 63 RFLALLPFCD 72


>gi|57234187|ref|YP_181760.1| 30S ribosomal protein S18 [Dehalococcoides ethenogenes 195]
 gi|123773606|sp|Q3Z7N9|RS18_DEHE1 RecName: Full=30S ribosomal protein S18
 gi|57224635|gb|AAW39692.1| ribosomal protein S18 [Dehalococcoides ethenogenes 195]
          Length = 147

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 44/77 (57%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P    R   + +RK C    +   RIDYKD   L R++S RGKI P R +    + QR L
Sbjct: 10 PARGGRGRYTPKRKICSFCAEKVSRIDYKDSAKLARYISDRGKIEPRRRTGTCARHQRAL 69

Query: 66 AKAIKRARYLGLIAYVN 82
          A AIKRAR++ L+ +V+
Sbjct: 70 ANAIKRARFIALMPFVS 86


>gi|319789282|ref|YP_004150915.1| ribosomal protein S18 [Thermovibrio ammonificans HB-1]
 gi|317113784|gb|ADU96274.1| ribosomal protein S18 [Thermovibrio ammonificans HB-1]
          Length = 80

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 50/73 (68%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +R    RRK C    +   RIDYK++ LL  F+S+RG+I+P RIS V  K QR+LA+A+K
Sbjct: 7  QRRFVRRRKYCKFCAEKIERIDYKNVELLKSFISERGRIIPRRISGVCSKHQRQLARAVK 66

Query: 71 RARYLGLIAYVNL 83
          RAR+L L+ +V +
Sbjct: 67 RARHLALLPFVKM 79


>gi|258542090|ref|YP_003187523.1| 30S ribosomal protein S18 [Acetobacter pasteurianus IFO 3283-01]
 gi|329114157|ref|ZP_08242919.1| 30S ribosomal protein S18 [Acetobacter pomorum DM001]
 gi|256633168|dbj|BAH99143.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636225|dbj|BAI02194.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639280|dbj|BAI05242.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642334|dbj|BAI08289.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645389|dbj|BAI11337.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648444|dbj|BAI14385.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651497|dbj|BAI17431.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO
          3283-01-42C]
 gi|256654488|dbj|BAI20415.1| SSU ribosomal protein S18P [Acetobacter pasteurianus IFO 3283-12]
 gi|326696233|gb|EGE47912.1| 30S ribosomal protein S18 [Acetobacter pomorum DM001]
          Length = 91

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 54/80 (67%), Positives = 63/80 (78%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          A   P    RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KK
Sbjct: 10 AARRPAVGARRPFYRRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKK 69

Query: 62 QRELAKAIKRARYLGLIAYV 81
          QRELA+AIKRAR+L L+ YV
Sbjct: 70 QRELAQAIKRARFLALLPYV 89


>gi|332971411|gb|EGK10369.1| 30S ribosomal protein S18 [Desmospora sp. 8437]
          Length = 75

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/74 (45%), Positives = 48/74 (64%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR  + RRK C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L +A
Sbjct: 1  MARRRGNKRRKVCFFTVNKIEYIDYKDVDLLRKFISERGKILPRRVTGTSSKYQRQLTRA 60

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ Y  
Sbjct: 61 IKRARQMALLPYTT 74


>gi|240144659|ref|ZP_04743260.1| ribosomal protein S18 [Roseburia intestinalis L1-82]
 gi|257203299|gb|EEV01584.1| ribosomal protein S18 [Roseburia intestinalis L1-82]
 gi|291537110|emb|CBL10222.1| SSU ribosomal protein S18P [Roseburia intestinalis M50/1]
 gi|291540345|emb|CBL13456.1| SSU ribosomal protein S18P [Roseburia intestinalis XB6B4]
          Length = 87

 Score =  102 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/80 (45%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          A+    P+ RR +  R+K C   G     IDYKD   L R++S+RGKI+P RI+    K 
Sbjct: 7  ADKDGAPMKRRPMHRRKKVCVFCG-KDNVIDYKDTNKLKRYISERGKILPRRITGNCAKH 65

Query: 62 QRELAKAIKRARYLGLIAYV 81
          QR L  AIKRAR++ L+ YV
Sbjct: 66 QRALTVAIKRARHVALMPYV 85


>gi|114319745|ref|YP_741428.1| 30S ribosomal protein S18 [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312361|sp|Q0AB49|RS18_ALHEH RecName: Full=30S ribosomal protein S18
 gi|114226139|gb|ABI55938.1| SSU ribosomal protein S18P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 74

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 47/70 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+  S + QR+LA+AIKRA
Sbjct: 3  RFFRRRKYCRFTAEGVKEIDYKDLNTLRNYVTETGKIVPSRITGTSARYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|158520026|ref|YP_001527896.1| ribosomal protein S18 [Desulfococcus oleovorans Hxd3]
 gi|205557251|sp|A8ZRQ2|RS18_DESOH RecName: Full=30S ribosomal protein S18
 gi|158508852|gb|ABW65819.1| ribosomal protein S18 [Desulfococcus oleovorans Hxd3]
          Length = 83

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 48/78 (61%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          + P+P  ++ V HRRK C      +  IDYK+ + L  F+++RGKI+P RIS    K QR
Sbjct: 1  MNPSPRGKKRVFHRRKYCRFCADSSLPIDYKNPKSLKSFITERGKIIPRRISGTCAKHQR 60

Query: 64 ELAKAIKRARYLGLIAYV 81
           + + IKRAR + L+ YV
Sbjct: 61 AITREIKRARTIALLPYV 78


>gi|30023496|ref|NP_835127.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 14579]
 gi|42784668|ref|NP_981915.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 10987]
 gi|47568671|ref|ZP_00239368.1| ribosomal protein S18 [Bacillus cereus G9241]
 gi|206970197|ref|ZP_03231150.1| 30S ribosomal protein S18 [Bacillus cereus AH1134]
 gi|206975889|ref|ZP_03236800.1| 30S ribosomal protein S18 [Bacillus cereus H3081.97]
 gi|217962965|ref|YP_002341543.1| 30S ribosomal protein S18 [Bacillus cereus AH187]
 gi|218232550|ref|YP_002370247.1| 30S ribosomal protein S18 [Bacillus cereus B4264]
 gi|218900613|ref|YP_002449024.1| ribosomal protein S18 [Bacillus cereus G9842]
 gi|222098949|ref|YP_002533007.1| 30S ribosomal protein s18 [Bacillus cereus Q1]
 gi|228905416|ref|ZP_04069371.1| 30S ribosomal protein S18 [Bacillus thuringiensis IBL 4222]
 gi|228911311|ref|ZP_04075115.1| 30S ribosomal protein S18 [Bacillus thuringiensis IBL 200]
 gi|228924217|ref|ZP_04087488.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          huazhongensis BGSC 4BD1]
 gi|228942621|ref|ZP_04105153.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          berliner ATCC 10792]
 gi|228955723|ref|ZP_04117718.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
 gi|228961736|ref|ZP_04123339.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          pakistani str. T13001]
 gi|228968624|ref|ZP_04129607.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar sotto
          str. T04001]
 gi|228975551|ref|ZP_04136103.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228982187|ref|ZP_04142476.1| 30S ribosomal protein S18 [Bacillus thuringiensis Bt407]
 gi|228988700|ref|ZP_04148785.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
 gi|229051141|ref|ZP_04194685.1| 30S ribosomal protein S18 [Bacillus cereus AH676]
 gi|229072937|ref|ZP_04206133.1| 30S ribosomal protein S18 [Bacillus cereus F65185]
 gi|229082681|ref|ZP_04215135.1| 30S ribosomal protein S18 [Bacillus cereus Rock4-2]
 gi|229112885|ref|ZP_04242416.1| 30S ribosomal protein S18 [Bacillus cereus Rock1-15]
 gi|229130718|ref|ZP_04259671.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-Cer4]
 gi|229142221|ref|ZP_04270745.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-ST26]
 gi|229148022|ref|ZP_04276361.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-ST24]
 gi|229153631|ref|ZP_04281807.1| 30S ribosomal protein S18 [Bacillus cereus m1550]
 gi|229159032|ref|ZP_04287088.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 4342]
 gi|229164423|ref|ZP_04292351.1| 30S ribosomal protein S18 [Bacillus cereus R309803]
 gi|229181718|ref|ZP_04309041.1| 30S ribosomal protein S18 [Bacillus cereus 172560W]
 gi|229193723|ref|ZP_04320664.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 10876]
 gi|229199602|ref|ZP_04326262.1| 30S ribosomal protein S18 [Bacillus cereus m1293]
 gi|296505900|ref|YP_003667600.1| 30S ribosomal protein S18 [Bacillus thuringiensis BMB171]
 gi|59798780|sp|Q72WV5|RS18_BACC1 RecName: Full=30S ribosomal protein S18
 gi|59798875|sp|Q814G7|RS18_BACCR RecName: Full=30S ribosomal protein S18
 gi|226735108|sp|B7IS16|RS18_BACC2 RecName: Full=30S ribosomal protein S18
 gi|226735109|sp|B7HGD2|RS18_BACC4 RecName: Full=30S ribosomal protein S18
 gi|226735110|sp|B7HZF9|RS18_BACC7 RecName: Full=30S ribosomal protein S18
 gi|254765410|sp|B9IT30|RS18_BACCQ RecName: Full=30S ribosomal protein S18
 gi|29899057|gb|AAP12328.1| SSU ribosomal protein S18P [Bacillus cereus ATCC 14579]
 gi|42740600|gb|AAS44523.1| ribosomal protein S18 [Bacillus cereus ATCC 10987]
 gi|47554659|gb|EAL13013.1| ribosomal protein S18 [Bacillus cereus G9241]
 gi|206734774|gb|EDZ51943.1| 30S ribosomal protein S18 [Bacillus cereus AH1134]
 gi|206745983|gb|EDZ57379.1| 30S ribosomal protein S18 [Bacillus cereus H3081.97]
 gi|217064909|gb|ACJ79159.1| ribosomal protein S18 [Bacillus cereus AH187]
 gi|218160507|gb|ACK60499.1| ribosomal protein S18 [Bacillus cereus B4264]
 gi|218540805|gb|ACK93199.1| ribosomal protein S18 [Bacillus cereus G9842]
 gi|221243008|gb|ACM15718.1| ribosomal protein S18 [Bacillus cereus Q1]
 gi|228583876|gb|EEK42034.1| 30S ribosomal protein S18 [Bacillus cereus m1293]
 gi|228589748|gb|EEK47626.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 10876]
 gi|228601751|gb|EEK59249.1| 30S ribosomal protein S18 [Bacillus cereus 172560W]
 gi|228619028|gb|EEK75926.1| 30S ribosomal protein S18 [Bacillus cereus R309803]
 gi|228624451|gb|EEK81222.1| 30S ribosomal protein S18 [Bacillus cereus ATCC 4342]
 gi|228629817|gb|EEK86470.1| 30S ribosomal protein S18 [Bacillus cereus m1550]
 gi|228635447|gb|EEK91938.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-ST24]
 gi|228641239|gb|EEK97546.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-ST26]
 gi|228652735|gb|EEL08620.1| 30S ribosomal protein S18 [Bacillus cereus BDRD-Cer4]
 gi|228670564|gb|EEL25877.1| 30S ribosomal protein S18 [Bacillus cereus Rock1-15]
 gi|228700626|gb|EEL53158.1| 30S ribosomal protein S18 [Bacillus cereus Rock4-2]
 gi|228710183|gb|EEL62161.1| 30S ribosomal protein S18 [Bacillus cereus F65185]
 gi|228722204|gb|EEL73605.1| 30S ribosomal protein S18 [Bacillus cereus AH676]
 gi|228771012|gb|EEM19493.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
 gi|228777539|gb|EEM25817.1| 30S ribosomal protein S18 [Bacillus thuringiensis Bt407]
 gi|228784161|gb|EEM32188.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228791053|gb|EEM38671.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar sotto
          str. T04001]
 gi|228797930|gb|EEM44940.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          pakistani str. T13001]
 gi|228803951|gb|EEM50575.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
 gi|228817047|gb|EEM63140.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          berliner ATCC 10792]
 gi|228835435|gb|EEM80805.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          huazhongensis BGSC 4BD1]
 gi|228848329|gb|EEM93179.1| 30S ribosomal protein S18 [Bacillus thuringiensis IBL 200]
 gi|228854236|gb|EEM98939.1| 30S ribosomal protein S18 [Bacillus thuringiensis IBL 4222]
 gi|296326952|gb|ADH09880.1| 30S ribosomal protein S18 [Bacillus thuringiensis BMB171]
 gi|324329423|gb|ADY24683.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          finitimus YBT-020]
 gi|326943270|gb|AEA19166.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          chinensis CT-43]
          Length = 77

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 48/72 (66%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +   + RRK C  +  G  RIDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AI
Sbjct: 4  RKGGRAKRRKVCFFTANGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAI 63

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 64 KRARQMALLPYV 75


>gi|288958519|ref|YP_003448860.1| small subunit ribosomal protein S18 [Azospirillum sp. B510]
 gi|288910827|dbj|BAI72316.1| small subunit ribosomal protein S18 [Azospirillum sp. B510]
          Length = 89

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP IDYKD++LL+RF+S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 17 RRPFFRRRKTCPFSGANAPAIDYKDVKLLSRFISERGKIVPSRITAVSTKKQRELARAIK 76

Query: 71 RARYLGLIAYV 81
          RAR+L L+ YV
Sbjct: 77 RARFLALLPYV 87


>gi|260584271|ref|ZP_05852018.1| 30S ribosomal protein S18 [Granulicatella elegans ATCC 700633]
 gi|260157789|gb|EEW92858.1| 30S ribosomal protein S18 [Granulicatella elegans ATCC 700633]
          Length = 80

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 42/66 (63%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +      IDYKD+ LL R++S++GKI+P R++    K QR L  AIKRAR +GL
Sbjct: 14 KKVCYFTANHITYIDYKDVELLKRYISEKGKILPRRVTGTCAKYQRLLTVAIKRARIMGL 73

Query: 78 IAYVNL 83
          + +  +
Sbjct: 74 LPFTTV 79


>gi|59798883|sp|Q82XQ8|RS18_NITEU RecName: Full=30S ribosomal protein S18
          Length = 76

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 47/74 (63%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  R +  R+K C  + +G   IDYKDI LL  F+S+ G+I+P+RI+      QR+L  A
Sbjct: 1  MANRPLFKRKKFCRFTAEGIKHIDYKDIDLLKDFVSENGRIIPARITGTRAYYQRQLNLA 60

Query: 69 IKRARYLGLIAYVN 82
          I+RAR+L L+ Y +
Sbjct: 61 IERARFLALLPYTD 74


>gi|325295181|ref|YP_004281695.1| 30S ribosomal protein S18 [Desulfurobacterium thermolithotrophum
          DSM 11699]
 gi|325065629|gb|ADY73636.1| 30S ribosomal protein S18 [Desulfurobacterium thermolithotrophum
          DSM 11699]
          Length = 80

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 50/73 (68%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +R    RRK C    +   +IDYK++ LL  F+S+RG+I+P RIS V  K QR+LA+A+K
Sbjct: 7  QRRFVRRRKYCKFCAEKIEKIDYKNVELLKPFISERGRIIPRRISGVCSKHQRQLARAVK 66

Query: 71 RARYLGLIAYVNL 83
          RAR+L L+ +V +
Sbjct: 67 RARHLALLPFVKI 79


>gi|240948272|ref|ZP_04752658.1| 30S ribosomal protein S18 [Actinobacillus minor NM305]
 gi|257465547|ref|ZP_05629918.1| 30S ribosomal protein S18 [Actinobacillus minor 202]
 gi|240297311|gb|EER47852.1| 30S ribosomal protein S18 [Actinobacillus minor NM305]
 gi|257451207|gb|EEV25250.1| 30S ribosomal protein S18 [Actinobacillus minor 202]
          Length = 75

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI  L  ++S+ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAENVVEIDYKDIATLKNYISENGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|254780330|ref|YP_003064743.1| 30S ribosomal protein S18 [Candidatus Liberibacter asiaticus str.
          psy62]
 gi|254040007|gb|ACT56803.1| 30S ribosomal protein S18 [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 83

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 83/83 (100%), Positives = 83/83 (100%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK
Sbjct: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60

Query: 61 KQRELAKAIKRARYLGLIAYVNL 83
          KQRELAKAIKRARYLGLIAYVNL
Sbjct: 61 KQRELAKAIKRARYLGLIAYVNL 83


>gi|56708146|ref|YP_170042.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|110670617|ref|YP_667174.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|118497542|ref|YP_898592.1| 30S ribosomal protein S18 [Francisella tularensis subsp. novicida
          U112]
 gi|134301959|ref|YP_001121928.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis WY96-3418]
 gi|187931624|ref|YP_001891608.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          mediasiatica FSC147]
 gi|224457242|ref|ZP_03665715.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|254370630|ref|ZP_04986635.1| hypothetical protein [Francisella tularensis subsp. tularensis
          FSC033]
 gi|254372903|ref|ZP_04988392.1| 30S ribosomal protein S18 [Francisella tularensis subsp. novicida
          GA99-3549]
 gi|254374357|ref|ZP_04989839.1| hypothetical protein FTDG_00524 [Francisella novicida GA99-3548]
 gi|254874949|ref|ZP_05247659.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|81677050|sp|Q5NG00|RS18_FRATT RecName: Full=30S ribosomal protein S18
 gi|122970929|sp|Q14HF2|RS18_FRAT1 RecName: Full=30S ribosomal protein S18
 gi|205558096|sp|A0Q6H3|RS18_FRATN RecName: Full=30S ribosomal protein S18
 gi|205558144|sp|A4IY06|RS18_FRATW RecName: Full=30S ribosomal protein S18
 gi|56604638|emb|CAG45694.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|110320950|emb|CAL09077.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|118423448|gb|ABK89838.1| 30S ribosomal protein S18 [Francisella novicida U112]
 gi|134049736|gb|ABO46807.1| ribosomal protein S18 [Francisella tularensis subsp. tularensis
          WY96-3418]
 gi|151568873|gb|EDN34527.1| hypothetical protein FTBG_00419 [Francisella tularensis subsp.
          tularensis FSC033]
 gi|151570630|gb|EDN36284.1| 30S ribosomal protein S18 [Francisella novicida GA99-3549]
 gi|151572077|gb|EDN37731.1| hypothetical protein FTDG_00524 [Francisella novicida GA99-3548]
 gi|187712533|gb|ACD30830.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          mediasiatica FSC147]
 gi|254840948|gb|EET19384.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|282159352|gb|ADA78743.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          tularensis NE061598]
 gi|332184104|gb|AEE26358.1| SSU ribosomal protein S18p [Francisella cf. novicida 3523]
 gi|332678241|gb|AEE87370.1| SSU ribosomal protein S18p [Francisella cf. novicida Fx1]
          Length = 72

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 46/67 (68%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK C  + +G   IDYKD+  L  ++++ GKIVPSR++  S K QR+LA AIKRAR+L
Sbjct: 2  SRRKVCRFTVEGVKEIDYKDVNKLKAYITETGKIVPSRVTGTSAKYQRQLATAIKRARFL 61

Query: 76 GLIAYVN 82
           L+ Y +
Sbjct: 62 ALLPYCD 68


>gi|329297941|ref|ZP_08255277.1| 30S ribosomal protein S18 [Plautia stali symbiont]
          Length = 75

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTCAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|15603043|ref|NP_246115.1| 30S ribosomal protein S18 [Pasteurella multocida subsp. multocida
          str. Pm70]
 gi|260912756|ref|ZP_05919242.1| 50S ribosomal protein L21 [Pasteurella dagmatis ATCC 43325]
 gi|13431845|sp|P57916|RS18_PASMU RecName: Full=30S ribosomal protein S18
 gi|12721529|gb|AAK03262.1| RpS18 [Pasteurella multocida subsp. multocida str. Pm70]
 gi|260633134|gb|EEX51299.1| 50S ribosomal protein L21 [Pasteurella dagmatis ATCC 43325]
          Length = 75

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKD+  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAENVVEIDYKDVATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|114564510|ref|YP_752024.1| 30S ribosomal protein S18 [Shewanella frigidimarina NCIMB 400]
 gi|122298732|sp|Q07XS9|RS18_SHEFN RecName: Full=30S ribosomal protein S18
 gi|114335803|gb|ABI73185.1| SSU ribosomal protein S18P [Shewanella frigidimarina NCIMB 400]
          Length = 75

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 48/71 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+  S + QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTSEGVVEIDYKDIVTLKNYITESGKIVPSRITGTSARYQRQLARAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLSLLPYTDL 73


>gi|167627911|ref|YP_001678411.1| 30S ribosomal protein S18 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|241668463|ref|ZP_04756041.1| 30S ribosomal protein S18 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|254876997|ref|ZP_05249707.1| 30S ribosomal protein S18 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|205557713|sp|B0U080|RS18_FRAP2 RecName: Full=30S ribosomal protein S18
 gi|167597912|gb|ABZ87910.1| 30S ribosomal protein S18 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|254843018|gb|EET21432.1| 30S ribosomal protein S18 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
          Length = 72

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 45/67 (67%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK C  +  G   IDYKD+  L  ++++ GKIVPSR++  S K QR+LA AIKRAR+L
Sbjct: 2  SRRKVCRFTVDGVKEIDYKDVNKLKAYITETGKIVPSRVTGTSAKYQRQLATAIKRARFL 61

Query: 76 GLIAYVN 82
           L+ Y +
Sbjct: 62 ALLPYCD 68


>gi|82703070|ref|YP_412636.1| 30S ribosomal protein S18 [Nitrosospira multiformis ATCC 25196]
 gi|123768178|sp|Q2Y7M7|RS18_NITMU RecName: Full=30S ribosomal protein S18
 gi|82411135|gb|ABB75244.1| SSU ribosomal protein S18P [Nitrosospira multiformis ATCC 25196]
          Length = 94

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 49/72 (68%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  RRK C  + +G   +DYKDI LL  F+++ GKI+P+RI+    + QR+L+ A++R
Sbjct: 22 RPLFKRRKFCRFTAEGIKTVDYKDIELLKDFINENGKIIPARITGTKSRYQRQLSTAVER 81

Query: 72 ARYLGLIAYVNL 83
          AR+L L+ Y +L
Sbjct: 82 ARFLALLPYTDL 93


>gi|254481140|ref|ZP_05094386.1| ribosomal protein S18 [marine gamma proteobacterium HTCC2148]
 gi|214038935|gb|EEB79596.1| ribosomal protein S18 [marine gamma proteobacterium HTCC2148]
          Length = 75

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+  L  ++S+ GKIVPSRI+    K QR+LA A+KRA
Sbjct: 3  RFFRRRKFCKFTAEGVKEIDYKDLETLKAYVSETGKIVPSRITGTKAKYQRQLATAVKRA 62

Query: 73 RYLGLIAYVN 82
          R+L L+ Y +
Sbjct: 63 RFLALLPYTD 72


>gi|119897011|ref|YP_932224.1| 30S ribosomal protein S18 [Azoarcus sp. BH72]
 gi|237654323|ref|YP_002890637.1| 30S ribosomal protein S18 [Thauera sp. MZ1T]
 gi|119669424|emb|CAL93337.1| 30S ribosomal protein S18 [Azoarcus sp. BH72]
 gi|237625570|gb|ACR02260.1| ribosomal protein S18 [Thauera sp. MZ1T]
          Length = 91

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 46/72 (63%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  RRK C  + +    +DYKD+ +L  F+++  KI+P+RI+      QR+L+ A+KR
Sbjct: 18 RGLFKRRKFCRFTAEKIEEVDYKDVDILKDFITENAKIMPARITGTKAGYQRQLSVAVKR 77

Query: 72 ARYLGLIAYVNL 83
          AR+L L+ Y +L
Sbjct: 78 ARFLALMPYTDL 89


>gi|89100929|ref|ZP_01173776.1| ribosomal protein S18 [Bacillus sp. NRRL B-14911]
 gi|89084338|gb|EAR63492.1| ribosomal protein S18 [Bacillus sp. NRRL B-14911]
          Length = 81

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 43/63 (68%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIKRAR + L+ 
Sbjct: 17 VCYFTANGITHIDYKDVDLLKKFISERGKILPRRVTGTNAKYQRKLTVAIKRARIMALLP 76

Query: 80 YVN 82
          YV+
Sbjct: 77 YVS 79


>gi|162149102|ref|YP_001603563.1| 30S ribosomal protein S18 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|209545155|ref|YP_002277384.1| 30S ribosomal protein S18 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|254812942|sp|A9H1M6|RS18_GLUDA RecName: Full=30S ribosomal protein S18
 gi|161787679|emb|CAP57275.1| putative 30S ribosomal protein S18 [Gluconacetobacter
          diazotrophicus PAl 5]
 gi|209532832|gb|ACI52769.1| ribosomal protein S18 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 91

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 19 RRPFYRRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIK 78

Query: 71 RARYLGLIAYV 81
          RAR++ L+ Y+
Sbjct: 79 RARFMALLPYI 89


>gi|296116662|ref|ZP_06835272.1| 30S ribosomal protein S18 [Gluconacetobacter hansenii ATCC 23769]
 gi|295976874|gb|EFG83642.1| 30S ribosomal protein S18 [Gluconacetobacter hansenii ATCC 23769]
          Length = 91

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 51/71 (71%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 19 RRPFYRRRKSCPFSGPNAPQIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIK 78

Query: 71 RARYLGLIAYV 81
          RAR+L L+ Y+
Sbjct: 79 RARFLALLPYI 89


>gi|115314809|ref|YP_763532.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica OSU18]
 gi|122325175|sp|Q0BLY9|RS18_FRATO RecName: Full=30S ribosomal protein S18
 gi|115129708|gb|ABI82895.1| ribosomal protein S18 [Francisella tularensis subsp. holarctica
          OSU18]
          Length = 72

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 46/67 (68%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK C  + +G   IDYKD+  L  ++++ GKIVPSR++  S K QR+LA AIKRAR+L
Sbjct: 2  SRRKVCRFTVEGVKEIDYKDVNKLKAYINETGKIVPSRVTGTSAKYQRQLATAIKRARFL 61

Query: 76 GLIAYVN 82
           L+ Y +
Sbjct: 62 ALLPYCD 68


>gi|289551779|ref|YP_003472683.1| SSU ribosomal protein S18p [Staphylococcus lugdunensis HKU09-01]
 gi|315660049|ref|ZP_07912907.1| 30S ribosomal protein S18 [Staphylococcus lugdunensis M23590]
 gi|289181310|gb|ADC88555.1| SSU ribosomal protein S18p [Staphylococcus lugdunensis HKU09-01]
 gi|315494950|gb|EFU83287.1| 30S ribosomal protein S18 [Staphylococcus lugdunensis M23590]
          Length = 80

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|241888999|ref|ZP_04776303.1| ribosomal protein S18 [Gemella haemolysans ATCC 10379]
 gi|241864248|gb|EER68626.1| ribosomal protein S18 [Gemella haemolysans ATCC 10379]
          Length = 82

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 15 KKVCYFTKNNVEFIDYKDVELLKKFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 74

Query: 78 IAYV 81
          + YV
Sbjct: 75 LPYV 78


>gi|30265490|ref|NP_847867.1| 30S ribosomal protein S18 [Bacillus anthracis str. Ames]
 gi|47531058|ref|YP_022407.1| 30S ribosomal protein S18 [Bacillus anthracis str. 'Ames
          Ancestor']
 gi|49188309|ref|YP_031562.1| 30S ribosomal protein S18 [Bacillus anthracis str. Sterne]
 gi|49481204|ref|YP_039462.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          konkukian str. 97-27]
 gi|52145280|ref|YP_086737.1| 30S ribosomal protein S18 [Bacillus cereus E33L]
 gi|65317453|ref|ZP_00390412.1| COG0238: Ribosomal protein S18 [Bacillus anthracis str. A2012]
 gi|118480500|ref|YP_897651.1| 30S ribosomal protein S18 [Bacillus thuringiensis str. Al Hakam]
 gi|163943152|ref|YP_001648036.1| 30S ribosomal protein S18 [Bacillus weihenstephanensis KBAB4]
 gi|165873035|ref|ZP_02217656.1| ribosomal protein S18 [Bacillus anthracis str. A0488]
 gi|167635075|ref|ZP_02393392.1| ribosomal protein S18 [Bacillus anthracis str. A0442]
 gi|167641758|ref|ZP_02400001.1| ribosomal protein S18 [Bacillus anthracis str. A0193]
 gi|170689458|ref|ZP_02880648.1| ribosomal protein S18 [Bacillus anthracis str. A0465]
 gi|170707550|ref|ZP_02898003.1| ribosomal protein S18 [Bacillus anthracis str. A0389]
 gi|177655284|ref|ZP_02936838.1| ribosomal protein S18 [Bacillus anthracis str. A0174]
 gi|190569300|ref|ZP_03022194.1| ribosomal protein S18 [Bacillus anthracis Tsiankovskii-I]
 gi|196036074|ref|ZP_03103474.1| ribosomal protein S18 [Bacillus cereus W]
 gi|196041980|ref|ZP_03109267.1| ribosomal protein S18 [Bacillus cereus NVH0597-99]
 gi|196045471|ref|ZP_03112702.1| ribosomal protein S18 [Bacillus cereus 03BB108]
 gi|218906664|ref|YP_002454498.1| ribosomal protein S18 [Bacillus cereus AH820]
 gi|225867453|ref|YP_002752831.1| 30S ribosomal protein S18 [Bacillus cereus 03BB102]
 gi|227818241|ref|YP_002818250.1| 30S ribosomal protein S18 [Bacillus anthracis str. CDC 684]
 gi|228918084|ref|ZP_04081612.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
 gi|228930478|ref|ZP_04093478.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          pondicheriensis BGSC 4BA1]
 gi|228936752|ref|ZP_04099543.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          andalousiensis BGSC 4AW1]
 gi|228949194|ref|ZP_04111462.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|228994191|ref|ZP_04154091.1| 30S ribosomal protein S18 [Bacillus pseudomycoides DSM 12442]
 gi|229000261|ref|ZP_04159830.1| 30S ribosomal protein S18 [Bacillus mycoides Rock3-17]
 gi|229007785|ref|ZP_04165371.1| 30S ribosomal protein S18 [Bacillus mycoides Rock1-4]
 gi|229035130|ref|ZP_04189076.1| 30S ribosomal protein S18 [Bacillus cereus AH1271]
 gi|229087959|ref|ZP_04220067.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-44]
 gi|229094583|ref|ZP_04225650.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-42]
 gi|229099899|ref|ZP_04230822.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-29]
 gi|229118962|ref|ZP_04248307.1| 30S ribosomal protein S18 [Bacillus cereus Rock1-3]
 gi|229124975|ref|ZP_04254149.1| 30S ribosomal protein S18 [Bacillus cereus 95/8201]
 gi|229170175|ref|ZP_04297861.1| 30S ribosomal protein S18 [Bacillus cereus AH621]
 gi|229187701|ref|ZP_04314837.1| 30S ribosomal protein S18 [Bacillus cereus BGSC 6E1]
 gi|229604103|ref|YP_002869681.1| 30S ribosomal protein S18 [Bacillus anthracis str. A0248]
 gi|254687087|ref|ZP_05150945.1| 30S ribosomal protein S18 [Bacillus anthracis str. CNEVA-9066]
 gi|254724130|ref|ZP_05185915.1| 30S ribosomal protein S18 [Bacillus anthracis str. A1055]
 gi|254735147|ref|ZP_05192857.1| 30S ribosomal protein S18 [Bacillus anthracis str. Western North
          America USA6153]
 gi|254742144|ref|ZP_05199831.1| 30S ribosomal protein S18 [Bacillus anthracis str. Kruger B]
 gi|254755946|ref|ZP_05207978.1| 30S ribosomal protein S18 [Bacillus anthracis str. Vollum]
 gi|254761374|ref|ZP_05213396.1| 30S ribosomal protein S18 [Bacillus anthracis str. Australia 94]
 gi|300118826|ref|ZP_07056546.1| 30S ribosomal protein S18 [Bacillus cereus SJ1]
 gi|301056946|ref|YP_003795157.1| 30S ribosomal protein S18 [Bacillus anthracis CI]
 gi|59798636|sp|Q630D0|RS18_BACCZ RecName: Full=30S ribosomal protein S18
 gi|59798712|sp|Q6HAG4|RS18_BACHK RecName: Full=30S ribosomal protein S18
 gi|59798878|sp|Q81JI4|RS18_BACAN RecName: Full=30S ribosomal protein S18
 gi|166220922|sp|A0RLQ1|RS18_BACAH RecName: Full=30S ribosomal protein S18
 gi|226735107|sp|B7JIJ9|RS18_BACC0 RecName: Full=30S ribosomal protein S18
 gi|229564239|sp|A9VTK8|RS18_BACWK RecName: Full=30S ribosomal protein S18
 gi|254765406|sp|C3P3E3|RS18_BACAA RecName: Full=30S ribosomal protein S18
 gi|254765407|sp|C3LGS9|RS18_BACAC RecName: Full=30S ribosomal protein S18
 gi|254765408|sp|C1ER65|RS18_BACC3 RecName: Full=30S ribosomal protein S18
 gi|30260168|gb|AAP29353.1| 30S ribosomal protein S18 [Bacillus anthracis str. Ames]
 gi|47506206|gb|AAT34882.1| ribosomal protein S18 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49182236|gb|AAT57612.1| ribosomal protein S18 [Bacillus anthracis str. Sterne]
 gi|49332760|gb|AAT63406.1| ribosomal protein S18 (30S ribosomal protein S18) [Bacillus
          thuringiensis serovar konkukian str. 97-27]
 gi|51978749|gb|AAU20299.1| ribosomal protein S18 (30S ribosomal protein S18) [Bacillus
          cereus E33L]
 gi|118419725|gb|ABK88144.1| SSU ribosomal protein S18P [Bacillus thuringiensis str. Al Hakam]
 gi|163865349|gb|ABY46408.1| ribosomal protein S18 [Bacillus weihenstephanensis KBAB4]
 gi|164711247|gb|EDR16803.1| ribosomal protein S18 [Bacillus anthracis str. A0488]
 gi|167510312|gb|EDR85715.1| ribosomal protein S18 [Bacillus anthracis str. A0193]
 gi|167529549|gb|EDR92299.1| ribosomal protein S18 [Bacillus anthracis str. A0442]
 gi|170127546|gb|EDS96420.1| ribosomal protein S18 [Bacillus anthracis str. A0389]
 gi|170666560|gb|EDT17333.1| ribosomal protein S18 [Bacillus anthracis str. A0465]
 gi|172080211|gb|EDT65303.1| ribosomal protein S18 [Bacillus anthracis str. A0174]
 gi|190559607|gb|EDV13598.1| ribosomal protein S18 [Bacillus anthracis Tsiankovskii-I]
 gi|195991241|gb|EDX55209.1| ribosomal protein S18 [Bacillus cereus W]
 gi|196023678|gb|EDX62354.1| ribosomal protein S18 [Bacillus cereus 03BB108]
 gi|196027235|gb|EDX65855.1| ribosomal protein S18 [Bacillus cereus NVH0597-99]
 gi|218539261|gb|ACK91659.1| ribosomal protein S18 [Bacillus cereus AH820]
 gi|225787551|gb|ACO27768.1| 30S ribosomal protein S18 [Bacillus cereus 03BB102]
 gi|227005264|gb|ACP15007.1| 30S ribosomal protein S18 [Bacillus anthracis str. CDC 684]
 gi|228595769|gb|EEK53453.1| 30S ribosomal protein S18 [Bacillus cereus BGSC 6E1]
 gi|228613276|gb|EEK70415.1| 30S ribosomal protein S18 [Bacillus cereus AH621]
 gi|228658476|gb|EEL14142.1| 30S ribosomal protein S18 [Bacillus cereus 95/8201]
 gi|228664487|gb|EEL19983.1| 30S ribosomal protein S18 [Bacillus cereus Rock1-3]
 gi|228683514|gb|EEL37469.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-29]
 gi|228688830|gb|EEL42661.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-42]
 gi|228695344|gb|EEL48221.1| 30S ribosomal protein S18 [Bacillus cereus Rock3-44]
 gi|228728196|gb|EEL79226.1| 30S ribosomal protein S18 [Bacillus cereus AH1271]
 gi|228753462|gb|EEM02914.1| 30S ribosomal protein S18 [Bacillus mycoides Rock1-4]
 gi|228759593|gb|EEM08570.1| 30S ribosomal protein S18 [Bacillus mycoides Rock3-17]
 gi|228765643|gb|EEM14297.1| 30S ribosomal protein S18 [Bacillus pseudomycoides DSM 12442]
 gi|228810477|gb|EEM56830.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|228822961|gb|EEM68802.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          andalousiensis BGSC 4AW1]
 gi|228829197|gb|EEM74834.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          pondicheriensis BGSC 4BA1]
 gi|228841564|gb|EEM86680.1| 30S ribosomal protein S18 [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
 gi|229268511|gb|ACQ50148.1| 30S ribosomal protein S18 [Bacillus anthracis str. A0248]
 gi|298723794|gb|EFI64516.1| 30S ribosomal protein S18 [Bacillus cereus SJ1]
 gi|300379115|gb|ADK08019.1| 30S ribosomal protein S18 [Bacillus cereus biovar anthracis str.
          CI]
          Length = 77

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 48/72 (66%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +   + RRK C  +  G  RIDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AI
Sbjct: 4  RKGGRAKRRKVCFFTSNGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAI 63

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 64 KRARQMALLPYV 75


>gi|205620144|sp|Q3SH33|RS18_THIDA RecName: Full=30S ribosomal protein S18
          Length = 91

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 46/72 (63%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  RRK C  + +    +DYKD+ +L  F+++ G+I+P+RI+      QR+L  AIKR
Sbjct: 19 RGLFKRRKFCRFTAEKVVEVDYKDVDVLKEFIAENGRIIPARITGTKAHYQRQLGTAIKR 78

Query: 72 ARYLGLIAYVNL 83
          AR+L L+ Y +L
Sbjct: 79 ARFLALMPYTDL 90


>gi|224475522|ref|YP_002633128.1| 30S ribosomal protein S18 [Staphylococcus carnosus subsp.
          carnosus TM300]
 gi|254812955|sp|B9DIC0|RS18_STACT RecName: Full=30S ribosomal protein S18
 gi|222420129|emb|CAL26943.1| 30S ribosomal protein S18 [Staphylococcus carnosus subsp.
          carnosus TM300]
          Length = 80

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTDLLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|91775681|ref|YP_545437.1| 30S ribosomal protein S18 [Methylobacillus flagellatus KT]
 gi|123078871|sp|Q1H1P1|RS18_METFK RecName: Full=30S ribosomal protein S18
 gi|91709668|gb|ABE49596.1| SSU ribosomal protein S18P [Methylobacillus flagellatus KT]
          Length = 75

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 50/73 (68%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R++  RR+ C  S +G  ++DYKD+ LL  F+++ GKI+P+RI+    K QR+L  A+
Sbjct: 1  MARDMFKRRRYCRFSAEGIKQVDYKDVDLLKDFINENGKIIPARITGTKAKYQRQLTTAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|27469288|ref|NP_765925.1| 30S ribosomal protein S18 [Staphylococcus epidermidis ATCC 12228]
 gi|57865985|ref|YP_187646.1| 30S ribosomal protein S18 [Staphylococcus epidermidis RP62A]
 gi|223043454|ref|ZP_03613500.1| ribosomal protein S18 [Staphylococcus capitis SK14]
 gi|242372656|ref|ZP_04818230.1| 30S ribosomal protein S18 [Staphylococcus epidermidis M23864:W1]
 gi|282874664|ref|ZP_06283546.1| ribosomal protein S18 [Staphylococcus epidermidis SK135]
 gi|314935023|ref|ZP_07842382.1| ribosomal protein S18 [Staphylococcus caprae C87]
 gi|38258566|sp|Q8CQP6|RS18_STAES RecName: Full=30S ribosomal protein S18
 gi|71153728|sp|Q5HRZ3|RS18_STAEQ RecName: Full=30S ribosomal protein S18
 gi|27316838|gb|AAO06013.1|AE016752_46 30S ribosomal protein S18 [Staphylococcus epidermidis ATCC 12228]
 gi|57636643|gb|AAW53431.1| ribosomal protein S18 [Staphylococcus epidermidis RP62A]
 gi|222443243|gb|EEE49342.1| ribosomal protein S18 [Staphylococcus capitis SK14]
 gi|242349573|gb|EES41174.1| 30S ribosomal protein S18 [Staphylococcus epidermidis M23864:W1]
 gi|281296588|gb|EFA89100.1| ribosomal protein S18 [Staphylococcus epidermidis SK135]
 gi|313652953|gb|EFS16716.1| ribosomal protein S18 [Staphylococcus caprae C87]
 gi|319399801|gb|EFV88049.1| ribosomal protein S18 [Staphylococcus epidermidis FRI909]
 gi|329723856|gb|EGG60383.1| ribosomal protein S18 [Staphylococcus epidermidis VCU144]
 gi|329734384|gb|EGG70698.1| ribosomal protein S18 [Staphylococcus epidermidis VCU028]
 gi|329736079|gb|EGG72352.1| ribosomal protein S18 [Staphylococcus epidermidis VCU045]
          Length = 80

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|77361356|ref|YP_340931.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas haloplanktis
          TAC125]
 gi|315125714|ref|YP_004067717.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas sp. SM9913]
 gi|332535621|ref|ZP_08411387.1| 30S ribosomal protein S18 [Pseudoalteromonas haloplanktis
          ANT/505]
 gi|123588590|sp|Q3II81|RS18_PSEHT RecName: Full=30S ribosomal protein S18
 gi|76876267|emb|CAI87489.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas haloplanktis
          TAC125]
 gi|315014228|gb|ADT67566.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas sp. SM9913]
 gi|332034976|gb|EGI71498.1| 30S ribosomal protein S18 [Pseudoalteromonas haloplanktis
          ANT/505]
          Length = 75

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 47/71 (66%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C    +G  +IDYKD+  L  ++++ GKIVPSRI+  S K QR+LA AIKRA
Sbjct: 3  RYFRRRKFCRFKAEGVQQIDYKDLATLRNYVTESGKIVPSRITGTSAKYQRQLATAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLALLPYTDL 73


>gi|70727625|ref|YP_254541.1| 30S ribosomal protein S18 [Staphylococcus haemolyticus JCSC1435]
 gi|228474191|ref|ZP_04058928.1| ribosomal protein S18 [Staphylococcus hominis SK119]
 gi|314935171|ref|ZP_07842524.1| ribosomal protein S18 [Staphylococcus hominis subsp. hominis C80]
 gi|123762271|sp|Q4L342|RS18_STAHJ RecName: Full=30S ribosomal protein S18
 gi|68448351|dbj|BAE05935.1| 30S ribosomal protein S18 [Staphylococcus haemolyticus JCSC1435]
 gi|228271886|gb|EEK13223.1| ribosomal protein S18 [Staphylococcus hominis SK119]
 gi|313656506|gb|EFS20245.1| ribosomal protein S18 [Staphylococcus hominis subsp. hominis C80]
          Length = 80

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|253999141|ref|YP_003051204.1| 30S ribosomal protein S18 [Methylovorus sp. SIP3-4]
 gi|313201242|ref|YP_004039900.1| 30S ribosomal protein S18 [Methylovorus sp. MP688]
 gi|253985820|gb|ACT50677.1| ribosomal protein S18 [Methylovorus sp. SIP3-4]
 gi|312440558|gb|ADQ84664.1| ribosomal protein S18 [Methylovorus sp. MP688]
          Length = 75

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 49/73 (67%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R++  RR+ C  S +G   +DYKD+ LL  F+++ GKI+P+RI+    + QR+L  A+
Sbjct: 1  MARDMFKRRRYCRFSAEGIKEVDYKDVDLLKDFINENGKIIPARITGTKARYQRQLTTAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|121997453|ref|YP_001002240.1| 30S ribosomal protein S18 [Halorhodospira halophila SL1]
 gi|166220954|sp|A1WUS6|RS18_HALHL RecName: Full=30S ribosomal protein S18
 gi|121588858|gb|ABM61438.1| SSU ribosomal protein S18P [Halorhodospira halophila SL1]
          Length = 74

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+  L  +++  GKIVPSRI+  S + QR+LA+AIKRA
Sbjct: 3  RFFRRRKYCKFTAEGVKEIDYKDLNTLKNYITDTGKIVPSRITGTSARYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|163784039|ref|ZP_02178996.1| ribosomal protein S18 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880696|gb|EDP74243.1| ribosomal protein S18 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 79

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/78 (48%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  +     R+K C    +G    DYK+I +L  F+S+RGKIVPSRIS    K QR
Sbjct: 1  MANNPAQKPFFQKRKKYCKFCAEGIEP-DYKNIDILKEFISERGKIVPSRISGTCGKHQR 59

Query: 64 ELAKAIKRARYLGLIAYV 81
          +LA AIKRAR L L+ YV
Sbjct: 60 KLAVAIKRARQLALLPYV 77


>gi|21242371|ref|NP_641953.1| 30S ribosomal protein S18 [Xanthomonas axonopodis pv. citri str.
          306]
 gi|78047218|ref|YP_363393.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. vesicatoria
          str. 85-10]
 gi|190575040|ref|YP_001972885.1| 30S ribosomal protein S18 [Stenotrophomonas maltophilia K279a]
 gi|254524088|ref|ZP_05136143.1| ribosomal protein S18 [Stenotrophomonas sp. SKA14]
 gi|285018509|ref|YP_003376220.1| 30s ribosomal subunit protein s18 [Xanthomonas albilineans GPE
          PC73]
 gi|325928161|ref|ZP_08189370.1| SSU ribosomal protein S18P [Xanthomonas perforans 91-118]
 gi|23822134|sp|Q8PM13|RS18_XANAC RecName: Full=30S ribosomal protein S18
 gi|123771403|sp|Q3BV20|RS18_XANC5 RecName: Full=30S ribosomal protein S18
 gi|229560069|sp|B2FKJ8|RS18_STRMK RecName: Full=30S ribosomal protein S18
 gi|21107808|gb|AAM36489.1| 30S ribosomal protein S18 [Xanthomonas axonopodis pv. citri str.
          306]
 gi|78035648|emb|CAJ23339.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. vesicatoria
          str. 85-10]
 gi|190012962|emb|CAQ46594.1| 30s ribosomal subunit protein S18 [Stenotrophomonas maltophilia
          K279a]
 gi|219721679|gb|EED40204.1| ribosomal protein S18 [Stenotrophomonas sp. SKA14]
 gi|283473727|emb|CBA16230.1| probable 30s ribosomal subunit protein s18 [Xanthomonas
          albilineans]
 gi|325541457|gb|EGD12990.1| SSU ribosomal protein S18P [Xanthomonas perforans 91-118]
          Length = 76

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 46/71 (64%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               RRK C  + +G   IDYKD+  L ++L++ GKIVPSR++    K QR+LA A+KR
Sbjct: 2  SKFFRRRKFCKFTAEGVKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSKYQRQLATAVKR 61

Query: 72 ARYLGLIAYVN 82
          AR+L LI Y +
Sbjct: 62 ARFLALIPYTD 72


>gi|329769493|ref|ZP_08260903.1| 30S ribosomal protein S18 [Gemella sanguinis M325]
 gi|328838708|gb|EGF88306.1| 30S ribosomal protein S18 [Gemella sanguinis M325]
          Length = 82

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 15 KKVCYFTKNNIETIDYKDVELLKKFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 74

Query: 78 IAYV 81
          + YV
Sbjct: 75 LPYV 78


>gi|319891325|ref|YP_004148200.1| SSU ribosomal protein S18p [Staphylococcus pseudintermedius
          HKU10-03]
 gi|317161021|gb|ADV04564.1| SSU ribosomal protein S18p [Staphylococcus pseudintermedius
          HKU10-03]
 gi|323465518|gb|ADX77671.1| ribosomal protein S18 [Staphylococcus pseudintermedius ED99]
          Length = 80

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 72

Query: 78 IAYV 81
          + +V
Sbjct: 73 LPFV 76


>gi|302879168|ref|YP_003847732.1| 30S ribosomal protein S18 [Gallionella capsiferriformans ES-2]
 gi|302581957|gb|ADL55968.1| ribosomal protein S18 [Gallionella capsiferriformans ES-2]
          Length = 91

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 50/82 (60%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
           +       R N+  RRK C  + +    +DYKD+ +L  F+S+ GK++P+RI+    + 
Sbjct: 9  TDDKKKRFSRNNLFKRRKFCRFTVEKIAEVDYKDVNILKEFISENGKLIPARITGTKTRY 68

Query: 62 QRELAKAIKRARYLGLIAYVNL 83
          QR+L+ A+KRAR+L L+ Y +L
Sbjct: 69 QRQLSTAVKRARFLALLPYTDL 90


>gi|16272489|ref|NP_438703.1| 30S ribosomal protein S18 [Haemophilus influenzae Rd KW20]
 gi|32033888|ref|ZP_00134159.1| COG0238: Ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|33152179|ref|NP_873532.1| 30S ribosomal protein S18 [Haemophilus ducreyi 35000HP]
 gi|68249142|ref|YP_248254.1| 30S ribosomal protein S18 [Haemophilus influenzae 86-028NP]
 gi|145628926|ref|ZP_01784726.1| 30S ribosomal protein S18 [Haemophilus influenzae 22.1-21]
 gi|145630274|ref|ZP_01786055.1| 30S ribosomal protein S18 [Haemophilus influenzae R3021]
 gi|145633503|ref|ZP_01789232.1| 30S ribosomal protein S18 [Haemophilus influenzae 3655]
 gi|145635374|ref|ZP_01791076.1| 30S ribosomal protein S18 [Haemophilus influenzae PittAA]
 gi|145637414|ref|ZP_01793073.1| 30S ribosomal protein S18 [Haemophilus influenzae PittHH]
 gi|145638545|ref|ZP_01794154.1| 30S ribosomal protein S18 [Haemophilus influenzae PittII]
 gi|145640518|ref|ZP_01796102.1| 30S ribosomal protein S18 [Haemophilus influenzae R3021]
 gi|148825181|ref|YP_001289934.1| 30S ribosomal protein S18 [Haemophilus influenzae PittEE]
 gi|148827736|ref|YP_001292489.1| 30S ribosomal protein S18 [Haemophilus influenzae PittGG]
 gi|165976597|ref|YP_001652190.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|167855349|ref|ZP_02478116.1| 30S ribosomal protein S18 [Haemophilus parasuis 29755]
 gi|190150497|ref|YP_001969022.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|219871260|ref|YP_002475635.1| 30S ribosomal protein S18 [Haemophilus parasuis SH0165]
 gi|229844296|ref|ZP_04464436.1| 30S ribosomal protein S18 [Haemophilus influenzae 6P18H1]
 gi|229846628|ref|ZP_04466736.1| 30S ribosomal protein S18 [Haemophilus influenzae 7P49H1]
 gi|254361769|ref|ZP_04977904.1| ribosomal protein S18 [Mannheimia haemolytica PHL213]
 gi|260580992|ref|ZP_05848815.1| ribosomal protein S18 [Haemophilus influenzae RdAW]
 gi|260582751|ref|ZP_05850538.1| ribosomal protein S18 [Haemophilus influenzae NT127]
 gi|261494029|ref|ZP_05990532.1| 30S ribosomal protein S18 [Mannheimia haemolytica serotype A2
          str. BOVINE]
 gi|261496211|ref|ZP_05992617.1| 30S ribosomal protein S18 [Mannheimia haemolytica serotype A2
          str. OVINE]
 gi|303250080|ref|ZP_07336282.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|303253253|ref|ZP_07339402.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|307246085|ref|ZP_07528167.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|307250425|ref|ZP_07532372.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 4 str. M62]
 gi|307252810|ref|ZP_07534700.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|307257225|ref|ZP_07538996.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 10 str. D13039]
 gi|307259503|ref|ZP_07541228.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 11 str. 56153]
 gi|319775534|ref|YP_004138022.1| 30S ribosomal protein S18 [Haemophilus influenzae F3047]
 gi|319897938|ref|YP_004136135.1| 30S ribosomal protein s18 [Haemophilus influenzae F3031]
 gi|322515404|ref|ZP_08068396.1| 50S ribosomal protein L21 [Actinobacillus ureae ATCC 25976]
 gi|329122423|ref|ZP_08251010.1| 50S ribosomal protein L21 [Haemophilus aegyptius ATCC 11116]
 gi|54039411|sp|P66458|RS18_HAEDU RecName: Full=30S ribosomal protein S18
 gi|54042146|sp|P66457|RS18_HAEIN RecName: Full=30S ribosomal protein S18
 gi|81336451|sp|Q4QN03|RS18_HAEI8 RecName: Full=30S ribosomal protein S18
 gi|166220952|sp|A5U9V0|RS18_HAEIE RecName: Full=30S ribosomal protein S18
 gi|166220953|sp|A5UH50|RS18_HAEIG RecName: Full=30S ribosomal protein S18
 gi|229470504|sp|B3GY57|RS18_ACTP7 RecName: Full=30S ribosomal protein S18
 gi|229470509|sp|B0BQB1|RS18_ACTPJ RecName: Full=30S ribosomal protein S18
 gi|254812943|sp|B8F5T5|RS18_HAEPS RecName: Full=30S ribosomal protein S18
 gi|1573530|gb|AAC22203.1| ribosomal protein S18 (rpS18) [Haemophilus influenzae Rd KW20]
 gi|33148401|gb|AAP95921.1| 30S ribosomal protein S18 [Haemophilus ducreyi 35000HP]
 gi|68057341|gb|AAX87594.1| 30S ribosomal protein S18 [Haemophilus influenzae 86-028NP]
 gi|144979396|gb|EDJ89082.1| 30S ribosomal protein S18 [Haemophilus influenzae 22.1-21]
 gi|144984009|gb|EDJ91446.1| 30S ribosomal protein S18 [Haemophilus influenzae R3021]
 gi|144985872|gb|EDJ92480.1| 30S ribosomal protein S18 [Haemophilus influenzae 3655]
 gi|145267380|gb|EDK07382.1| 30S ribosomal protein S18 [Haemophilus influenzae PittAA]
 gi|145269360|gb|EDK09304.1| 30S ribosomal protein S18 [Haemophilus influenzae PittHH]
 gi|145272140|gb|EDK12048.1| 30S ribosomal protein S18 [Haemophilus influenzae PittII]
 gi|145275104|gb|EDK14966.1| 30S ribosomal protein S18 [Haemophilus influenzae 22.4-21]
 gi|148715341|gb|ABQ97551.1| 30S ribosomal protein S18 [Haemophilus influenzae PittEE]
 gi|148718978|gb|ABR00106.1| 30S ribosomal protein S18 [Haemophilus influenzae PittGG]
 gi|153093304|gb|EDN74300.1| ribosomal protein S18 [Mannheimia haemolytica PHL213]
 gi|165876698|gb|ABY69746.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|167853497|gb|EDS24744.1| 30S ribosomal protein S18 [Haemophilus parasuis 29755]
 gi|189915628|gb|ACE61880.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|219691464|gb|ACL32687.1| 30S ribosomal protein S18 [Haemophilus parasuis SH0165]
 gi|229810721|gb|EEP46439.1| 30S ribosomal protein S18 [Haemophilus influenzae 7P49H1]
 gi|229812545|gb|EEP48234.1| 30S ribosomal protein S18 [Haemophilus influenzae 6P18H1]
 gi|260092351|gb|EEW76291.1| ribosomal protein S18 [Haemophilus influenzae RdAW]
 gi|260094201|gb|EEW78102.1| ribosomal protein S18 [Haemophilus influenzae NT127]
 gi|261308163|gb|EEY09460.1| 30S ribosomal protein S18 [Mannheimia haemolytica serotype A2
          str. OVINE]
 gi|261310195|gb|EEY11395.1| 30S ribosomal protein S18 [Mannheimia haemolytica serotype A2
          str. BOVINE]
 gi|301169260|emb|CBW28857.1| 30S ribosomal subunit protein S18 [Haemophilus influenzae 10810]
 gi|302647935|gb|EFL78142.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|302651143|gb|EFL81297.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306853020|gb|EFM85243.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|306857554|gb|EFM89663.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 4 str. M62]
 gi|306859709|gb|EFM91732.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306864267|gb|EFM96179.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 10 str. D13039]
 gi|306866439|gb|EFM98302.1| 30S ribosomal protein S18 [Actinobacillus pleuropneumoniae
          serovar 11 str. 56153]
 gi|309750049|gb|ADO80033.1| 30S ribosomal subunit protein S18 [Haemophilus influenzae R2866]
 gi|309972304|gb|ADO95505.1| 30S ribosomal subunit protein S18 [Haemophilus influenzae R2846]
 gi|317433444|emb|CBY81827.1| 30S ribosomal protein S18 [Haemophilus influenzae F3031]
 gi|317450125|emb|CBY86339.1| 30S ribosomal protein S18 [Haemophilus influenzae F3047]
 gi|322118559|gb|EFX90791.1| 50S ribosomal protein L21 [Actinobacillus ureae ATCC 25976]
 gi|327473705|gb|EGF19124.1| 50S ribosomal protein L21 [Haemophilus aegyptius ATCC 11116]
          Length = 75

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI  L  ++S+ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAENVVEIDYKDIATLKNYISESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|319943303|ref|ZP_08017586.1| 50S ribosomal protein L21 [Lautropia mirabilis ATCC 51599]
 gi|319743845|gb|EFV96249.1| 50S ribosomal protein L21 [Lautropia mirabilis ATCC 51599]
          Length = 91

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 47/80 (58%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R+K C  + +    IDYKD+  L  F++++GKI+P+R++      Q
Sbjct: 10 DRKPKRPAQSALFKRKKFCRFTAEKVEWIDYKDVDTLKDFVTEQGKIIPARLTGTRAHYQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AI+RAR+L L+ Y +
Sbjct: 70 RQLGVAIRRARFLALMPYTD 89


>gi|117618475|ref|YP_855253.1| 30S ribosomal protein S18 [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|330831137|ref|YP_004394089.1| 30S ribosomal protein S18 [Aeromonas veronii B565]
 gi|166220920|sp|A0KG68|RS18_AERHH RecName: Full=30S ribosomal protein S18
 gi|117559882|gb|ABK36830.1| ribosomal protein S18 [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|328806273|gb|AEB51472.1| 30S ribosomal protein S18 [Aeromonas veronii B565]
          Length = 76

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 46/71 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAENVTEIDYKDIVTLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLALLPYTDL 73


>gi|52424526|ref|YP_087663.1| 30S ribosomal protein S18 [Mannheimia succiniciproducens MBEL55E]
 gi|113461579|ref|YP_719648.1| 30S ribosomal protein S18 [Haemophilus somnus 129PT]
 gi|152978437|ref|YP_001344066.1| 30S ribosomal protein S18 [Actinobacillus succinogenes 130Z]
 gi|170718759|ref|YP_001783944.1| 30S ribosomal protein S18 [Haemophilus somnus 2336]
 gi|332289560|ref|YP_004420412.1| 30S ribosomal protein S18 [Gallibacterium anatis UMN179]
 gi|59798655|sp|Q65VD2|RS18_MANSM RecName: Full=30S ribosomal protein S18
 gi|123132188|sp|Q0I4E7|RS18_HAES1 RecName: Full=30S ribosomal protein S18
 gi|171704224|sp|A6VMD4|RS18_ACTSZ RecName: Full=30S ribosomal protein S18
 gi|189029679|sp|B0US45|RS18_HAES2 RecName: Full=30S ribosomal protein S18
 gi|52306578|gb|AAU37078.1| RpsR protein [Mannheimia succiniciproducens MBEL55E]
 gi|112823622|gb|ABI25711.1| SSU ribosomal protein S18P [Haemophilus somnus 129PT]
 gi|150840160|gb|ABR74131.1| ribosomal protein S18 [Actinobacillus succinogenes 130Z]
 gi|168826888|gb|ACA32259.1| ribosomal protein S18 [Haemophilus somnus 2336]
 gi|330432456|gb|AEC17515.1| 30S ribosomal protein S18 [Gallibacterium anatis UMN179]
          Length = 75

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAENVVEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|317496133|ref|ZP_07954493.1| ribosomal protein S18 [Gemella moribillum M424]
 gi|329768685|ref|ZP_08260169.1| 30S ribosomal protein S18 [Gemella haemolysans M341]
 gi|316913708|gb|EFV35194.1| ribosomal protein S18 [Gemella moribillum M424]
 gi|328836399|gb|EGF86064.1| 30S ribosomal protein S18 [Gemella haemolysans M341]
          Length = 82

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 15 KKVCYFTKNNVEFIDYKDVELLKKFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 74

Query: 78 IAYV 81
          + YV
Sbjct: 75 LPYV 78


>gi|167766039|ref|ZP_02438092.1| hypothetical protein CLOSS21_00532 [Clostridium sp. SS2/1]
 gi|317499404|ref|ZP_07957671.1| ribosomal protein S18 [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167712119|gb|EDS22698.1| hypothetical protein CLOSS21_00532 [Clostridium sp. SS2/1]
 gi|291559997|emb|CBL38797.1| SSU ribosomal protein S18P [butyrate-producing bacterium SSC/2]
 gi|316893276|gb|EFV15491.1| ribosomal protein S18 [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 84

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 46/75 (61%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          +P+ RR    RRK C    +    IDYKD+  L +++S+RGKI+P RI+    K QR + 
Sbjct: 8  SPMRRRGGRRRRKVCAFCTEADAVIDYKDVATLKKYVSERGKILPRRITGTCAKHQRAVT 67

Query: 67 KAIKRARYLGLIAYV 81
           AIKRAR+L L+ Y 
Sbjct: 68 GAIKRARHLALMPYT 82


>gi|302877153|ref|YP_003845786.1| 30S ribosomal protein S18 [Clostridium cellulovorans 743B]
 gi|307687852|ref|ZP_07630298.1| 30S ribosomal protein S18 [Clostridium cellulovorans 743B]
 gi|302580010|gb|ADL54022.1| ribosomal protein S18 [Clostridium cellulovorans 743B]
          Length = 85

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 2/84 (2%)

Query: 1  MAEVAPTPLLR--RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVS 58
          M+E       +  R    R+K C    +    IDYKD+  L +++++RGKI+P RIS   
Sbjct: 1  MSENNKKEFKKNIRGRKSRKKVCAFCSEKVEAIDYKDVNRLRKYVTERGKILPRRISGTC 60

Query: 59 HKKQRELAKAIKRARYLGLIAYVN 82
           K QREL  +IKRAR + L+ +  
Sbjct: 61 AKHQRELTGSIKRARNIALLPFTT 84


>gi|145297777|ref|YP_001140618.1| 30S ribosomal protein S18 [Aeromonas salmonicida subsp.
          salmonicida A449]
 gi|166220921|sp|A4SIZ8|RS18_AERS4 RecName: Full=30S ribosomal protein S18
 gi|142850549|gb|ABO88870.1| ribosomal protein S18 [Aeromonas salmonicida subsp. salmonicida
          A449]
          Length = 76

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 46/71 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAENVTEIDYKDIVTLKNYVTESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLALLPYTDL 73


>gi|330993922|ref|ZP_08317852.1| 30S ribosomal protein S18 [Gluconacetobacter sp. SXCC-1]
 gi|329758868|gb|EGG75382.1| 30S ribosomal protein S18 [Gluconacetobacter sp. SXCC-1]
          Length = 91

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 51/71 (71%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 19 RRPFYRRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIK 78

Query: 71 RARYLGLIAYV 81
          RAR+L L+ Y+
Sbjct: 79 RARFLALLPYI 89


>gi|251800229|ref|YP_003014960.1| ribosomal protein S18 [Paenibacillus sp. JDR-2]
 gi|247547855|gb|ACT04874.1| ribosomal protein S18 [Paenibacillus sp. JDR-2]
          Length = 94

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 43/73 (58%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +   + RRK C  +      IDYKD  LL +F+S+RGKI+P R++  S K QR L  AI
Sbjct: 21 RKGGRNKRRKVCFFTVNKITHIDYKDTDLLKKFISERGKILPRRVTGTSAKYQRLLTVAI 80

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ Y  
Sbjct: 81 KRARTVALLPYTT 93


>gi|297569121|ref|YP_003690465.1| ribosomal protein S18 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925036|gb|ADH85846.1| ribosomal protein S18 [Desulfurivibrio alkaliphilus AHT2]
          Length = 79

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 45/73 (61%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + R+    RRK C      +  IDYKD++ L  FL++RGKI+P RI     K QR+L++A
Sbjct: 2  MKRKKYFGRRKVCRFCSDKSLAIDYKDVKTLRGFLTERGKIIPRRIYGNCAKHQRQLSEA 61

Query: 69 IKRARYLGLIAYV 81
          IKRAR + L+ Y 
Sbjct: 62 IKRARQIALLPYT 74


>gi|297545636|ref|YP_003677938.1| 30S ribosomal protein S18 [Thermoanaerobacter mathranii subsp.
          mathranii str. A3]
 gi|296843411|gb|ADH61927.1| ribosomal protein S18 [Thermoanaerobacter mathranii subsp.
          mathranii str. A3]
          Length = 89

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 39/62 (62%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C        +IDYKD+  L +++++RGKI+P RI+    + QR+L +AIKRAR + L+ 
Sbjct: 26 VCAFCTDNIDKIDYKDVARLRKYITERGKILPRRITGNCARHQRQLTRAIKRARQIALLP 85

Query: 80 YV 81
          Y 
Sbjct: 86 YT 87


>gi|15839149|ref|NP_299837.1| 30S ribosomal protein S18 [Xylella fastidiosa 9a5c]
 gi|11387104|sp|Q9PAF8|RS18_XYLFA RecName: Full=30S ribosomal protein S18
 gi|9107772|gb|AAF85357.1|AE004063_6 30S ribosomal protein S18 [Xylella fastidiosa 9a5c]
          Length = 76

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 45/71 (63%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               RRK C  + +G   IDYKD+  L ++L++ GKIVPSR++    K QR+L  A+KR
Sbjct: 2  SKFFRRRKFCKFTAEGIKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSKYQRQLTTAVKR 61

Query: 72 ARYLGLIAYVN 82
          AR+L LI Y +
Sbjct: 62 ARFLALIPYTD 72


>gi|294501974|ref|YP_003565674.1| 30S ribosomal protein S18 [Bacillus megaterium QM B1551]
 gi|295707325|ref|YP_003600400.1| 30S ribosomal protein S18 [Bacillus megaterium DSM 319]
 gi|294351911|gb|ADE72240.1| 30S ribosomal protein S18 [Bacillus megaterium QM B1551]
 gi|294804984|gb|ADF42050.1| 30S ribosomal protein S18 [Bacillus megaterium DSM 319]
          Length = 79

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 43/63 (68%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +  G   IDYKD+ +L +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ 
Sbjct: 15 VCFFTANGITHIDYKDVDMLKKFVSERGKILPRRVTGTSAKYQRKLTIAIKRARQMALLP 74

Query: 80 YVN 82
          YV+
Sbjct: 75 YVS 77


>gi|289523469|ref|ZP_06440323.1| ribosomal protein S18 [Anaerobaculum hydrogeniformans ATCC
          BAA-1850]
 gi|289503161|gb|EFD24325.1| ribosomal protein S18 [Anaerobaculum hydrogeniformans ATCC
          BAA-1850]
          Length = 76

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 43/70 (61%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          +    R K C         +DYK++  L RFL++RGKI+P R++    K QR+LA+AIKR
Sbjct: 5  KRRKRRPKVCTFCSNKIEYVDYKNVEQLKRFLTERGKILPHRVTGNCAKHQRQLARAIKR 64

Query: 72 ARYLGLIAYV 81
          AR++ L+ + 
Sbjct: 65 ARFMALLPFT 74


>gi|300311392|ref|YP_003775484.1| 30S ribosomal protein S18 [Herbaspirillum seropedicae SmR1]
 gi|300074177|gb|ADJ63576.1| 30S ribosomal subunit S18 protein [Herbaspirillum seropedicae
          SmR1]
          Length = 94

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 48/82 (58%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          +++      +  +  R+K C  +  G  ++DYKD+  L  F+ + GKI+P+R++      
Sbjct: 10 SKLKNKRQQQNPLFKRKKFCRFTAAGVEQVDYKDVDTLKDFVQENGKIMPARLTGTKAHY 69

Query: 62 QRELAKAIKRARYLGLIAYVNL 83
          QR++  AIKRARYL L+ Y +L
Sbjct: 70 QRQVDTAIKRARYLALLPYTDL 91


>gi|205562195|sp|Q0ADI8|RS18_NITEC RecName: Full=30S ribosomal protein S18
          Length = 76

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 48/74 (64%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  R +  R+K C  + +G  +IDYKD+ LL  F+S+ G+I+P+RI+      QR+L  A
Sbjct: 1  MANRPLFKRKKFCRFTAEGIKKIDYKDVDLLKDFISENGRIIPARITGTRSYYQRQLNLA 60

Query: 69 IKRARYLGLIAYVN 82
          I+RAR+L L+ Y +
Sbjct: 61 IERARFLALLPYTD 74


>gi|226308|prf||1506337A ribosomal protein S18
          Length = 77

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ 
Sbjct: 13 VCYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLP 72

Query: 80 YV 81
          YV
Sbjct: 73 YV 74


>gi|114328879|ref|YP_746036.1| 30S ribosomal protein S18 [Granulibacter bethesdensis CGDNIH1]
 gi|122326172|sp|Q0BPY9|RS18_GRABC RecName: Full=30S ribosomal protein S18
 gi|114317053|gb|ABI63113.1| SSU ribosomal protein S18P [Granulibacter bethesdensis CGDNIH1]
          Length = 91

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 51/71 (71%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP SG  AP+IDYKD+RLL+RFLS+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 19 RRPFYRRRKSCPFSGPNAPKIDYKDVRLLSRFLSERGKIVPSRITAVSAKKQRELAQAIK 78

Query: 71 RARYLGLIAYV 81
          RAR+L L+ Y+
Sbjct: 79 RARFLALLPYI 89


>gi|311032234|ref|ZP_07710324.1| 30S ribosomal protein S18 [Bacillus sp. m3-13]
          Length = 79

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 42/63 (66%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +  G   IDYKD  +L +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ 
Sbjct: 15 VCYFTANGITHIDYKDTDVLKKFVSERGKILPRRVTGTSAKYQRKLTIAIKRARQMALLP 74

Query: 80 YVN 82
          YV+
Sbjct: 75 YVS 77


>gi|52082634|ref|YP_081425.1| 30S ribosomal protein S18 [Bacillus licheniformis ATCC 14580]
 gi|52788033|ref|YP_093862.1| 30S ribosomal protein S18 [Bacillus licheniformis ATCC 14580]
 gi|319648500|ref|ZP_08002716.1| 30S ribosomal protein S18 [Bacillus sp. BT1B_CT2]
 gi|81690794|sp|Q65CP5|RS18_BACLD RecName: Full=30S ribosomal protein S18
 gi|52005845|gb|AAU25787.1| ribosomal protein S18 [Bacillus licheniformis ATCC 14580]
 gi|52350535|gb|AAU43169.1| RpsR [Bacillus licheniformis ATCC 14580]
 gi|317389579|gb|EFV70390.1| 30S ribosomal protein S18 [Bacillus sp. BT1B_CT2]
          Length = 79

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 42/62 (67%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +  G   IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ 
Sbjct: 15 VCYFTSNGITHIDYKDVDLLRKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLP 74

Query: 80 YV 81
          YV
Sbjct: 75 YV 76


>gi|119471281|ref|ZP_01613784.1| 30S ribosomal subunit protein S18 [Alteromonadales bacterium
          TW-7]
 gi|119445747|gb|EAW27030.1| 30S ribosomal subunit protein S18 [Alteromonadales bacterium
          TW-7]
          Length = 75

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 47/71 (66%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C    +G  +IDYKD+  L  ++++ GKIVPSRI+  S K QR+LA AIKRA
Sbjct: 3  RYFRRRKFCRFKAEGVQQIDYKDLATLRNYVTESGKIVPSRITGTSAKFQRQLATAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLALLPYTDL 73


>gi|51246448|ref|YP_066332.1| 30S ribosomal protein S18 [Desulfotalea psychrophila LSv54]
 gi|59798684|sp|Q6AK01|RS18_DESPS RecName: Full=30S ribosomal protein S18
 gi|50877485|emb|CAG37325.1| probable 30S ribosomal protein S18 [Desulfotalea psychrophila
          LSv54]
          Length = 81

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 2/77 (2%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +AP P  ++ +  R+K C         IDYKD+++L  F+S+RGKI+P RI       QR
Sbjct: 1  MAPRP--QKKLFTRKKVCRFCADKELVIDYKDVKVLRNFVSERGKIIPRRIVGTCASHQR 58

Query: 64 ELAKAIKRARYLGLIAY 80
          +L +A+KRAR + L+ Y
Sbjct: 59 QLCEAVKRARQIALLPY 75


>gi|194366361|ref|YP_002028971.1| 30S ribosomal protein S18 [Stenotrophomonas maltophilia R551-3]
 gi|229560068|sp|B4SP93|RS18_STRM5 RecName: Full=30S ribosomal protein S18
 gi|194349165|gb|ACF52288.1| ribosomal protein S18 [Stenotrophomonas maltophilia R551-3]
          Length = 76

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 46/71 (64%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               RRK C  + +G   IDYKD+  L ++L++ GKIVPSR++    K QR+LA A+KR
Sbjct: 2  SKFFRRRKFCKFTAEGVKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSKYQRQLATAVKR 61

Query: 72 ARYLGLIAYVN 82
          AR+L LI Y +
Sbjct: 62 ARFLALIPYTD 72


>gi|238897794|ref|YP_002923473.1| 30S ribosomal subunit protein S18 [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
 gi|259494812|sp|C4K432|RS18_HAMD5 RecName: Full=30S ribosomal protein S18
 gi|229465551|gb|ACQ67325.1| 30S ribosomal subunit protein S18 [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
          Length = 85

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 47/70 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G  +IDYKDI +L  ++++ GKIVPSRI+    K QR+LA+AIK A
Sbjct: 3  RYFRRRKFCRFTAEGVKQIDYKDIIMLKNYITESGKIVPSRITGTCSKYQRQLAQAIKVA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|282891669|ref|ZP_06300156.1| hypothetical protein pah_c188o044 [Parachlamydia acanthamoebae
          str. Hall's coccus]
 gi|281498459|gb|EFB40791.1| hypothetical protein pah_c188o044 [Parachlamydia acanthamoebae
          str. Hall's coccus]
          Length = 85

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 51/71 (71%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          R   + +RK+CP +  G   IDYKD+  L++F+++RGKI+P RI+ VS   Q+ LA+AIK
Sbjct: 12 RDQRARKRKTCPFTAAGITEIDYKDVSTLSKFITERGKILPRRITGVSAYHQKRLAEAIK 71

Query: 71 RARYLGLIAYV 81
          RAR++ L+ +V
Sbjct: 72 RARHIALLPFV 82


>gi|89256364|ref|YP_513726.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica LVS]
 gi|167010709|ref|ZP_02275640.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica FSC200]
 gi|169656607|ref|YP_001428514.2| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica FTNF002-00]
 gi|254367700|ref|ZP_04983721.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica 257]
 gi|290954057|ref|ZP_06558678.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|295312550|ref|ZP_06803310.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|122999744|sp|Q2A3H6|RS18_FRATH RecName: Full=30S ribosomal protein S18
 gi|205562308|sp|A7NC55|RS18_FRATF RecName: Full=30S ribosomal protein S18
 gi|89144195|emb|CAJ79464.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica LVS]
 gi|134253511|gb|EBA52605.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica 257]
 gi|164551675|gb|ABU61558.2| ribosomal protein S18 [Francisella tularensis subsp. holarctica
          FTNF002-00]
          Length = 72

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 46/67 (68%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK C  + +G   IDYKD+  L  ++++ GKIVPSR++  S K QR+LA AIKRAR+L
Sbjct: 2  SRRKVCRFTIEGVKEIDYKDVNKLKAYINETGKIVPSRVTGTSAKYQRQLATAIKRARFL 61

Query: 76 GLIAYVN 82
           L+ Y +
Sbjct: 62 ALLPYCD 68


>gi|326529315|dbj|BAK01051.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 81

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 2/81 (2%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA+ +     RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MADAS--SPARRPFHRRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSQK 58

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 59 KQRELAKAIKRARFLGLLPYV 79


>gi|331091911|ref|ZP_08340743.1| hypothetical protein HMPREF9477_01386 [Lachnospiraceae bacterium
          2_1_46FAA]
 gi|330402810|gb|EGG82377.1| hypothetical protein HMPREF9477_01386 [Lachnospiraceae bacterium
          2_1_46FAA]
          Length = 87

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/79 (46%), Positives = 49/79 (62%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
            A +P+ RR    R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K Q
Sbjct: 7  NKADSPMKRRGGRRRKKVCVFCGKENNEIDYKDVAKLRKYISERGKILPRRITGNCAKHQ 66

Query: 63 RELAKAIKRARYLGLIAYV 81
          R L  AIKRAR+L L+ YV
Sbjct: 67 RALTVAIKRARHLALMPYV 85


>gi|74318121|ref|YP_315861.1| 30S ribosomal protein S18 [Thiobacillus denitrificans ATCC 25259]
 gi|74057616|gb|AAZ98056.1| ribosomal protein S18 [Thiobacillus denitrificans ATCC 25259]
          Length = 95

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 46/72 (63%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  RRK C  + +    +DYKD+ +L  F+++ G+I+P+RI+      QR+L  AIKR
Sbjct: 23 RGLFKRRKFCRFTAEKVVEVDYKDVDVLKEFIAENGRIIPARITGTKAHYQRQLGTAIKR 82

Query: 72 ARYLGLIAYVNL 83
          AR+L L+ Y +L
Sbjct: 83 ARFLALMPYTDL 94


>gi|167038652|ref|YP_001666230.1| 30S ribosomal protein S18 [Thermoanaerobacter pseudethanolicus
          ATCC 33223]
 gi|167041002|ref|YP_001663987.1| 30S ribosomal protein S18 [Thermoanaerobacter sp. X514]
 gi|256751478|ref|ZP_05492356.1| ribosomal protein S18 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913787|ref|ZP_07131104.1| ribosomal protein S18 [Thermoanaerobacter sp. X561]
 gi|307265461|ref|ZP_07547017.1| ribosomal protein S18 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307725527|ref|YP_003905278.1| 30S ribosomal protein S18 [Thermoanaerobacter sp. X513]
 gi|320117044|ref|YP_004187203.1| 30S ribosomal protein S18 [Thermoanaerobacter brockii subsp.
          finnii Ako-1]
 gi|326391890|ref|ZP_08213400.1| ribosomal protein S18 [Thermoanaerobacter ethanolicus JW 200]
 gi|229560075|sp|B0K8G2|RS18_THEP3 RecName: Full=30S ribosomal protein S18
 gi|229560076|sp|B0K5L7|RS18_THEPX RecName: Full=30S ribosomal protein S18
 gi|166855242|gb|ABY93651.1| ribosomal protein S18 [Thermoanaerobacter sp. X514]
 gi|166857486|gb|ABY95894.1| ribosomal protein S18 [Thermoanaerobacter pseudethanolicus ATCC
          33223]
 gi|256749697|gb|EEU62723.1| ribosomal protein S18 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300890472|gb|EFK85617.1| ribosomal protein S18 [Thermoanaerobacter sp. X561]
 gi|306919575|gb|EFN49793.1| ribosomal protein S18 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307582588|gb|ADN55987.1| ribosomal protein S18 [Thermoanaerobacter sp. X513]
 gi|319930135|gb|ADV80820.1| ribosomal protein S18 [Thermoanaerobacter brockii subsp. finnii
          Ako-1]
 gi|325992052|gb|EGD50534.1| ribosomal protein S18 [Thermoanaerobacter ethanolicus JW 200]
          Length = 88

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C        +IDYKD+  L +++++RGKI+P RI+    + QR+L KAIKRAR + L+ 
Sbjct: 25 VCAFCTDNIDKIDYKDVARLRKYITERGKILPRRITGNCARHQRQLTKAIKRARQIALLP 84

Query: 80 YV 81
          Y 
Sbjct: 85 YT 86


>gi|117925749|ref|YP_866366.1| 30S ribosomal protein S18P [Magnetococcus sp. MC-1]
 gi|205558242|sp|A0LAG7|RS18_MAGSM RecName: Full=30S ribosomal protein S18
 gi|117609505|gb|ABK44960.1| SSU ribosomal protein S18P [Magnetococcus sp. MC-1]
          Length = 106

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 50/76 (65%)

Query: 6   PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
           P    RR    RRK CP       +IDYKD ++L+R++++RGK+VPSRI+ V    QR+L
Sbjct: 29  PLASARRPFFRRRKVCPFCADKGLKIDYKDPKMLSRYITERGKMVPSRITGVCAPHQRKL 88

Query: 66  AKAIKRARYLGLIAYV 81
           + AIKRAR + L+ ++
Sbjct: 89  SVAIKRARNIALLPFI 104


>gi|289579513|ref|YP_003478140.1| ribosomal protein S18 [Thermoanaerobacter italicus Ab9]
 gi|289529226|gb|ADD03578.1| ribosomal protein S18 [Thermoanaerobacter italicus Ab9]
          Length = 89

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 39/62 (62%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C        +IDYKD+  L +++++RGKI+P RI+    + QR+L +AIKRAR + L+ 
Sbjct: 26 VCAFCTDNIDKIDYKDVARLRKYITERGKILPRRITGNCARHQRQLTRAIKRARQIALLP 85

Query: 80 YV 81
          Y 
Sbjct: 86 YT 87


>gi|319651070|ref|ZP_08005204.1| ribosomal protein S18 [Bacillus sp. 2_A_57_CT2]
 gi|317397240|gb|EFV77944.1| ribosomal protein S18 [Bacillus sp. 2_A_57_CT2]
          Length = 79

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 43/63 (68%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIKRAR + L+ 
Sbjct: 15 VCFFTANGITHIDYKDVDLLKKFISERGKILPRRVTGTNAKYQRKLTIAIKRARQMALLP 74

Query: 80 YVN 82
          YV+
Sbjct: 75 YVS 77


>gi|310830125|ref|YP_003962482.1| hypothetical protein ELI_4585 [Eubacterium limosum KIST612]
 gi|308741859|gb|ADO39519.1| hypothetical protein ELI_4585 [Eubacterium limosum KIST612]
          Length = 75

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 44/73 (60%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + +    RRK C    +    +DYKD+  L +++S+RGKI+P R +    K QR++ +A+
Sbjct: 1  MPKPFKRRRKVCEFCERHETEVDYKDVATLKKYISERGKILPRRATGTCAKHQRKVTEAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ Y +
Sbjct: 61 KRARNIALLPYTS 73


>gi|317502276|ref|ZP_07960447.1| ribosomal protein S18 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|316896321|gb|EFV18421.1| ribosomal protein S18 [Lachnospiraceae bacterium 8_1_57FAA]
          Length = 88

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 44/72 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R     R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AI
Sbjct: 15 RRGPARRRKKVCVFCGKENNEIDYKDVAKLKKYVSERGKILPRRITGNCAKHQRALTVAI 74

Query: 70 KRARYLGLIAYV 81
          KRAR++ L+ YV
Sbjct: 75 KRARHIALMPYV 86


>gi|149926828|ref|ZP_01915087.1| 30S ribosomal protein S18 [Limnobacter sp. MED105]
 gi|149824380|gb|EDM83598.1| 30S ribosomal protein S18 [Limnobacter sp. MED105]
          Length = 89

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 45/80 (56%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +       +  +  R+K C  +     +IDYKDI  L  F+S+ GKI+P+RI+      Q
Sbjct: 8  DRKGRRPQQNPLFKRKKFCRFTVGKVEQIDYKDIDTLKDFISENGKIMPARITGTKANYQ 67

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 68 RQLDTAIKRARFLALLPYTD 87


>gi|225026122|ref|ZP_03715314.1| hypothetical protein EUBHAL_00363 [Eubacterium hallii DSM 3353]
 gi|224956559|gb|EEG37768.1| hypothetical protein EUBHAL_00363 [Eubacterium hallii DSM 3353]
          Length = 86

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/79 (41%), Positives = 45/79 (56%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +    P+ RR    R+K C         IDYKD+  L R++S+RGKI+P RI+    K Q
Sbjct: 6  DRGDAPMRRRGGRRRKKVCIFCADKNAVIDYKDVNKLKRYVSERGKILPRRITGNCAKHQ 65

Query: 63 RELAKAIKRARYLGLIAYV 81
          R L  AIKRAR++ L+ Y 
Sbjct: 66 RALTVAIKRARHVSLMPYT 84


>gi|254369338|ref|ZP_04985350.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica FSC022]
 gi|157122288|gb|EDO66428.1| 30S ribosomal protein S18 [Francisella tularensis subsp.
          holarctica FSC022]
          Length = 72

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 46/67 (68%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK C  + +G   IDYKD+  L  ++++ GKIVPSR++  S K QR+LA AIKRAR+L
Sbjct: 2  SRRKVCRFTVEGVKEIDYKDVNKLKAYITETGKIVPSRVTGTSAKYQRQLATAIKRARFL 61

Query: 76 GLIAYVN 82
           L+ Y +
Sbjct: 62 ALLPYYD 68


>gi|260575000|ref|ZP_05843001.1| ribosomal protein S18 [Rhodobacter sp. SW2]
 gi|259022622|gb|EEW25917.1| ribosomal protein S18 [Rhodobacter sp. SW2]
          Length = 75

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 45/72 (62%), Positives = 54/72 (75%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP IDYKD R L R++S+RGKIVPSRI++VS KKQRELA A
Sbjct: 1  MATKPFFRRRKVCPFSGDNAPAIDYKDTRTLQRYISERGKIVPSRITAVSAKKQRELATA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|166030697|ref|ZP_02233526.1| hypothetical protein DORFOR_00371 [Dorea formicigenerans ATCC
          27755]
 gi|166029489|gb|EDR48246.1| hypothetical protein DORFOR_00371 [Dorea formicigenerans ATCC
          27755]
          Length = 88

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 44/72 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R     R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AI
Sbjct: 15 RRNPGRRRKKVCVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQRALTVAI 74

Query: 70 KRARYLGLIAYV 81
          KRAR++ L+ YV
Sbjct: 75 KRARHVALMPYV 86


>gi|56422015|ref|YP_149333.1| 30S ribosomal protein S18 [Geobacillus kaustophilus HTA426]
 gi|196249872|ref|ZP_03148568.1| ribosomal protein S18 [Geobacillus sp. G11MC16]
 gi|261420889|ref|YP_003254571.1| 30S ribosomal protein S18 [Geobacillus sp. Y412MC61]
 gi|297531674|ref|YP_003672949.1| ribosomal protein S18 [Geobacillus sp. C56-T3]
 gi|319768560|ref|YP_004134061.1| ribosomal protein S18 [Geobacillus sp. Y412MC52]
 gi|585939|sp|P10806|RS18_BACST RecName: Full=30S ribosomal protein S18; AltName: Full=BS19;
          AltName: Full=BS21
 gi|81675665|sp|Q5KU71|RS18_GEOKA RecName: Full=30S ribosomal protein S18
 gi|205562283|sp|A4ITV8|RS18_GEOTN RecName: Full=30S ribosomal protein S18
 gi|56381857|dbj|BAD77765.1| 30S ribosomal protein S18 (BS21) [Geobacillus kaustophilus
          HTA426]
 gi|196210748|gb|EDY05511.1| ribosomal protein S18 [Geobacillus sp. G11MC16]
 gi|261377346|gb|ACX80089.1| ribosomal protein S18 [Geobacillus sp. Y412MC61]
 gi|297254926|gb|ADI28372.1| ribosomal protein S18 [Geobacillus sp. C56-T3]
 gi|317113426|gb|ADU95918.1| ribosomal protein S18 [Geobacillus sp. Y412MC52]
          Length = 78

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ 
Sbjct: 14 VCYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLP 73

Query: 80 YV 81
          YV
Sbjct: 74 YV 75


>gi|291542457|emb|CBL15567.1| SSU ribosomal protein S18P [Ruminococcus bromii L2-63]
          Length = 79

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 43/74 (58%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
            + R    R+K C         IDYKDI  L R++S+RGKI+P R++    + QREL  
Sbjct: 4  RPMNRGRKARKKVCGFCVDKVENIDYKDIARLRRYMSERGKILPRRVTGTCARHQRELTV 63

Query: 68 AIKRARYLGLIAYV 81
          AIKRAR+L L+ Y 
Sbjct: 64 AIKRARHLALLPYT 77


>gi|239637255|ref|ZP_04678243.1| ribosomal protein S18 [Staphylococcus warneri L37603]
 gi|239597211|gb|EEQ79720.1| ribosomal protein S18 [Staphylococcus warneri L37603]
 gi|330685075|gb|EGG96742.1| ribosomal protein S18 [Staphylococcus epidermidis VCU121]
          Length = 80

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTAAIKRARHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|56477753|ref|YP_159342.1| 30S ribosomal protein S18 [Aromatoleum aromaticum EbN1]
 gi|56313796|emb|CAI08441.1| 30S Ribosomal protein S18 [Aromatoleum aromaticum EbN1]
          Length = 91

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 46/72 (63%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  RRK C  + +    +DYKD+ +L  F+++  KI+P+RI+      QR+L+ A+KR
Sbjct: 18 RGLFKRRKFCRFTAEKIEEVDYKDVDILKDFVTENSKIMPARITGTKAGYQRQLSTAVKR 77

Query: 72 ARYLGLIAYVNL 83
          AR+L L+ Y +L
Sbjct: 78 ARFLALLPYTDL 89


>gi|257453409|ref|ZP_05618704.1| ribosomal protein S18 [Enhydrobacter aerosaccus SK60]
 gi|257449161|gb|EEV24109.1| ribosomal protein S18 [Enhydrobacter aerosaccus SK60]
          Length = 75

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 49/70 (70%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI +L +++++ GKIVPSRI+  S+K QR+LA AIK+A
Sbjct: 3  RFYRRRKFCRFTAEGITHIDYKDIEILKQYVTESGKIVPSRITGTSNKYQRQLAVAIKQA 62

Query: 73 RYLGLIAYVN 82
          RYL LI Y +
Sbjct: 63 RYLALIPYTD 72


>gi|110835050|ref|YP_693909.1| 30S ribosomal protein S18 [Alcanivorax borkumensis SK2]
 gi|254427140|ref|ZP_05040847.1| ribosomal protein S18 [Alcanivorax sp. DG881]
 gi|123149283|sp|Q0VMG1|RS18_ALCBS RecName: Full=30S ribosomal protein S18
 gi|110648161|emb|CAL17637.1| 30S ribosomal protein S18 [Alcanivorax borkumensis SK2]
 gi|196193309|gb|EDX88268.1| ribosomal protein S18 [Alcanivorax sp. DG881]
          Length = 76

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIK+A
Sbjct: 3  RFYRRRKFCRFTAEGVEYIDYKDLDTLKAYITETGKIVPSRITGTKARYQRQLASAIKQA 62

Query: 73 RYLGLIAYVN 82
          R+L L+ Y +
Sbjct: 63 RFLALLPYSD 72


>gi|325261132|ref|ZP_08127870.1| ribosomal protein S18 [Clostridium sp. D5]
 gi|324032586|gb|EGB93863.1| ribosomal protein S18 [Clostridium sp. D5]
          Length = 88

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 44/72 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R     R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AI
Sbjct: 15 RRGPARRRKKVCVFCGKENNDIDYKDVVKLKKYISERGKILPRRITGNCAKHQRALTVAI 74

Query: 70 KRARYLGLIAYV 81
          KRAR++ L+ YV
Sbjct: 75 KRARHIALMPYV 86


>gi|73748806|ref|YP_308045.1| 30S ribosomal protein S18 [Dehalococcoides sp. CBDB1]
 gi|147669567|ref|YP_001214385.1| 30S ribosomal protein S18 [Dehalococcoides sp. BAV1]
 gi|289432827|ref|YP_003462700.1| ribosomal protein S18 [Dehalococcoides sp. GT]
 gi|123773677|sp|Q3ZY14|RS18_DEHSC RecName: Full=30S ribosomal protein S18
 gi|205557202|sp|A5FQL1|RS18_DEHSB RecName: Full=30S ribosomal protein S18
 gi|73660522|emb|CAI83129.1| ribosomal protein S18 [Dehalococcoides sp. CBDB1]
 gi|146270515|gb|ABQ17507.1| SSU ribosomal protein S18P [Dehalococcoides sp. BAV1]
 gi|288946547|gb|ADC74244.1| ribosomal protein S18 [Dehalococcoides sp. GT]
          Length = 147

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 44/77 (57%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P    R   + +RK C    +   RIDYKD   L R++S RGKI P R +    + QR L
Sbjct: 10 PARGGRGRYTPKRKICSFCAEKVSRIDYKDSAKLARYISDRGKIEPRRRTGTCARHQRAL 69

Query: 66 AKAIKRARYLGLIAYVN 82
          A AIKRAR++ L+ +V+
Sbjct: 70 ANAIKRARFIALMPFVS 86


>gi|260425912|ref|ZP_05779891.1| ribosomal protein S18 [Citreicella sp. SE45]
 gi|260420404|gb|EEX13655.1| ribosomal protein S18 [Citreicella sp. SE45]
          Length = 75

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 57/73 (78%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+A
Sbjct: 1  MAAKPFFRRRKVCPFSGDNAPAIDYKDTKLLQRYISERGKIVPSRITAVSAKKQRELARA 60

Query: 69 IKRARYLGLIAYV 81
          IKRAR+L L+ YV
Sbjct: 61 IKRARFLALLPYV 73


>gi|251793280|ref|YP_003008008.1| 30S ribosomal protein S18 [Aggregatibacter aphrophilus NJ8700]
 gi|261867098|ref|YP_003255020.1| 30S ribosomal protein S18 [Aggregatibacter actinomycetemcomitans
          D11S-1]
 gi|293390733|ref|ZP_06635067.1| ribosomal protein S18 [Aggregatibacter actinomycetemcomitans
          D7S-1]
 gi|315633585|ref|ZP_07888875.1| 50S ribosomal protein L21 [Aggregatibacter segnis ATCC 33393]
 gi|247534675|gb|ACS97921.1| ribosomal protein S18 [Aggregatibacter aphrophilus NJ8700]
 gi|261412430|gb|ACX81801.1| ribosomal protein S18 [Aggregatibacter actinomycetemcomitans
          D11S-1]
 gi|290951267|gb|EFE01386.1| ribosomal protein S18 [Aggregatibacter actinomycetemcomitans
          D7S-1]
 gi|315477627|gb|EFU68369.1| 50S ribosomal protein L21 [Aggregatibacter segnis ATCC 33393]
          Length = 76

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI  L  ++S+ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAENVVEIDYKDIATLKNYISESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYSD 72


>gi|169351670|ref|ZP_02868608.1| hypothetical protein CLOSPI_02451 [Clostridium spiroforme DSM
          1552]
 gi|169291892|gb|EDS74025.1| hypothetical protein CLOSPI_02451 [Clostridium spiroforme DSM
          1552]
          Length = 76

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 44/72 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R+    R+K C  +      IDYKD+ LL RF+S  GKI+P R++  S K QR LA AI
Sbjct: 3  FRKQRMGRKKVCYFTKNNITYIDYKDVELLKRFVSANGKIIPRRVTGTSAKYQRMLATAI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 63 KRARQMALLPYV 74


>gi|307822879|ref|ZP_07653110.1| ribosomal protein S18 [Methylobacter tundripaludum SV96]
 gi|307736483|gb|EFO07329.1| ribosomal protein S18 [Methylobacter tundripaludum SV96]
          Length = 75

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 48/70 (68%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              R+K C  S +G  +IDYKD+ LL+ ++++ GKIVPSRI+  S K QR+L  AIKRA
Sbjct: 3  RNIRRKKFCRFSAEGGTQIDYKDLDLLSDYITETGKIVPSRITGTSAKYQRQLGVAIKRA 62

Query: 73 RYLGLIAYVN 82
          R++ L+ + +
Sbjct: 63 RFIALLPFCD 72


>gi|237748617|ref|ZP_04579097.1| 30S ribosomal protein S18 [Oxalobacter formigenes OXCC13]
 gi|229379979|gb|EEO30070.1| 30S ribosomal protein S18 [Oxalobacter formigenes OXCC13]
          Length = 94

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 44/73 (60%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +  +  R+K C  +  G  +IDYKDI  L  F+ +  KI+P+R++      QR++  AIK
Sbjct: 19 QNPLFKRKKFCRFTAAGVEQIDYKDIDTLKDFIQENCKIMPARLTGTKAHYQRQVDTAIK 78

Query: 71 RARYLGLIAYVNL 83
          RAR+L L+ Y +L
Sbjct: 79 RARFLALLPYTSL 91


>gi|326802630|ref|YP_004320448.1| ribosomal protein S18 [Aerococcus urinae ACS-120-V-Col10a]
 gi|326651036|gb|AEA01219.1| ribosomal protein S18 [Aerococcus urinae ACS-120-V-Col10a]
          Length = 79

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 37/63 (58%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD  LL+R++S +GKI+P R++    K QR L  AIKRAR + L+
Sbjct: 14 KVCFFCANHMDFIDYKDTDLLSRYVSDKGKILPRRVTGTCAKHQRTLTSAIKRARIMALL 73

Query: 79 AYV 81
           + 
Sbjct: 74 PFT 76


>gi|167948932|ref|ZP_02536006.1| 30S ribosomal protein S18 [Endoriftia persephone
          'Hot96_1+Hot96_2']
          Length = 74

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              R+K C  + +G   IDYKD+ LL  ++S+ GKIVPSRI+    K QR+LA AIKRA
Sbjct: 3  RFFRRKKYCRFTAEGITDIDYKDLNLLKAYVSESGKIVPSRITGTKAKYQRQLATAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYSD 72


>gi|254473485|ref|ZP_05086882.1| ribosomal protein S18 [Pseudovibrio sp. JE062]
 gi|211957601|gb|EEA92804.1| ribosomal protein S18 [Pseudovibrio sp. JE062]
          Length = 81

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKDIRLL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 9  RRPFFRRRKTCPFSGANAPKIDYKDIRLLQRYISERGKIVPSRITAVSAKKQRELARAIK 68

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ +V
Sbjct: 69 RARFLGLLPFV 79


>gi|319941486|ref|ZP_08015814.1| 30S ribosomal protein S18 [Sutterella wadsworthensis 3_1_45B]
 gi|319805106|gb|EFW01936.1| 30S ribosomal protein S18 [Sutterella wadsworthensis 3_1_45B]
          Length = 90

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 45/77 (58%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
               + ++  RRK C  + +   +IDYKD+  L  F+ + GKI+P+R++      QR+L
Sbjct: 12 RRSNQQNSLFKRRKFCRFTAEHVEQIDYKDVDTLRDFIQENGKIMPARLTGTQAHYQRQL 71

Query: 66 AKAIKRARYLGLIAYVN 82
            AIKRAR+L L+ Y +
Sbjct: 72 DTAIKRARFLALLPYTD 88


>gi|242243301|ref|ZP_04797746.1| 30S ribosomal protein S18 [Staphylococcus epidermidis W23144]
 gi|251811311|ref|ZP_04825784.1| 30S ribosomal protein S18 [Staphylococcus epidermidis
          BCM-HMP0060]
 gi|293367634|ref|ZP_06614286.1| 30S ribosomal protein S18 [Staphylococcus epidermidis
          M23864:W2(grey)]
 gi|242233250|gb|EES35562.1| 30S ribosomal protein S18 [Staphylococcus epidermidis W23144]
 gi|251805178|gb|EES57835.1| 30S ribosomal protein S18 [Staphylococcus epidermidis
          BCM-HMP0060]
 gi|291318204|gb|EFE58598.1| 30S ribosomal protein S18 [Staphylococcus epidermidis
          M23864:W2(grey)]
          Length = 88

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR++ L
Sbjct: 21 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRARHMAL 80

Query: 78 IAYV 81
          + YV
Sbjct: 81 LPYV 84


>gi|325579200|ref|ZP_08149156.1| 50S ribosomal protein L21 [Haemophilus parainfluenzae ATCC 33392]
 gi|301155579|emb|CBW15047.1| 30S ribosomal subunit protein S18 [Haemophilus parainfluenzae
          T3T1]
 gi|325159435|gb|EGC71569.1| 50S ribosomal protein L21 [Haemophilus parainfluenzae ATCC 33392]
          Length = 76

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI  L  ++S+ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAENVVEIDYKDIATLKNYISESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYSD 72


>gi|187932713|ref|YP_001887719.1| 30S ribosomal protein S18 [Clostridium botulinum B str. Eklund
          17B]
 gi|188587867|ref|YP_001922702.1| 30S ribosomal protein S18 [Clostridium botulinum E3 str. Alaska
          E43]
 gi|251778070|ref|ZP_04820990.1| 30S ribosomal protein S18 [Clostridium botulinum E1 str. 'BoNT E
          Beluga']
 gi|187720866|gb|ACD22087.1| 30S ribosomal protein S18 [Clostridium botulinum B str. Eklund
          17B]
 gi|188498148|gb|ACD51284.1| 30S ribosomal protein S18 [Clostridium botulinum E3 str. Alaska
          E43]
 gi|243082385|gb|EES48275.1| 30S ribosomal protein S18 [Clostridium botulinum E1 str. 'BoNT E
          Beluga']
          Length = 83

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 44/82 (53%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M+         R    +RK C      A  IDYKDI  L +++++RGKI+P RIS    K
Sbjct: 1  MSREDNRRSGGRARRSKRKVCAFCVDKADSIDYKDINKLRKYVTERGKILPRRISGTCAK 60

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
           QR+L  AIKRAR + L+ +  
Sbjct: 61 HQRQLTDAIKRARNIALLPFTT 82


>gi|317130989|ref|YP_004097271.1| ribosomal protein S18 [Bacillus cellulosilyticus DSM 2522]
 gi|315475937|gb|ADU32540.1| ribosomal protein S18 [Bacillus cellulosilyticus DSM 2522]
          Length = 75

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 34/74 (45%), Positives = 47/74 (63%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR    RRK C  +      IDYKD  LL +F+S+RGKI+P R++  S K QR+L +A
Sbjct: 1  MARRGRPKRRKVCYFTVNKITSIDYKDTDLLKKFISERGKILPRRVTGTSAKYQRQLTRA 60

Query: 69 IKRARYLGLIAYVN 82
          IKR+R + L+ YV 
Sbjct: 61 IKRSRTMALLPYVT 74


>gi|320353929|ref|YP_004195268.1| 30S ribosomal protein S18P [Desulfobulbus propionicus DSM 2032]
 gi|320122431|gb|ADW17977.1| SSU ribosomal protein S18P [Desulfobulbus propionicus DSM 2032]
          Length = 79

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 41/69 (59%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          + V  RR+ C         IDYKD + L  F+++RGKI+P RI     K QREL +A+KR
Sbjct: 5  KKVFSRRRVCRFCTDKDVTIDYKDPKTLKNFVTERGKIIPRRIYGTCAKHQRELTEAVKR 64

Query: 72 ARYLGLIAY 80
          AR L L+ Y
Sbjct: 65 ARQLALLPY 73


>gi|221639577|ref|YP_002525839.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides KD131]
 gi|254812952|sp|B9KJP1|RS18_RHOSK RecName: Full=30S ribosomal protein S18
 gi|221160358|gb|ACM01338.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides KD131]
          Length = 75

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 46/72 (63%), Positives = 55/72 (76%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA A
Sbjct: 1  MANKPFFRRRKVCPFSGDNAPVIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELAAA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|205371930|ref|ZP_03224750.1| 30S ribosomal protein S18 [Bacillus coahuilensis m4-4]
          Length = 79

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 41/63 (65%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ 
Sbjct: 15 VCYFTSNNITNIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTTAIKRARMMALLP 74

Query: 80 YVN 82
          YV 
Sbjct: 75 YVT 77


>gi|205562353|sp|A7ZAU7|RS18_BACA2 RecName: Full=30S ribosomal protein S18
 gi|328555771|gb|AEB26263.1| 30S ribosomal protein S18 [Bacillus amyloliquefaciens TA208]
          Length = 79

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 42/63 (66%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIKRAR + L+ 
Sbjct: 15 VCYFTSNGITHIDYKDVDLLRKFVSERGKILPRRVTGTNAKYQRKLTIAIKRARQMALLP 74

Query: 80 YVN 82
          YV 
Sbjct: 75 YVT 77


>gi|224824683|ref|ZP_03697790.1| ribosomal protein S18 [Lutiella nitroferrum 2002]
 gi|224603176|gb|EEG09352.1| ribosomal protein S18 [Lutiella nitroferrum 2002]
          Length = 75

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 46/73 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R +  R+K C  + +G   IDYK + LL  F+++ GKI+PSRI+    + QR+L  AI
Sbjct: 1  MARQLFKRKKFCRFTAEGIKEIDYKSVDLLKDFIAENGKIIPSRITGTKARYQRQLTTAI 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L  + Y +
Sbjct: 61 KRARFLAFLPYTD 73


>gi|319787275|ref|YP_004146750.1| ribosomal protein S18 [Pseudoxanthomonas suwonensis 11-1]
 gi|317465787|gb|ADV27519.1| ribosomal protein S18 [Pseudoxanthomonas suwonensis 11-1]
          Length = 76

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 46/71 (64%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               RRK C  + +G   IDYKD+  L ++L++ GKIVPSR++    + QR+L+ AIKR
Sbjct: 2  SKFFRRRKFCKFTAEGVKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSRYQRQLSTAIKR 61

Query: 72 ARYLGLIAYVN 82
          AR+L LI Y +
Sbjct: 62 ARFLALIPYTD 72


>gi|210613749|ref|ZP_03289863.1| hypothetical protein CLONEX_02070 [Clostridium nexile DSM 1787]
 gi|210150958|gb|EEA81966.1| hypothetical protein CLONEX_02070 [Clostridium nexile DSM 1787]
          Length = 87

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 49/79 (62%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
            A +P+ RR    R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K Q
Sbjct: 7  NKADSPMKRRGGRRRKKVCVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQ 66

Query: 63 RELAKAIKRARYLGLIAYV 81
          R L  AIKRAR++ L+ YV
Sbjct: 67 RALTVAIKRARHIALMPYV 85


>gi|154688193|ref|YP_001423354.1| 30S ribosomal protein S18 [Bacillus amyloliquefaciens FZB42]
 gi|308175795|ref|YP_003922500.1| 30S ribosomal protein S18 [Bacillus amyloliquefaciens DSM 7]
 gi|154354044|gb|ABS76123.1| RpsR [Bacillus amyloliquefaciens FZB42]
 gi|307608659|emb|CBI45030.1| ribosomal protein S18 [Bacillus amyloliquefaciens DSM 7]
          Length = 81

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 42/63 (66%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIKRAR + L+ 
Sbjct: 17 VCYFTSNGITHIDYKDVDLLRKFVSERGKILPRRVTGTNAKYQRKLTIAIKRARQMALLP 76

Query: 80 YVN 82
          YV 
Sbjct: 77 YVT 79


>gi|53719096|ref|YP_108082.1| 30S ribosomal protein S18 [Burkholderia pseudomallei K96243]
 gi|53723579|ref|YP_103058.1| 30S ribosomal protein S18 [Burkholderia mallei ATCC 23344]
 gi|67640202|ref|ZP_00439017.1| 30S ribosomal protein S18 [Burkholderia mallei GB8 horse 4]
 gi|76812240|ref|YP_333809.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1710b]
 gi|83719433|ref|YP_442702.1| 30S ribosomal protein S18 [Burkholderia thailandensis E264]
 gi|107028949|ref|YP_626044.1| 30S ribosomal protein S18 [Burkholderia cenocepacia AU 1054]
 gi|116689893|ref|YP_835516.1| 30S ribosomal protein S18 [Burkholderia cenocepacia HI2424]
 gi|121598687|ref|YP_993212.1| 30S ribosomal protein S18 [Burkholderia mallei SAVP1]
 gi|124384536|ref|YP_001026013.1| 30S ribosomal protein S18 [Burkholderia mallei NCTC 10229]
 gi|126438832|ref|YP_001059285.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 668]
 gi|126448650|ref|YP_001080720.1| 30S ribosomal protein S18 [Burkholderia mallei NCTC 10247]
 gi|126454887|ref|YP_001066553.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1106a]
 gi|134278013|ref|ZP_01764728.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 305]
 gi|161524575|ref|YP_001579587.1| 30S ribosomal protein S18 [Burkholderia multivorans ATCC 17616]
 gi|167002902|ref|ZP_02268692.1| 30S ribosomal protein S18 [Burkholderia mallei PRL-20]
 gi|167562481|ref|ZP_02355397.1| ribosomal protein S18 [Burkholderia oklahomensis EO147]
 gi|167569665|ref|ZP_02362539.1| ribosomal protein S18 [Burkholderia oklahomensis C6786]
 gi|167581641|ref|ZP_02374515.1| ribosomal protein S18 [Burkholderia thailandensis TXDOH]
 gi|167586988|ref|ZP_02379376.1| ribosomal protein S18 [Burkholderia ubonensis Bu]
 gi|167619761|ref|ZP_02388392.1| ribosomal protein S18 [Burkholderia thailandensis Bt4]
 gi|167719192|ref|ZP_02402428.1| ribosomal protein S18 [Burkholderia pseudomallei DM98]
 gi|167738194|ref|ZP_02410968.1| ribosomal protein S18 [Burkholderia pseudomallei 14]
 gi|167815383|ref|ZP_02447063.1| ribosomal protein S18 [Burkholderia pseudomallei 91]
 gi|167823791|ref|ZP_02455262.1| ribosomal protein S18 [Burkholderia pseudomallei 9]
 gi|167836331|ref|ZP_02463214.1| ribosomal protein S18 [Burkholderia thailandensis MSMB43]
 gi|167845334|ref|ZP_02470842.1| ribosomal protein S18 [Burkholderia pseudomallei B7210]
 gi|167893876|ref|ZP_02481278.1| ribosomal protein S18 [Burkholderia pseudomallei 7894]
 gi|167902330|ref|ZP_02489535.1| ribosomal protein S18 [Burkholderia pseudomallei NCTC 13177]
 gi|167910568|ref|ZP_02497659.1| ribosomal protein S18 [Burkholderia pseudomallei 112]
 gi|167918594|ref|ZP_02505685.1| ribosomal protein S18 [Burkholderia pseudomallei BCC215]
 gi|189350669|ref|YP_001946297.1| 30S ribosomal protein S18 [Burkholderia multivorans ATCC 17616]
 gi|217421371|ref|ZP_03452875.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 576]
 gi|221198144|ref|ZP_03571190.1| 30S ribosomal protein S18 [Burkholderia multivorans CGD2M]
 gi|221208365|ref|ZP_03581368.1| 30S ribosomal protein S18 [Burkholderia multivorans CGD2]
 gi|221215116|ref|ZP_03588083.1| 30S ribosomal protein S18 [Burkholderia multivorans CGD1]
 gi|226197276|ref|ZP_03792853.1| 30S ribosomal protein S18 [Burkholderia pseudomallei Pakistan 9]
 gi|237812611|ref|YP_002897062.1| ribosomal protein S18 [Burkholderia pseudomallei MSHR346]
 gi|242316691|ref|ZP_04815707.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1106b]
 gi|254178433|ref|ZP_04885088.1| 30S ribosomal protein S18 [Burkholderia mallei ATCC 10399]
 gi|254179492|ref|ZP_04886091.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1655]
 gi|254189116|ref|ZP_04895627.1| 30S ribosomal protein S18 [Burkholderia pseudomallei Pasteur
          52237]
 gi|254197494|ref|ZP_04903916.1| 30S ribosomal protein S18 [Burkholderia pseudomallei S13]
 gi|254200004|ref|ZP_04906370.1| 30S ribosomal protein S18 [Burkholderia mallei FMH]
 gi|254206337|ref|ZP_04912689.1| 30S ribosomal protein S18 [Burkholderia mallei JHU]
 gi|254248017|ref|ZP_04941338.1| Ribosomal protein S18 [Burkholderia cenocepacia PC184]
 gi|254261784|ref|ZP_04952838.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1710a]
 gi|254297374|ref|ZP_04964827.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 406e]
 gi|254358248|ref|ZP_04974521.1| 30S ribosomal protein S18 [Burkholderia mallei 2002721280]
 gi|257138914|ref|ZP_05587176.1| 30S ribosomal protein S18 [Burkholderia thailandensis E264]
 gi|59798633|sp|Q62JR1|RS18_BURMA RecName: Full=30S ribosomal protein S18
 gi|59798645|sp|Q63UY4|RS18_BURPS RecName: Full=30S ribosomal protein S18
 gi|123179948|sp|Q1BH34|RS18_BURCA RecName: Full=30S ribosomal protein S18
 gi|123598874|sp|Q3JRJ4|RS18_BURP1 RecName: Full=30S ribosomal protein S18
 gi|123753784|sp|Q2SWJ7|RS18_BURTA RecName: Full=30S ribosomal protein S18
 gi|166220929|sp|A0K7Z6|RS18_BURCH RecName: Full=30S ribosomal protein S18
 gi|166220930|sp|A3MKD4|RS18_BURM7 RecName: Full=30S ribosomal protein S18
 gi|166220931|sp|A2S244|RS18_BURM9 RecName: Full=30S ribosomal protein S18
 gi|166220932|sp|A1V4Q9|RS18_BURMS RecName: Full=30S ribosomal protein S18
 gi|166220933|sp|A3NW32|RS18_BURP0 RecName: Full=30S ribosomal protein S18
 gi|166220934|sp|A3NAB4|RS18_BURP6 RecName: Full=30S ribosomal protein S18
 gi|229559971|sp|A9AJW3|RS18_BURM1 RecName: Full=30S ribosomal protein S18
 gi|52209510|emb|CAH35462.1| 30S ribosomal protein S18 [Burkholderia pseudomallei K96243]
 gi|52427002|gb|AAU47595.1| ribosomal protein S18 [Burkholderia mallei ATCC 23344]
 gi|76581693|gb|ABA51168.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1710b]
 gi|83653258|gb|ABC37321.1| ribosomal protein S18 [Burkholderia thailandensis E264]
 gi|105898113|gb|ABF81071.1| SSU ribosomal protein S18P [Burkholderia cenocepacia AU 1054]
 gi|116647982|gb|ABK08623.1| SSU ribosomal protein S18P [Burkholderia cenocepacia HI2424]
 gi|121227497|gb|ABM50015.1| 30S ribosomal protein S18 [Burkholderia mallei SAVP1]
 gi|124292556|gb|ABN01825.1| 30S ribosomal protein S18 [Burkholderia mallei NCTC 10229]
 gi|124872793|gb|EAY64509.1| Ribosomal protein S18 [Burkholderia cenocepacia PC184]
 gi|126218325|gb|ABN81831.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 668]
 gi|126228529|gb|ABN92069.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1106a]
 gi|126241520|gb|ABO04613.1| 30S ribosomal protein S18 [Burkholderia mallei NCTC 10247]
 gi|134251663|gb|EBA51742.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 305]
 gi|147749600|gb|EDK56674.1| 30S ribosomal protein S18 [Burkholderia mallei FMH]
 gi|147753780|gb|EDK60845.1| 30S ribosomal protein S18 [Burkholderia mallei JHU]
 gi|148027375|gb|EDK85396.1| 30S ribosomal protein S18 [Burkholderia mallei 2002721280]
 gi|157807650|gb|EDO84820.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 406e]
 gi|157936795|gb|EDO92465.1| 30S ribosomal protein S18 [Burkholderia pseudomallei Pasteur
          52237]
 gi|160342004|gb|ABX15090.1| ribosomal protein S18 [Burkholderia multivorans ATCC 17616]
 gi|160699472|gb|EDP89442.1| 30S ribosomal protein S18 [Burkholderia mallei ATCC 10399]
 gi|169654235|gb|EDS86928.1| 30S ribosomal protein S18 [Burkholderia pseudomallei S13]
 gi|184210032|gb|EDU07075.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1655]
 gi|189334691|dbj|BAG43761.1| small subunit ribosomal protein S18 [Burkholderia multivorans
          ATCC 17616]
 gi|217395113|gb|EEC35131.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 576]
 gi|221165052|gb|EED97531.1| 30S ribosomal protein S18 [Burkholderia multivorans CGD1]
 gi|221171778|gb|EEE04222.1| 30S ribosomal protein S18 [Burkholderia multivorans CGD2]
 gi|221182076|gb|EEE14477.1| 30S ribosomal protein S18 [Burkholderia multivorans CGD2M]
 gi|225930655|gb|EEH26665.1| 30S ribosomal protein S18 [Burkholderia pseudomallei Pakistan 9]
 gi|237506129|gb|ACQ98447.1| ribosomal protein S18 [Burkholderia pseudomallei MSHR346]
 gi|238520888|gb|EEP84344.1| 30S ribosomal protein S18 [Burkholderia mallei GB8 horse 4]
 gi|242139930|gb|EES26332.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1106b]
 gi|243061456|gb|EES43642.1| 30S ribosomal protein S18 [Burkholderia mallei PRL-20]
 gi|254220473|gb|EET09857.1| 30S ribosomal protein S18 [Burkholderia pseudomallei 1710a]
 gi|325522549|gb|EGD01101.1| 30S ribosomal protein S18 [Burkholderia sp. TJI49]
          Length = 91

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +       +  +  R+K C  +  G  +IDYKD   L  F+ + GKI P+R++      Q
Sbjct: 8  KFDKRRQQQNPLFKRKKFCRFTAAGVEQIDYKDTETLKDFIGENGKITPARLTGTKAHYQ 67

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 68 RQLDTAIKRARFLALLPYTD 87


>gi|50812313|ref|NP_391969.2| 30S ribosomal protein S18 [Bacillus subtilis subsp. subtilis str.
          168]
 gi|221312071|ref|ZP_03593918.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. subtilis str.
          168]
 gi|221316396|ref|ZP_03598201.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. subtilis str.
          NCIB 3610]
 gi|221321309|ref|ZP_03602603.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. subtilis str.
          JH642]
 gi|221325592|ref|ZP_03606886.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. subtilis str.
          SMY]
 gi|296330018|ref|ZP_06872502.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. spizizenii
          ATCC 6633]
 gi|305676742|ref|YP_003868414.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. spizizenii
          str. W23]
 gi|321313649|ref|YP_004205936.1| 30S ribosomal protein S18 [Bacillus subtilis BSn5]
 gi|585940|sp|P21475|RS18_BACSU RecName: Full=30S ribosomal protein S18; AltName: Full=BS21
 gi|32468848|emb|CAB16126.2| ribosomal protein S18 [Bacillus subtilis subsp. subtilis str.
          168]
 gi|296153057|gb|EFG93922.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. spizizenii
          ATCC 6633]
 gi|305414986|gb|ADM40105.1| 30S ribosomal protein S18 [Bacillus subtilis subsp. spizizenii
          str. W23]
 gi|320019923|gb|ADV94909.1| 30S ribosomal protein S18 [Bacillus subtilis BSn5]
          Length = 79

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 43/63 (68%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIKRAR + L+ 
Sbjct: 15 VCYFTSNGITHIDYKDVDLLKKFVSERGKILPRRVTGTNAKYQRKLTAAIKRARQMALLP 74

Query: 80 YVN 82
          YV+
Sbjct: 75 YVS 77


>gi|319938326|ref|ZP_08012722.1| 30S ribosomal protein S18 [Coprobacillus sp. 29_1]
 gi|319806509|gb|EFW03171.1| 30S ribosomal protein S18 [Coprobacillus sp. 29_1]
          Length = 76

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 45/72 (62%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +R    R+K C  +      IDYKD+ LL RF+S  GKI+P R++  S K QR+LA AI
Sbjct: 3  FKRQRMGRKKVCFFTKNKIDYIDYKDVELLKRFVSANGKIIPRRVTGTSAKYQRQLAAAI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 63 KRARQMALLPYV 74


>gi|150019892|ref|YP_001312146.1| 30S ribosomal protein S18 [Clostridium beijerinckii NCIMB 8052]
 gi|189029672|sp|A6M3L0|RS18_CLOB8 RecName: Full=30S ribosomal protein S18
 gi|149906357|gb|ABR37190.1| ribosomal protein S18 [Clostridium beijerinckii NCIMB 8052]
          Length = 86

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 42/71 (59%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          +    R+K C      A  IDYKDI  L +++++RGKI+P RIS    K QREL  +IKR
Sbjct: 15 KMRRSRKKVCAFCVDKAEFIDYKDINKLRKYVTERGKILPRRISGTCAKHQRELTSSIKR 74

Query: 72 ARYLGLIAYVN 82
          AR + L+ +  
Sbjct: 75 ARNIALLPFTT 85


>gi|467373|dbj|BAA05219.1| ribosomal protein S18 [Bacillus subtilis]
          Length = 81

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 43/63 (68%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIKRAR + L+ 
Sbjct: 17 VCYFTSNGITHIDYKDVDLLKKFVSERGKILPRRVTGTNAKYQRKLTAAIKRARQMALLP 76

Query: 80 YVN 82
          YV+
Sbjct: 77 YVS 79


>gi|237745856|ref|ZP_04576336.1| 30S ribosomal protein S18 [Oxalobacter formigenes HOxBLS]
 gi|229377207|gb|EEO27298.1| 30S ribosomal protein S18 [Oxalobacter formigenes HOxBLS]
          Length = 94

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 43/73 (58%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +  +  R+K C  +     +IDYKDI  L  F+ +  KI+P+R++      QR+L  AIK
Sbjct: 19 QNPLFKRKKFCRFTVANVEQIDYKDIDTLKDFIQENCKIMPARLTGTKAHYQRQLDTAIK 78

Query: 71 RARYLGLIAYVNL 83
          RAR+L L+ Y +L
Sbjct: 79 RARFLALLPYTSL 91


>gi|134295902|ref|YP_001119637.1| 30S ribosomal protein S18 [Burkholderia vietnamiensis G4]
 gi|166220935|sp|A4JEU9|RS18_BURVG RecName: Full=30S ribosomal protein S18
 gi|134139059|gb|ABO54802.1| SSU ribosomal protein S18P [Burkholderia vietnamiensis G4]
          Length = 91

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +       +  +  R+K C  +  G  +IDYKD   L  F+ + GKI P+R++      Q
Sbjct: 8  KFDKRRQQQNPLFKRKKFCRFTAAGVDQIDYKDTETLKDFIGENGKITPARLTGTKAHYQ 67

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 68 RQLDTAIKRARFLALLPYTD 87


>gi|167747438|ref|ZP_02419565.1| hypothetical protein ANACAC_02158 [Anaerostipes caccae DSM 14662]
 gi|317471167|ref|ZP_07930538.1| ribosomal protein S18 [Anaerostipes sp. 3_2_56FAA]
 gi|167652800|gb|EDR96929.1| hypothetical protein ANACAC_02158 [Anaerostipes caccae DSM 14662]
 gi|316901382|gb|EFV23325.1| ribosomal protein S18 [Anaerostipes sp. 3_2_56FAA]
          Length = 84

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 39/63 (61%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C    +    IDYKD+  L +++S+RGKI+P RI+    K QR +  AIKRAR+L L+
Sbjct: 20 KVCAFCTEADAVIDYKDVATLKKYVSERGKILPRRITGTCAKHQRAVTSAIKRARHLALM 79

Query: 79 AYV 81
           Y 
Sbjct: 80 PYT 82


>gi|295689696|ref|YP_003593389.1| 30S ribosomal protein S18 [Caulobacter segnis ATCC 21756]
 gi|295431599|gb|ADG10771.1| ribosomal protein S18 [Caulobacter segnis ATCC 21756]
          Length = 92

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 47/68 (69%), Positives = 57/68 (83%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             RRK CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELAKAIKRAR
Sbjct: 23 FFRRRKVCPFSGANAPKIDYKDVKLLQRYVSERGKIVPSRITAVSAKKQRELAKAIKRAR 82

Query: 74 YLGLIAYV 81
          +L L+ YV
Sbjct: 83 FLALLPYV 90


>gi|312796133|ref|YP_004029055.1| SSU ribosomal protein S18P [Burkholderia rhizoxinica HKI 454]
 gi|312167908|emb|CBW74911.1| SSU ribosomal protein S18P [Burkholderia rhizoxinica HKI 454]
          Length = 91

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 43/81 (53%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +       +  +  R+K C  +      IDYKDI  L  F+ + GKI P+R++      Q
Sbjct: 8  KFDKRRQQQNPLFKRKKFCRFTAASVEYIDYKDIETLKDFIGENGKITPARLTGTKAHYQ 67

Query: 63 RELAKAIKRARYLGLIAYVNL 83
          R+L  AIKRAR+L L+ Y +L
Sbjct: 68 RQLDTAIKRARFLALLPYTDL 88


>gi|254499290|ref|ZP_05111964.1| 30S ribosomal protein S18 [Legionella drancourtii LLAP12]
 gi|254351487|gb|EET10348.1| 30S ribosomal protein S18 [Legionella drancourtii LLAP12]
          Length = 75

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/69 (50%), Positives = 47/69 (68%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             R+K C  S +G   IDYKDI LL  ++S+ GKIVPSRI+    + QR+LAKAIK AR
Sbjct: 4  YFRRKKMCRFSAEGGNEIDYKDINLLKNYISETGKIVPSRITGTQTRFQRQLAKAIKHAR 63

Query: 74 YLGLIAYVN 82
          ++GL+ Y +
Sbjct: 64 FIGLLPYCD 72


>gi|21672804|ref|NP_660871.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
 gi|25009169|sp|Q8K919|RS18_BUCAP RecName: Full=30S ribosomal protein S18
 gi|21623454|gb|AAM68082.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
          Length = 75

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 47/70 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI +L  ++++ GKIVPSRI+    K QR+L++AIK+A
Sbjct: 3  RYFRRRKFCRFTAEGIQEIDYKDIAMLKNYITENGKIVPSRITGTRAKFQRQLSRAIKKA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|269216494|ref|ZP_06160348.1| ribosomal protein S18 [Slackia exigua ATCC 700122]
 gi|269130023|gb|EEZ61105.1| ribosomal protein S18 [Slackia exigua ATCC 700122]
          Length = 86

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 42/69 (60%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
          N   RRK C     G   IDYKD  +L +F++ RGKI P R++    + QR++A AIK A
Sbjct: 5  NKQPRRKFCQFCKDGTDYIDYKDTAMLRKFVTDRGKIKPRRVTGACVQHQRDIATAIKNA 64

Query: 73 RYLGLIAYV 81
          R +GL+ YV
Sbjct: 65 REMGLMPYV 73


>gi|225023646|ref|ZP_03712838.1| hypothetical protein EIKCOROL_00509 [Eikenella corrodens ATCC
          23834]
 gi|224943528|gb|EEG24737.1| hypothetical protein EIKCOROL_00509 [Eikenella corrodens ATCC
          23834]
          Length = 76

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 47/73 (64%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK C  + +G  ++DYK + LL  F+S+ GKI+P+RI+      QR+L+ A+
Sbjct: 1  MARQTFKRRKFCRFTAEGIKQVDYKSVDLLKDFISENGKIIPARITGTKAHYQRQLSVAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|88858916|ref|ZP_01133557.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas tunicata D2]
 gi|88819142|gb|EAR28956.1| 30S ribosomal subunit protein S18 [Pseudoalteromonas tunicata D2]
          Length = 75

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 47/71 (66%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C    +G  +IDYKD+  L  ++++ GKIVPSRI+  S K QR+LA AIKRA
Sbjct: 3  RYFRRRKFCRFKAEGVQKIDYKDLATLRNYVTESGKIVPSRITGTSAKYQRQLAAAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLALLPYTDL 73


>gi|78066641|ref|YP_369410.1| 30S ribosomal protein S18 [Burkholderia sp. 383]
 gi|170703446|ref|ZP_02894217.1| ribosomal protein S18 [Burkholderia ambifaria IOP40-10]
 gi|170733231|ref|YP_001765178.1| 30S ribosomal protein S18 [Burkholderia cenocepacia MC0-3]
 gi|171321592|ref|ZP_02910523.1| ribosomal protein S18 [Burkholderia ambifaria MEX-5]
 gi|206560307|ref|YP_002231071.1| 30S ribosomal protein S18 [Burkholderia cenocepacia J2315]
 gi|238027018|ref|YP_002911249.1| 30S ribosomal protein S18 [Burkholderia glumae BGR1]
 gi|254252204|ref|ZP_04945522.1| Ribosomal protein S18 [Burkholderia dolosa AUO158]
 gi|330817223|ref|YP_004360928.1| 30S ribosomal protein S18 [Burkholderia gladioli BSR3]
 gi|123742574|sp|Q39FK0|RS18_BURS3 RecName: Full=30S ribosomal protein S18
 gi|229559969|sp|B1JTF1|RS18_BURCC RecName: Full=30S ribosomal protein S18
 gi|229559970|sp|B4EBH1|RS18_BURCJ RecName: Full=30S ribosomal protein S18
 gi|77967386|gb|ABB08766.1| SSU ribosomal protein S18P [Burkholderia sp. 383]
 gi|124894813|gb|EAY68693.1| Ribosomal protein S18 [Burkholderia dolosa AUO158]
 gi|169816473|gb|ACA91056.1| ribosomal protein S18 [Burkholderia cenocepacia MC0-3]
 gi|170131644|gb|EDT00201.1| ribosomal protein S18 [Burkholderia ambifaria IOP40-10]
 gi|171093125|gb|EDT38342.1| ribosomal protein S18 [Burkholderia ambifaria MEX-5]
 gi|198036348|emb|CAR52244.1| 30S ribosomal protein S18 [Burkholderia cenocepacia J2315]
 gi|237876212|gb|ACR28545.1| 30S ribosomal protein S18 [Burkholderia glumae BGR1]
 gi|327369616|gb|AEA60972.1| 30S ribosomal protein S18 [Burkholderia gladioli BSR3]
          Length = 91

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +       +  +  R+K C  +  G  +IDYKD   L  F+ + GKI P+R++      Q
Sbjct: 8  KFDKRRQQQNPLFKRKKFCRFTAAGVEQIDYKDTETLKDFIGENGKITPARLTGTKAHYQ 67

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 68 RQLDTAIKRARFLALLPYTD 87


>gi|114762812|ref|ZP_01442244.1| 30S ribosomal protein S18 [Pelagibaca bermudensis HTCC2601]
 gi|114544422|gb|EAU47429.1| 30S ribosomal protein S18 [Roseovarius sp. HTCC2601]
          Length = 75

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 58/73 (79%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+A
Sbjct: 1  MAAKPFFRRRKVCPFSGDNAPKIDYKDTKLLQRYISERGKIVPSRITAVSAKKQRELARA 60

Query: 69 IKRARYLGLIAYV 81
          IKRAR+L L+ YV
Sbjct: 61 IKRARFLALLPYV 73


>gi|115351860|ref|YP_773699.1| 30S ribosomal protein S18 [Burkholderia ambifaria AMMD]
 gi|172060830|ref|YP_001808482.1| 30S ribosomal protein S18 [Burkholderia ambifaria MC40-6]
 gi|122323038|sp|Q0BEQ8|RS18_BURCM RecName: Full=30S ribosomal protein S18
 gi|229559968|sp|B1YRJ2|RS18_BURA4 RecName: Full=30S ribosomal protein S18
 gi|115281848|gb|ABI87365.1| SSU ribosomal protein S18P [Burkholderia ambifaria AMMD]
 gi|171993347|gb|ACB64266.1| ribosomal protein S18 [Burkholderia ambifaria MC40-6]
          Length = 91

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +       +  +  R+K C  +  G  +IDYKD   L  F+ + GKI P+R++      Q
Sbjct: 8  KFDKRRQQQNPLFKRKKFCRFTAAGVDQIDYKDTETLKDFIGENGKITPARLTGTKAHYQ 67

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 68 RQLDTAIKRARFLALLPYTD 87


>gi|325662894|ref|ZP_08151463.1| 30S ribosomal protein S18 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|331086618|ref|ZP_08335696.1| 30S ribosomal protein S18 [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|325470946|gb|EGC74175.1| 30S ribosomal protein S18 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|330410451|gb|EGG89883.1| 30S ribosomal protein S18 [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 87

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 49/79 (62%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
            A +P+ RR    R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K Q
Sbjct: 7  NKADSPMKRRGGRRRKKVCVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQ 66

Query: 63 RELAKAIKRARYLGLIAYV 81
          R L  AIKRAR++ L+ YV
Sbjct: 67 RALTVAIKRARHIALMPYV 85


>gi|224542221|ref|ZP_03682760.1| hypothetical protein CATMIT_01396 [Catenibacterium mitsuokai DSM
          15897]
 gi|224524856|gb|EEF93961.1| hypothetical protein CATMIT_01396 [Catenibacterium mitsuokai DSM
          15897]
          Length = 76

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 46/72 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           RR    RRK C  +      IDYKD+ LL RF+S  GKI+P R++  S K QR+LA+AI
Sbjct: 3  FRRQRMGRRKVCYFTKNKIDYIDYKDVELLKRFISANGKIIPRRVTGTSAKYQRKLARAI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 63 KRARQMALLPYV 74


>gi|15617154|ref|NP_240367.1| 30S ribosomal protein S18 [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
 gi|219681905|ref|YP_002468291.1| 30S ribosomal protein S18 [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|219682460|ref|YP_002468844.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Tuc7
          (Acyrthosiphon pisum)]
 gi|257471611|ref|ZP_05635610.1| 30S ribosomal protein S18 [Buchnera aphidicola str. LSR1
          (Acyrthosiphon pisum)]
 gi|11387089|sp|P57626|RS18_BUCAI RecName: Full=30S ribosomal protein S18
 gi|254765415|sp|B8D8C7|RS18_BUCA5 RecName: Full=30S ribosomal protein S18
 gi|254765416|sp|B8D884|RS18_BUCAT RecName: Full=30S ribosomal protein S18
 gi|25294830|pir||E84995 30S ribosomal protein S18 [imported] - Buchnera sp. (strain APS)
 gi|10039219|dbj|BAB13253.1| 30S ribosomal protein S18 [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
 gi|219622193|gb|ACL30349.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Tuc7
          (Acyrthosiphon pisum)]
 gi|219624748|gb|ACL30903.1| 30S ribosomal protein S18 [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|311086283|gb|ADP66365.1| 30S ribosomal protein S18 [Buchnera aphidicola str. LL01
          (Acyrthosiphon pisum)]
 gi|311086859|gb|ADP66940.1| 30S ribosomal protein S18 [Buchnera aphidicola str. TLW03
          (Acyrthosiphon pisum)]
 gi|311087447|gb|ADP67527.1| 30S ribosomal protein S18 [Buchnera aphidicola str. JF99
          (Acyrthosiphon pisum)]
 gi|311087935|gb|ADP68014.1| 30S ribosomal protein S18 [Buchnera aphidicola str. JF98
          (Acyrthosiphon pisum)]
          Length = 75

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 47/70 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI +L  ++++ GKIVPSRI+    K QR+L++AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVQEIDYKDIAVLKNYITESGKIVPSRITGTRAKYQRQLSRAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|319898717|ref|YP_004158810.1| 30S ribosomal protein S18 [Bartonella clarridgeiae 73]
 gi|319402681|emb|CBI76227.1| 30S ribosomal protein S18 [Bartonella clarridgeiae 73]
          Length = 82

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++  T + RR   HRRK+CP SG  AP+IDYKD +LL R++S+RGKI+PSRI++VS K
Sbjct: 1  MTDINQTSV-RRPFHHRRKTCPFSGANAPKIDYKDTKLLQRYISERGKIIPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA AIKRAR+LGL+ YV
Sbjct: 60 KQRELANAIKRARFLGLLPYV 80


>gi|302669612|ref|YP_003829572.1| ribosomal protein S18 RpsR [Butyrivibrio proteoclasticus B316]
 gi|302394085|gb|ADL32990.1| ribosomal protein S18 RpsR [Butyrivibrio proteoclasticus B316]
          Length = 87

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 49/81 (60%), Gaps = 2/81 (2%)

Query: 2  AEVAPTPLLRRN-VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          ++ +  P+ R+  +  R+K C   G     IDYKD   L +F+S+ GKI+P RI+    K
Sbjct: 6  SDKSDAPMRRKGGMHRRKKVCVFCG-KDNVIDYKDTAKLKKFVSESGKILPRRITGNCAK 64

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QREL  A+KRAR+L L+ YV
Sbjct: 65 HQRELTSAVKRARHLALMPYV 85


>gi|319778266|ref|YP_004129179.1| SSU ribosomal protein S18p [Taylorella equigenitalis MCE9]
 gi|317108290|gb|ADU91036.1| SSU ribosomal protein S18p [Taylorella equigenitalis MCE9]
          Length = 91

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 44/72 (61%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +  +  RRK C  +  G   IDYKDI  L  F+++ GKI+P+R++      QR+L  AIK
Sbjct: 17 QNPLFKRRKFCRFTAAGVDEIDYKDIDTLKDFITETGKIIPARLTGTKANYQRQLDTAIK 76

Query: 71 RARYLGLIAYVN 82
          RAR+L L+ Y +
Sbjct: 77 RARFLALLPYTD 88


>gi|15923357|ref|NP_370891.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Mu50]
 gi|15926068|ref|NP_373601.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          N315]
 gi|21282072|ref|NP_645160.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MW2]
 gi|49482597|ref|YP_039821.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MRSA252]
 gi|49485247|ref|YP_042468.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MSSA476]
 gi|57652627|ref|YP_185330.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          COL]
 gi|82750079|ref|YP_415820.1| 30S ribosomal protein S18 [Staphylococcus aureus RF122]
 gi|87160951|ref|YP_493082.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          USA300_FPR3757]
 gi|88194149|ref|YP_498939.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          NCTC 8325]
 gi|148266854|ref|YP_001245797.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          JH9]
 gi|150392900|ref|YP_001315575.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          JH1]
 gi|151220571|ref|YP_001331393.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          str. Newman]
 gi|156978695|ref|YP_001440954.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Mu3]
 gi|161508639|ref|YP_001574298.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          USA300_TCH1516]
 gi|221142675|ref|ZP_03567168.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          str. JKD6009]
 gi|253316532|ref|ZP_04839745.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          str. CF-Marseille]
 gi|253730731|ref|ZP_04864896.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          USA300_TCH959]
 gi|253735110|ref|ZP_04869275.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          TCH130]
 gi|255005162|ref|ZP_05143763.2| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Mu50-omega]
 gi|257424511|ref|ZP_05600940.1| SSU ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          55/2053]
 gi|257427180|ref|ZP_05603582.1| SSU ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          65-1322]
 gi|257429816|ref|ZP_05606203.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          68-397]
 gi|257432520|ref|ZP_05608883.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus E1410]
 gi|257435422|ref|ZP_05611473.1| SSU ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          M876]
 gi|257794202|ref|ZP_05643181.1| 30S ribosomal protein S18 [Staphylococcus aureus A9781]
 gi|258413513|ref|ZP_05681788.1| 30S ribosomal protein S18 [Staphylococcus aureus A9763]
 gi|258421363|ref|ZP_05684290.1| SSU ribosomal protein S18 [Staphylococcus aureus A9719]
 gi|258424580|ref|ZP_05687457.1| SSU ribosomal protein S18 [Staphylococcus aureus A9635]
 gi|258436936|ref|ZP_05689276.1| ribosomal protein S18 [Staphylococcus aureus A9299]
 gi|258444347|ref|ZP_05692681.1| ribosomal protein S18 [Staphylococcus aureus A8115]
 gi|258444884|ref|ZP_05693205.1| ribosomal protein S18 [Staphylococcus aureus A6300]
 gi|258448089|ref|ZP_05696218.1| ribosomal protein S18 [Staphylococcus aureus A6224]
 gi|258453040|ref|ZP_05701033.1| ribosomal protein S18 [Staphylococcus aureus A5948]
 gi|258455922|ref|ZP_05703877.1| ribosomal protein S18 [Staphylococcus aureus A5937]
 gi|262048929|ref|ZP_06021809.1| 30S ribosomal protein S18 [Staphylococcus aureus D30]
 gi|262052853|ref|ZP_06025038.1| 30S ribosomal protein S18 [Staphylococcus aureus 930918-3]
 gi|269202015|ref|YP_003281284.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          ED98]
 gi|282893528|ref|ZP_06301761.1| 30S ribosomal protein S18 [Staphylococcus aureus A8117]
 gi|282902953|ref|ZP_06310846.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus C160]
 gi|282907350|ref|ZP_06315198.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Btn1260]
 gi|282907693|ref|ZP_06315535.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          WW2703/97]
 gi|282912600|ref|ZP_06320396.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          WBG10049]
 gi|282913226|ref|ZP_06321018.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus M899]
 gi|282915690|ref|ZP_06323461.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          D139]
 gi|282921665|ref|ZP_06329383.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          C427]
 gi|282922341|ref|ZP_06330032.1| 30S ribosomal protein S18 [Staphylococcus aureus A9765]
 gi|282922853|ref|ZP_06330543.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          C101]
 gi|282927422|ref|ZP_06335040.1| 30S ribosomal protein S18 [Staphylococcus aureus A10102]
 gi|283768095|ref|ZP_06341010.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          H19]
 gi|283959806|ref|ZP_06377247.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          A017934/97]
 gi|284023376|ref|ZP_06377774.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          132]
 gi|293498275|ref|ZP_06666129.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          58-424]
 gi|293509216|ref|ZP_06667934.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          M809]
 gi|293550480|ref|ZP_06673152.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus M1015]
 gi|294850016|ref|ZP_06790754.1| 30S ribosomal protein S18 [Staphylococcus aureus A9754]
 gi|295405640|ref|ZP_06815450.1| 30S ribosomal protein S18 [Staphylococcus aureus A8819]
 gi|295426902|ref|ZP_06819541.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          EMRSA16]
 gi|296275194|ref|ZP_06857701.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MR1]
 gi|297209119|ref|ZP_06925518.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          ATCC 51811]
 gi|297245547|ref|ZP_06929415.1| 30S ribosomal protein S18 [Staphylococcus aureus A8796]
 gi|297588886|ref|ZP_06947527.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MN8]
 gi|300911120|ref|ZP_07128569.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          TCH70]
 gi|304380333|ref|ZP_07363053.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          ATCC BAA-39]
 gi|54039414|sp|P66468|RS18_STAAN RecName: Full=30S ribosomal protein S18
 gi|54039415|sp|P66469|RS18_STAAW RecName: Full=30S ribosomal protein S18
 gi|54042149|sp|P66467|RS18_STAAM RecName: Full=30S ribosomal protein S18
 gi|56749541|sp|Q6GCA5|RS18_STAAS RecName: Full=30S ribosomal protein S18
 gi|56749588|sp|Q6GJV1|RS18_STAAR RecName: Full=30S ribosomal protein S18
 gi|71153727|sp|Q5HIS7|RS18_STAAC RecName: Full=30S ribosomal protein S18
 gi|123098065|sp|Q2G111|RS18_STAA8 RecName: Full=30S ribosomal protein S18
 gi|123736012|sp|Q2FJP6|RS18_STAA3 RecName: Full=30S ribosomal protein S18
 gi|123741000|sp|Q2YVJ0|RS18_STAAB RecName: Full=30S ribosomal protein S18
 gi|166222245|sp|A7WY61|RS18_STAA1 RecName: Full=30S ribosomal protein S18
 gi|172048763|sp|A6QE49|RS18_STAAE RecName: Full=30S ribosomal protein S18
 gi|189029691|sp|A6TYM0|RS18_STAA2 RecName: Full=30S ribosomal protein S18
 gi|189029692|sp|A5IPU8|RS18_STAA9 RecName: Full=30S ribosomal protein S18
 gi|189029693|sp|A8YZJ3|RS18_STAAT RecName: Full=30S ribosomal protein S18
 gi|13700281|dbj|BAB41579.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          N315]
 gi|14246135|dbj|BAB56529.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Mu50]
 gi|21203508|dbj|BAB94208.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MW2]
 gi|49240726|emb|CAG39387.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MRSA252]
 gi|49243690|emb|CAG42114.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MSSA476]
 gi|57286813|gb|AAW38907.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus COL]
 gi|82655610|emb|CAI80006.1| 30S ribosomal protein S18 [Staphylococcus aureus RF122]
 gi|87126925|gb|ABD21439.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          USA300_FPR3757]
 gi|87201707|gb|ABD29517.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus NCTC
          8325]
 gi|147739923|gb|ABQ48221.1| SSU ribosomal protein S18P [Staphylococcus aureus subsp. aureus
          JH9]
 gi|149945352|gb|ABR51288.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus JH1]
 gi|150373371|dbj|BAF66631.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          str. Newman]
 gi|156720830|dbj|BAF77247.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Mu3]
 gi|160367448|gb|ABX28419.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          USA300_TCH1516]
 gi|253725575|gb|EES94304.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          USA300_TCH959]
 gi|253726910|gb|EES95639.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          TCH130]
 gi|257273529|gb|EEV05631.1| SSU ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          55/2053]
 gi|257276811|gb|EEV08262.1| SSU ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          65-1322]
 gi|257280297|gb|EEV10884.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          68-397]
 gi|257283399|gb|EEV13531.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus E1410]
 gi|257286018|gb|EEV16134.1| SSU ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          M876]
 gi|257788174|gb|EEV26514.1| 30S ribosomal protein S18 [Staphylococcus aureus A9781]
 gi|257839760|gb|EEV64229.1| 30S ribosomal protein S18 [Staphylococcus aureus A9763]
 gi|257842787|gb|EEV67209.1| SSU ribosomal protein S18 [Staphylococcus aureus A9719]
 gi|257845175|gb|EEV69212.1| SSU ribosomal protein S18 [Staphylococcus aureus A9635]
 gi|257848727|gb|EEV72714.1| ribosomal protein S18 [Staphylococcus aureus A9299]
 gi|257850606|gb|EEV74554.1| ribosomal protein S18 [Staphylococcus aureus A8115]
 gi|257856202|gb|EEV79116.1| ribosomal protein S18 [Staphylococcus aureus A6300]
 gi|257858604|gb|EEV81478.1| ribosomal protein S18 [Staphylococcus aureus A6224]
 gi|257859250|gb|EEV82105.1| ribosomal protein S18 [Staphylococcus aureus A5948]
 gi|257862134|gb|EEV84907.1| ribosomal protein S18 [Staphylococcus aureus A5937]
 gi|259159254|gb|EEW44313.1| 30S ribosomal protein S18 [Staphylococcus aureus 930918-3]
 gi|259163001|gb|EEW47563.1| 30S ribosomal protein S18 [Staphylococcus aureus D30]
 gi|262074305|gb|ACY10278.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          ED98]
 gi|269939947|emb|CBI48319.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          TW20]
 gi|282315074|gb|EFB45460.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          C101]
 gi|282316080|gb|EFB46464.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          C427]
 gi|282320506|gb|EFB50845.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          D139]
 gi|282323326|gb|EFB53645.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus M899]
 gi|282324296|gb|EFB54612.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          WBG10049]
 gi|282328598|gb|EFB58869.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          WW2703/97]
 gi|282330249|gb|EFB59770.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          Btn1260]
 gi|282590746|gb|EFB95822.1| 30S ribosomal protein S18 [Staphylococcus aureus A10102]
 gi|282593467|gb|EFB98462.1| 30S ribosomal protein S18 [Staphylococcus aureus A9765]
 gi|282597412|gb|EFC02371.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus C160]
 gi|282764214|gb|EFC04341.1| 30S ribosomal protein S18 [Staphylococcus aureus A8117]
 gi|283461974|gb|EFC09058.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          H19]
 gi|283469674|emb|CAQ48885.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus ST398]
 gi|283789398|gb|EFC28225.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          A017934/97]
 gi|285816089|gb|ADC36576.1| SSU ribosomal protein S18p [Staphylococcus aureus 04-02981]
 gi|290919527|gb|EFD96603.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus M1015]
 gi|291097206|gb|EFE27464.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          58-424]
 gi|291467968|gb|EFF10476.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          M809]
 gi|294823150|gb|EFG39581.1| 30S ribosomal protein S18 [Staphylococcus aureus A9754]
 gi|294969715|gb|EFG45734.1| 30S ribosomal protein S18 [Staphylococcus aureus A8819]
 gi|295129354|gb|EFG58981.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          EMRSA16]
 gi|296886052|gb|EFH24986.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          ATCC 51811]
 gi|297177533|gb|EFH36784.1| 30S ribosomal protein S18 [Staphylococcus aureus A8796]
 gi|297577397|gb|EFH96110.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MN8]
 gi|298693705|gb|ADI96927.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus ED133]
 gi|300887299|gb|EFK82495.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          TCH70]
 gi|302332104|gb|ADL22297.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          JKD6159]
 gi|302750239|gb|ADL64416.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          str. JKD6008]
 gi|304341314|gb|EFM07233.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          ATCC BAA-39]
 gi|312436518|gb|ADQ75589.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          TCH60]
 gi|312828889|emb|CBX33731.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus ECT-R
          2]
 gi|315130015|gb|EFT86004.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          CGS03]
 gi|315194827|gb|EFU25216.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          CGS00]
 gi|315198049|gb|EFU28381.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          CGS01]
 gi|320139324|gb|EFW31203.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MRSA131]
 gi|320142874|gb|EFW34670.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          MRSA177]
 gi|323438827|gb|EGA96565.1| 30S ribosomal protein S18 [Staphylococcus aureus O11]
 gi|323442576|gb|EGB00204.1| 30S ribosomal protein S18 [Staphylococcus aureus O46]
 gi|329313060|gb|AEB87473.1| 30S ribosomal protein S18 [Staphylococcus aureus subsp. aureus
          T0131]
 gi|329724234|gb|EGG60747.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus 21189]
 gi|329725657|gb|EGG62136.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus 21172]
 gi|329732622|gb|EGG68972.1| ribosomal protein S18 [Staphylococcus aureus subsp. aureus 21193]
          Length = 80

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKR+R++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRSRHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|209520395|ref|ZP_03269158.1| ribosomal protein S18 [Burkholderia sp. H160]
 gi|295676424|ref|YP_003604948.1| ribosomal protein S18 [Burkholderia sp. CCGE1002]
 gi|209499180|gb|EDZ99272.1| ribosomal protein S18 [Burkholderia sp. H160]
 gi|295436267|gb|ADG15437.1| ribosomal protein S18 [Burkholderia sp. CCGE1002]
          Length = 91

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 43/80 (53%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +       +  +  R+K C  +  G   IDYKDI  L  F+ + GKI P+R++      Q
Sbjct: 8  KFDKRRQQQNPLFKRKKFCRFTAAGVEYIDYKDIETLKDFIGENGKITPARLTGTKAHYQ 67

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 68 RQLDTAIKRARFLALMPYTD 87


>gi|121602413|ref|YP_988808.1| 30S ribosomal protein S18 [Bartonella bacilliformis KC583]
 gi|166220924|sp|A1US55|RS18_BARBK RecName: Full=30S ribosomal protein S18
 gi|120614590|gb|ABM45191.1| ribosomal protein S18 [Bartonella bacilliformis KC583]
          Length = 82

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 50/81 (61%), Positives = 64/81 (79%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M+++    L RR  + RRK+CP SG    +IDYKDI+LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MSDINQN-LARRPFNRRRKTCPFSGTNVAKIDYKDIKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA AIKRAR+LGL+ YV
Sbjct: 60 KQRELANAIKRARFLGLLPYV 80


>gi|88810600|ref|ZP_01125857.1| 30S ribosomal protein S18 [Nitrococcus mobilis Nb-231]
 gi|88792230|gb|EAR23340.1| 30S ribosomal protein S18 [Nitrococcus mobilis Nb-231]
          Length = 74

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+LA AIKRA
Sbjct: 3  RFFRRRKYCRFTAEGVREIDYKDLNTLKSYVTETGKIVPSRITGTRAKYQRQLASAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYTD 72


>gi|300721500|ref|YP_003710775.1| 30S ribosomal subunit protein S18 [Xenorhabdus nematophila ATCC
          19061]
 gi|297627992|emb|CBJ88541.1| 30S ribosomal subunit protein S18 [Xenorhabdus nematophila ATCC
          19061]
          Length = 75

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          R+L L+ Y +
Sbjct: 63 RHLSLLPYTD 72


>gi|148381563|ref|YP_001256104.1| ribosomal protein S18 [Clostridium botulinum A str. ATCC 3502]
 gi|153932032|ref|YP_001385940.1| 30S ribosomal protein S18 [Clostridium botulinum A str. ATCC
          19397]
 gi|153934477|ref|YP_001389347.1| 30S ribosomal protein S18 [Clostridium botulinum A str. Hall]
 gi|153939405|ref|YP_001392982.1| 30S ribosomal protein S18 [Clostridium botulinum F str.
          Langeland]
 gi|168181093|ref|ZP_02615757.1| ribosomal protein S18 [Clostridium botulinum NCTC 2916]
 gi|168183704|ref|ZP_02618368.1| 30S ribosomal protein S18 [Clostridium botulinum Bf]
 gi|170756238|ref|YP_001783261.1| 30S ribosomal protein S18 [Clostridium botulinum B1 str. Okra]
 gi|170759820|ref|YP_001788968.1| 30S ribosomal protein S18 [Clostridium botulinum A3 str. Loch
          Maree]
 gi|226951078|ref|YP_002806169.1| ribosomal protein S18 [Clostridium botulinum A2 str. Kyoto]
 gi|237797083|ref|YP_002864635.1| 30S ribosomal protein S18 [Clostridium botulinum Ba4 str. 657]
 gi|166220944|sp|A7FZG9|RS18_CLOB1 RecName: Full=30S ribosomal protein S18
 gi|166220945|sp|A5I7Z9|RS18_CLOBH RecName: Full=30S ribosomal protein S18
 gi|166220946|sp|A7GJM2|RS18_CLOBL RecName: Full=30S ribosomal protein S18
 gi|229559977|sp|B1IHQ2|RS18_CLOBK RecName: Full=30S ribosomal protein S18
 gi|229559978|sp|B1KU95|RS18_CLOBM RecName: Full=30S ribosomal protein S18
 gi|254765421|sp|C1FP14|RS18_CLOBJ RecName: Full=30S ribosomal protein S18
 gi|259494803|sp|C3KWH8|RS18_CLOB6 RecName: Full=30S ribosomal protein S18
 gi|148291047|emb|CAL85184.1| 30S ribosomal protein S18 [Clostridium botulinum A str. ATCC
          3502]
 gi|152928076|gb|ABS33576.1| 30S ribosomal protein S18 [Clostridium botulinum A str. ATCC
          19397]
 gi|152930391|gb|ABS35890.1| 30S ribosomal protein S18 [Clostridium botulinum A str. Hall]
 gi|152935301|gb|ABS40799.1| 30S ribosomal protein S18 [Clostridium botulinum F str.
          Langeland]
 gi|169121450|gb|ACA45286.1| 30S ribosomal protein S18 [Clostridium botulinum B1 str. Okra]
 gi|169406809|gb|ACA55220.1| 30S ribosomal protein S18 [Clostridium botulinum A3 str. Loch
          Maree]
 gi|182668122|gb|EDT80101.1| ribosomal protein S18 [Clostridium botulinum NCTC 2916]
 gi|182673233|gb|EDT85194.1| 30S ribosomal protein S18 [Clostridium botulinum Bf]
 gi|226841199|gb|ACO83865.1| ribosomal protein S18 [Clostridium botulinum A2 str. Kyoto]
 gi|229260880|gb|ACQ51913.1| 30S ribosomal protein S18 [Clostridium botulinum Ba4 str. 657]
 gi|295320957|gb|ADG01335.1| 30S ribosomal protein S18 [Clostridium botulinum F str. 230613]
 gi|322807950|emb|CBZ05525.1| SSU ribosomal protein S18p [Clostridium botulinum H04402 065]
          Length = 80

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/66 (46%), Positives = 43/66 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK C    + +  IDYKDI  L +F+++RGKI+P RIS    K QREL +AIKRAR + 
Sbjct: 14 KRKVCTFCAEKSEAIDYKDINKLRKFVTERGKILPRRISGNCAKHQRELTRAIKRARNIA 73

Query: 77 LIAYVN 82
          L+ +  
Sbjct: 74 LLPFTT 79


>gi|182416746|ref|ZP_02948143.1| ribosomal protein S18 [Clostridium butyricum 5521]
 gi|237669618|ref|ZP_04529596.1| ribosomal protein S18 [Clostridium butyricum E4 str. BoNT E
          BL5262]
 gi|182379403|gb|EDT76898.1| ribosomal protein S18 [Clostridium butyricum 5521]
 gi|237654852|gb|EEP52414.1| ribosomal protein S18 [Clostridium butyricum E4 str. BoNT E
          BL5262]
          Length = 85

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 42/71 (59%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    R+K C      A  IDYKDI  L +++++RGKI+P RIS    K QREL  +IKR
Sbjct: 14 RMRRSRKKVCAFCVDKAEFIDYKDINKLRKYVTERGKILPRRISGTCAKHQRELTTSIKR 73

Query: 72 ARYLGLIAYVN 82
          AR + L+ +  
Sbjct: 74 ARNIALLPFTT 84


>gi|54778771|gb|AAV39605.1| ribosomal protein S18 [synthetic construct]
          Length = 102

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/73 (47%), Positives = 47/73 (64%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          +      RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AI
Sbjct: 24 MTARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAI 83

Query: 70 KRARYLGLIAYVN 82
          KRARYL L+ Y +
Sbjct: 84 KRARYLSLLPYTD 96


>gi|126725407|ref|ZP_01741249.1| 30S ribosomal protein S18 [Rhodobacterales bacterium HTCC2150]
 gi|126704611|gb|EBA03702.1| 30S ribosomal protein S18 [Rhodobacterales bacterium HTCC2150]
          Length = 75

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/72 (62%), Positives = 55/72 (76%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP IDYKD R L R++S+RGKIVPSRI++VS KKQRELA+A
Sbjct: 1  MANKPFFRRRKVCPFSGDNAPAIDYKDTRTLQRYISERGKIVPSRITAVSAKKQRELARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|119383641|ref|YP_914697.1| 30S ribosomal protein S18 [Paracoccus denitrificans PD1222]
 gi|166220967|sp|A1B0F7|RS18_PARDP RecName: Full=30S ribosomal protein S18
 gi|119373408|gb|ABL69001.1| SSU ribosomal protein S18P [Paracoccus denitrificans PD1222]
          Length = 75

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/72 (63%), Positives = 56/72 (77%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA+A
Sbjct: 1  MANKPFFRRRKVCPFSGDNAPAIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|315122245|ref|YP_004062734.1| 30S ribosomal protein S18 [Candidatus Liberibacter solanacearum
          CLso-ZC1]
 gi|313495647|gb|ADR52246.1| 30S ribosomal protein S18 [Candidatus Liberibacter solanacearum
          CLso-ZC1]
          Length = 84

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 73/79 (92%), Positives = 76/79 (96%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          +P PLLRRN+SHRRKSCP SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVS KKQRE
Sbjct: 6  SPAPLLRRNMSHRRKSCPFSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSQKKQRE 65

Query: 65 LAKAIKRARYLGLIAYVNL 83
          LAKAIKRARYLGLIAYVN+
Sbjct: 66 LAKAIKRARYLGLIAYVNI 84


>gi|21231018|ref|NP_636935.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|58582038|ref|YP_201054.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae
          KACC10331]
 gi|66768977|ref|YP_243739.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|84623950|ref|YP_451322.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|166711573|ref|ZP_02242780.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzicola
          BLS256]
 gi|188576349|ref|YP_001913278.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188992091|ref|YP_001904101.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris
          str. B100]
 gi|289663137|ref|ZP_06484718.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. vasculorum
          NCPPB702]
 gi|289669573|ref|ZP_06490648.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. musacearum
          NCPPB4381]
 gi|325915473|ref|ZP_08177787.1| SSU ribosomal protein S18P [Xanthomonas vesicatoria ATCC 35937]
 gi|325917961|ref|ZP_08180130.1| SSU ribosomal protein S18P [Xanthomonas vesicatoria ATCC 35937]
 gi|325922527|ref|ZP_08184288.1| SSU ribosomal protein S18P [Xanthomonas gardneri ATCC 19865]
 gi|23822129|sp|Q8PAC1|RS18_XANCP RecName: Full=30S ribosomal protein S18
 gi|75508188|sp|Q5H052|RS18_XANOR RecName: Full=30S ribosomal protein S18
 gi|81305059|sp|Q4UTA4|RS18_XANC8 RecName: Full=30S ribosomal protein S18
 gi|123739106|sp|Q2P329|RS18_XANOM RecName: Full=30S ribosomal protein S18
 gi|229560081|sp|B0RUY8|RS18_XANCB RecName: Full=30S ribosomal protein S18
 gi|229560082|sp|B2SIV1|RS18_XANOP RecName: Full=30S ribosomal protein S18
 gi|21112642|gb|AAM40859.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|58426632|gb|AAW75669.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae
          KACC10331]
 gi|66574309|gb|AAY49719.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|84367890|dbj|BAE69048.1| 30S ribosomal protein S18 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|167733851|emb|CAP52057.1| 30S ribosomal protein S18 [Xanthomonas campestris pv. campestris]
 gi|188520801|gb|ACD58746.1| ribosomal protein S18 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|325535818|gb|EGD07645.1| SSU ribosomal protein S18P [Xanthomonas vesicatoria ATCC 35937]
 gi|325538355|gb|EGD10037.1| SSU ribosomal protein S18P [Xanthomonas vesicatoria ATCC 35937]
 gi|325546992|gb|EGD18085.1| SSU ribosomal protein S18P [Xanthomonas gardneri ATCC 19865]
          Length = 76

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 46/71 (64%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               RRK C  + +G   IDYKD+  L ++L++ GKIVPSR++    K QR+LA A+KR
Sbjct: 2  SKFFRRRKFCKFTAEGVKEIDYKDLNTLRQYLTENGKIVPSRVTGTKSKYQRQLATAVKR 61

Query: 72 ARYLGLIAYVN 82
          +R+L LI Y +
Sbjct: 62 SRFLALIPYTD 72


>gi|77463711|ref|YP_353215.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides 2.4.1]
 gi|126462540|ref|YP_001043654.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides ATCC 17029]
 gi|146277394|ref|YP_001167553.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides ATCC 17025]
 gi|332558562|ref|ZP_08412884.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides WS8N]
 gi|123591680|sp|Q3J1M0|RS18_RHOS4 RecName: Full=30S ribosomal protein S18
 gi|166220980|sp|A3PKL6|RS18_RHOS1 RecName: Full=30S ribosomal protein S18
 gi|166220981|sp|A4WS84|RS18_RHOS5 RecName: Full=30S ribosomal protein S18
 gi|77388129|gb|ABA79314.1| SSU ribosomal protein S18P [Rhodobacter sphaeroides 2.4.1]
 gi|126104204|gb|ABN76882.1| SSU ribosomal protein S18P [Rhodobacter sphaeroides ATCC 17029]
 gi|145555635|gb|ABP70248.1| SSU ribosomal protein S18P [Rhodobacter sphaeroides ATCC 17025]
 gi|332276274|gb|EGJ21589.1| 30S ribosomal protein S18 [Rhodobacter sphaeroides WS8N]
          Length = 75

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/72 (63%), Positives = 55/72 (76%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA A
Sbjct: 1  MANKPFFRRRKVCPFSGDNAPAIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELAAA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|227874245|ref|ZP_03992444.1| possible ribosomal protein S18 [Oribacterium sinus F0268]
 gi|227839914|gb|EEJ50345.1| possible ribosomal protein S18 [Oribacterium sinus F0268]
          Length = 90

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 3/82 (3%)

Query: 2  AEVAPTPLLRRN---VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVS 58
          ++ + +   RR       R+K C   G     +DYKD+  L +++S+RGKI+P RI+   
Sbjct: 6  SDKSGSARPRRAGAGFRSRKKVCGFCGDKVKPVDYKDVGTLRKYISERGKILPRRITGSC 65

Query: 59 HKKQRELAKAIKRARYLGLIAY 80
             QR +  AIKRAR++ L+ Y
Sbjct: 66 ALHQRAITTAIKRARHIALLPY 87


>gi|34499093|ref|NP_903308.1| 30S ribosomal protein S18 [Chromobacterium violaceum ATCC 12472]
 gi|59798832|sp|Q7NRY9|RS18_CHRVO RecName: Full=30S ribosomal protein S18
 gi|34104944|gb|AAQ61300.1| 30S ribosomal protein S18 [Chromobacterium violaceum ATCC 12472]
          Length = 75

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 46/73 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R +  R+K C  + +G   IDYK + LL  F+++ GKI+P+RI+    + QR+L  AI
Sbjct: 1  MARQLFKRKKFCRFTAEGIKEIDYKSVDLLKDFIAENGKIIPARITGTKARYQRQLTTAI 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L  + Y +
Sbjct: 61 KRARFLAFLPYTD 73


>gi|154503456|ref|ZP_02040516.1| hypothetical protein RUMGNA_01280 [Ruminococcus gnavus ATCC
          29149]
 gi|153795556|gb|EDN77976.1| hypothetical protein RUMGNA_01280 [Ruminococcus gnavus ATCC
          29149]
          Length = 90

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 44/72 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R     R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AI
Sbjct: 17 KRGPARRRKKVCVFCGKENNEIDYKDVAKLKKYVSERGKILPRRITGNCAKHQRALTVAI 76

Query: 70 KRARYLGLIAYV 81
          KRAR++ L+ YV
Sbjct: 77 KRARHIALMPYV 88


>gi|197302887|ref|ZP_03167939.1| hypothetical protein RUMLAC_01616 [Ruminococcus lactaris ATCC
          29176]
 gi|197298124|gb|EDY32672.1| hypothetical protein RUMLAC_01616 [Ruminococcus lactaris ATCC
          29176]
          Length = 88

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 45/72 (62%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R  V  R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AI
Sbjct: 15 RRGPVRRRKKVCVFCGKENNEIDYKDVAKLKKYVSERGKILPRRITGNCAKHQRALTVAI 74

Query: 70 KRARYLGLIAYV 81
          KRAR++ L+ YV
Sbjct: 75 KRARHISLMPYV 86


>gi|319405479|emb|CBI79098.1| 30S ribosomal protein S18 [Bartonella sp. AR 15-3]
          Length = 82

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++  TP  RR   HRRK+CP S   AP+IDYKDI+LL R++S+RGKI+PSRI++VS K
Sbjct: 1  MTDIHQTPT-RRPFHHRRKTCPFSSTNAPKIDYKDIKLLQRYISERGKIIPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA AIKRAR+LGL+ YV
Sbjct: 60 KQRELATAIKRARFLGLLPYV 80


>gi|83943160|ref|ZP_00955620.1| 30S ribosomal protein S18 [Sulfitobacter sp. EE-36]
 gi|83954295|ref|ZP_00963015.1| 30S ribosomal protein S18 [Sulfitobacter sp. NAS-14.1]
 gi|163746685|ref|ZP_02154042.1| 30S ribosomal protein S18 [Oceanibulbus indolifex HEL-45]
 gi|254486472|ref|ZP_05099677.1| ribosomal protein S18 [Roseobacter sp. GAI101]
 gi|83841332|gb|EAP80502.1| 30S ribosomal protein S18 [Sulfitobacter sp. NAS-14.1]
 gi|83846168|gb|EAP84045.1| 30S ribosomal protein S18 [Sulfitobacter sp. EE-36]
 gi|161379799|gb|EDQ04211.1| 30S ribosomal protein S18 [Oceanibulbus indolifex HEL-45]
 gi|214043341|gb|EEB83979.1| ribosomal protein S18 [Roseobacter sp. GAI101]
          Length = 75

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/72 (63%), Positives = 56/72 (77%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA+A
Sbjct: 1  MAAKPFFRRRKVCPFSGDNAPAIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|294677546|ref|YP_003578161.1| 30S ribosomal protein S18 [Rhodobacter capsulatus SB 1003]
 gi|6226085|sp|O68127|RS18_RHOCA RecName: Full=30S ribosomal protein S18
 gi|3128365|gb|AAC16217.1| 30S ribosomal protein S18 [Rhodobacter capsulatus SB 1003]
 gi|294476366|gb|ADE85754.1| 30S ribosomal protein S18 [Rhodobacter capsulatus SB 1003]
          Length = 75

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/72 (62%), Positives = 58/72 (80%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP+IDYKD+RLL R++S+RGKIVP+RI++VS KKQRELA+A
Sbjct: 1  MATKPFFRRRKVCPFSGDNAPKIDYKDVRLLQRYISERGKIVPARITAVSAKKQRELAQA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|323485447|ref|ZP_08090795.1| hypothetical protein HMPREF9474_02546 [Clostridium symbiosum
          WAL-14163]
 gi|323695065|ref|ZP_08109208.1| ribosomal protein S18 [Clostridium symbiosum WAL-14673]
 gi|323401310|gb|EGA93660.1| hypothetical protein HMPREF9474_02546 [Clostridium symbiosum
          WAL-14163]
 gi|323500867|gb|EGB16786.1| ribosomal protein S18 [Clostridium symbiosum WAL-14673]
          Length = 88

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C   G+    IDYKD+  L R++S+RGKI+P RI+    K QR L  AIKRAR++ L+ 
Sbjct: 25 VCVFCGEKNGVIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHIALMP 84

Query: 80 YV 81
          Y 
Sbjct: 85 YT 86


>gi|33357895|pdb|1P6G|R Chain R, Real Space Refined Coordinates Of The 30s Subunit Fitted
          Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
          State Of E. Coli 70s Ribosome
 gi|33357972|pdb|1P87|R Chain R, Real Space Refined Coordinates Of The 30s Subunit Fitted
          Into The Low Resolution Cryo-Em Map Of The
          Initiation-Like State Of E. Coli 70s Ribosome
 gi|83754056|pdb|2AVY|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 30s Subunit Of One 70s Ribosome. The
          Entire Crystal Structure Contains Two 70s Ribosomes And
          Is Described In Remark 400.
 gi|83754112|pdb|2AW7|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 30s Subunit Of The Second 70s Ribosome.
          The Entire Crystal Structure Contains Two 70s Ribosomes
          And Is Described In Remark 400.
 gi|118138070|pdb|2I2P|R Chain R, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|118138141|pdb|2I2U|R Chain R, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|157836038|pdb|2QOU|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 30s Subunit Of The First 70s
          Ribosome, With Spectinomycin Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|157836085|pdb|2QOW|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 30s Subunit Of The Second 70s
          Ribosome, With Spectinomycin Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|157836142|pdb|2QOY|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 30s Subunit Of The
          First 70s Ribosome, With Spectinomycin And Neomycin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|157836189|pdb|2QP0|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 30s Subunit Of The
          Second 70s Ribosome, With Spectinomycin And Neomycin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|158429715|pdb|2QAL|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 30s Subunit Of The First 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429767|pdb|2QAN|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 30s Subunit Of The Second 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429825|pdb|2QB9|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 30s Subunit Of The First 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429877|pdb|2QBB|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 30s Subunit Of The Second 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429929|pdb|2QBD|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 30s Subunit Of The
          First 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429981|pdb|2QBF|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 30s Subunit Of The
          Second 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158430035|pdb|2QBH|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The First 70s Ribosome, With Gentamicin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes And Is Described In Remark 400.
 gi|158430088|pdb|2QBJ|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The Second 70s Ribosome, With Gentamicin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes And Is Described In Remark 400.
 gi|158431388|pdb|2Z4K|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The First 70s Ribosome, With Paromomycin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes And Is Described In Remark 400.
 gi|158431441|pdb|2Z4M|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The Second 70s Ribosome, With
          Paromomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|168988805|pdb|2VHO|R Chain R, Structure Of Pdf Binding Helix In Complex With The
          Ribosome (Part 3 Of 4)
 gi|168988826|pdb|2VHP|R Chain R, Structure Of Pdf Binding Helix In Complex With The
          Ribosome (Part 4 Of 4)
 gi|197107295|pdb|3DF1|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 30s Subunit Of The First 70s
          Ribosome, With Hygromycin B Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|197107347|pdb|3DF3|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 30s Subunit Of The Second 70s
          Ribosome, With Hygromycin B Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|329666009|pdb|3J00|R Chain R, Structure Of The Ribosome-Secye Complex In The Membrane
          Environment
          Length = 74

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 2  RYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 61

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 62 RYLSLLPYTD 71


>gi|238021237|ref|ZP_04601663.1| hypothetical protein GCWU000324_01135 [Kingella oralis ATCC
          51147]
 gi|294669620|ref|ZP_06734687.1| hypothetical protein NEIELOOT_01521 [Neisseria elongata subsp.
          glycolytica ATCC 29315]
 gi|294788326|ref|ZP_06753569.1| ribosomal protein S18 [Simonsiella muelleri ATCC 29453]
 gi|325265837|ref|ZP_08132523.1| 50S ribosomal protein L21 [Kingella denitrificans ATCC 33394]
 gi|329119366|ref|ZP_08248052.1| 50S ribosomal protein L21 [Neisseria bacilliformis ATCC BAA-1200]
 gi|237868217|gb|EEP69223.1| hypothetical protein GCWU000324_01135 [Kingella oralis ATCC
          51147]
 gi|291308533|gb|EFE49776.1| hypothetical protein NEIELOOT_01521 [Neisseria elongata subsp.
          glycolytica ATCC 29315]
 gi|294483757|gb|EFG31441.1| ribosomal protein S18 [Simonsiella muelleri ATCC 29453]
 gi|324982475|gb|EGC18101.1| 50S ribosomal protein L21 [Kingella denitrificans ATCC 33394]
 gi|327464511|gb|EGF10810.1| 50S ribosomal protein L21 [Neisseria bacilliformis ATCC BAA-1200]
 gi|332970412|gb|EGK09404.1| 50S ribosomal protein L21 [Kingella kingae ATCC 23330]
          Length = 76

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 45/73 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK C  + +    +DYK + LL  F+++ GKI+P+RI+      QR+LA A+
Sbjct: 1  MARQTFKRRKFCRFTAEKIQEVDYKQVDLLKDFITENGKIIPARITGTKAHYQRQLAVAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|167755264|ref|ZP_02427391.1| hypothetical protein CLORAM_00769 [Clostridium ramosum DSM 1402]
 gi|237735012|ref|ZP_04565493.1| 30S ribosomal protein S18 [Mollicutes bacterium D7]
 gi|167705314|gb|EDS19893.1| hypothetical protein CLORAM_00769 [Clostridium ramosum DSM 1402]
 gi|229381788|gb|EEO31879.1| 30S ribosomal protein S18 [Coprobacillus sp. D7]
          Length = 76

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 44/72 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R+    R+K C  +      IDYKD+ LL RF+S  GKI+P R++  S K QR LA AI
Sbjct: 3  FRKQRMGRKKVCYFTKNKITYIDYKDVELLKRFVSANGKIIPRRVTGTSAKYQRMLATAI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 63 KRARQMALLPYV 74


>gi|23100932|ref|NP_694399.1| 30S ribosomal protein S18 [Oceanobacillus iheyensis HTE831]
 gi|59798907|sp|Q8EKV5|RS18_OCEIH RecName: Full=30S ribosomal protein S18
 gi|22779167|dbj|BAC15433.1| 30S ribosomal protein S18 [Oceanobacillus iheyensis HTE831]
          Length = 76

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/62 (51%), Positives = 42/62 (67%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +  G   IDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR + L+ 
Sbjct: 13 VCYFTANGITHIDYKDVDLLRRFISERGKILPRRVTGTSAKYQRKLTIAIKRARTMALLP 72

Query: 80 YV 81
          YV
Sbjct: 73 YV 74


>gi|94677019|ref|YP_589000.1| ribosomal protein S18 [Baumannia cicadellinicola str. Hc
          (Homalodisca coagulata)]
 gi|122988100|sp|Q1LSR4|RS18_BAUCH RecName: Full=30S ribosomal protein S18
 gi|94220169|gb|ABF14328.1| ribosomal protein S18 [Baumannia cicadellinicola str. Hc
          (Homalodisca coagulata)]
          Length = 75

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 46/71 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEDVIEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVNL 83
          RYL L+ Y +L
Sbjct: 63 RYLSLLPYTDL 73


>gi|289449911|ref|YP_003475641.1| 30S ribosomal protein S18 [Clostridiales genomosp. BVAB3 str.
          UPII9-5]
 gi|289184458|gb|ADC90883.1| ribosomal protein S18 [Clostridiales genomosp. BVAB3 str.
          UPII9-5]
          Length = 90

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 40/63 (63%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD+  L +F+S+RGKI+P R+S    K QREL  AIKRAR+L L+
Sbjct: 25 KVCNFCADHIETIDYKDVVRLRKFVSERGKILPKRMSGTCAKHQRELTIAIKRARHLALL 84

Query: 79 AYV 81
           ++
Sbjct: 85 PFI 87


>gi|225075138|ref|ZP_03718337.1| hypothetical protein NEIFLAOT_00138 [Neisseria flavescens
          NRL30031/H210]
 gi|241760281|ref|ZP_04758376.1| ribosomal protein S18 [Neisseria flavescens SK114]
 gi|261365214|ref|ZP_05978097.1| ribosomal protein S18 [Neisseria mucosa ATCC 25996]
 gi|261379686|ref|ZP_05984259.1| ribosomal protein S18 [Neisseria subflava NJ9703]
 gi|298368603|ref|ZP_06979921.1| ribosomal protein S18 [Neisseria sp. oral taxon 014 str. F0314]
 gi|319637637|ref|ZP_07992403.1| 30S ribosomal protein S18 [Neisseria mucosa C102]
 gi|224953622|gb|EEG34831.1| hypothetical protein NEIFLAOT_00138 [Neisseria flavescens
          NRL30031/H210]
 gi|241319159|gb|EER55637.1| ribosomal protein S18 [Neisseria flavescens SK114]
 gi|284797348|gb|EFC52695.1| ribosomal protein S18 [Neisseria subflava NJ9703]
 gi|288566476|gb|EFC88036.1| ribosomal protein S18 [Neisseria mucosa ATCC 25996]
 gi|298282606|gb|EFI24093.1| ribosomal protein S18 [Neisseria sp. oral taxon 014 str. F0314]
 gi|317400792|gb|EFV81447.1| 30S ribosomal protein S18 [Neisseria mucosa C102]
          Length = 76

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK C  + +    +DYK + LL  F+S+ GKI+P+RI+      QR+LA A+
Sbjct: 1  MARQSFKRRKFCRFTAEKIQEVDYKQVDLLKDFISENGKIIPARITGTKAHYQRQLATAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|50122532|ref|YP_051699.1| 30S ribosomal protein S18 [Pectobacterium atrosepticum SCRI1043]
 gi|227112366|ref|ZP_03826022.1| 30S ribosomal protein S18 [Pectobacterium carotovorum subsp.
          brasiliensis PBR1692]
 gi|253689795|ref|YP_003018985.1| ribosomal protein S18 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|261822827|ref|YP_003260933.1| 30S ribosomal protein S18 [Pectobacterium wasabiae WPP163]
 gi|59798691|sp|Q6D137|RS18_ERWCT RecName: Full=30S ribosomal protein S18
 gi|259494815|sp|C6DE13|RS18_PECCP RecName: Full=30S ribosomal protein S18
 gi|49613058|emb|CAG76509.1| 30S ribosomal protein S18 [Pectobacterium atrosepticum SCRI1043]
 gi|251756373|gb|ACT14449.1| ribosomal protein S18 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|261606840|gb|ACX89326.1| ribosomal protein S18 [Pectobacterium wasabiae WPP163]
          Length = 75

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|50085516|ref|YP_047026.1| 30S ribosomal protein S18 [Acinetobacter sp. ADP1]
 gi|255319499|ref|ZP_05360713.1| ribosomal protein S18 [Acinetobacter radioresistens SK82]
 gi|262378477|ref|ZP_06071634.1| ribosomal protein S18 [Acinetobacter radioresistens SH164]
 gi|59798698|sp|Q6F9Q9|RS18_ACIAD RecName: Full=30S ribosomal protein S18
 gi|49531492|emb|CAG69204.1| 30S ribosomal protein S18 [Acinetobacter sp. ADP1]
 gi|255303439|gb|EET82642.1| ribosomal protein S18 [Acinetobacter radioresistens SK82]
 gi|262299762|gb|EEY87674.1| ribosomal protein S18 [Acinetobacter radioresistens SH164]
          Length = 75

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI  L +++++ GKIVPSRI+    + QR+LA AIK+A
Sbjct: 3  RFYRRRKFCRFTAENVAYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQA 62

Query: 73 RYLGLIAYVN 82
          RYL LI Y +
Sbjct: 63 RYLALIPYTD 72


>gi|325981281|ref|YP_004293683.1| 30S ribosomal protein S18 [Nitrosomonas sp. AL212]
 gi|325530800|gb|ADZ25521.1| ribosomal protein S18 [Nitrosomonas sp. AL212]
          Length = 94

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 48/71 (67%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  R+K C  + +G  ++DYKDI +L  F+S+ GK++P+RI+  +   QR+L  AI+R
Sbjct: 22 RPLFKRKKFCRFTAEGIKQVDYKDIEILKDFISENGKVIPARITGTTSFYQRQLGTAIER 81

Query: 72 ARYLGLIAYVN 82
          AR+L L+ Y +
Sbjct: 82 ARFLALLPYTD 92


>gi|13476509|ref|NP_108079.1| 30S ribosomal protein S18 [Mesorhizobium loti MAFF303099]
 gi|260466964|ref|ZP_05813146.1| ribosomal protein S18 [Mesorhizobium opportunistum WSM2075]
 gi|319784439|ref|YP_004143915.1| ribosomal protein S18 [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|20978722|sp|Q984T9|RS18_RHILO RecName: Full=30S ribosomal protein S18
 gi|14027270|dbj|BAB54224.1| 30S ribosomal protein S18 [Mesorhizobium loti MAFF303099]
 gi|259029261|gb|EEW30555.1| ribosomal protein S18 [Mesorhizobium opportunistum WSM2075]
 gi|317170327|gb|ADV13865.1| ribosomal protein S18 [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 82

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|226941616|ref|YP_002796690.1| 30S ribosomal protein S18 [Laribacter hongkongensis HLHK9]
 gi|254812944|sp|C1DCR2|RS18_LARHH RecName: Full=30S ribosomal protein S18
 gi|226716543|gb|ACO75681.1| RpsR [Laribacter hongkongensis HLHK9]
          Length = 75

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 48/73 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R +  RRK C  + +G   +DYK + LL  F+++ GKI+P+RI+    + QR+L+ AI
Sbjct: 1  MARQLFKRRKFCRFTAEGIKEVDYKAVDLLKDFIAENGKIIPARITGTKARYQRQLSTAI 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALMPYTD 73


>gi|186475678|ref|YP_001857148.1| 30S ribosomal protein S18 [Burkholderia phymatum STM815]
 gi|229559972|sp|B2JG20|RS18_BURP8 RecName: Full=30S ribosomal protein S18
 gi|184192137|gb|ACC70102.1| ribosomal protein S18 [Burkholderia phymatum STM815]
          Length = 91

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 44/80 (55%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +       +  +  R+K C  +  G  +IDYKDI  L  F+ + GKI P+R++      Q
Sbjct: 8  KFDKRRQQQNPLFKRKKFCRFTAAGVEQIDYKDIDTLKDFIGENGKITPARLTGTKAHYQ 67

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 68 RQLDTAIKRARFLALMPYTD 87


>gi|291548589|emb|CBL24851.1| SSU ribosomal protein S18P [Ruminococcus torques L2-14]
          Length = 88

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 44/72 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R     R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AI
Sbjct: 15 RRGPARRRKKVCVFCGKENNEIDYKDVAKLKKYVSERGKILPRRITGNCAKHQRALTVAI 74

Query: 70 KRARYLGLIAYV 81
          KRAR++ L+ YV
Sbjct: 75 KRARHISLMPYV 86


>gi|28199811|ref|NP_780125.1| 30S ribosomal protein S18 [Xylella fastidiosa Temecula1]
 gi|71275195|ref|ZP_00651482.1| Ribosomal protein S18 [Xylella fastidiosa Dixon]
 gi|71898275|ref|ZP_00680449.1| Ribosomal protein S18 [Xylella fastidiosa Ann-1]
 gi|71899833|ref|ZP_00681983.1| Ribosomal protein S18 [Xylella fastidiosa Ann-1]
 gi|170731186|ref|YP_001776619.1| 30S ribosomal protein S18 [Xylella fastidiosa M12]
 gi|182682563|ref|YP_001830723.1| 30S ribosomal protein S18 [Xylella fastidiosa M23]
 gi|32129999|sp|Q87A84|RS18_XYLFT RecName: Full=30S ribosomal protein S18
 gi|229560083|sp|B2I9S8|RS18_XYLF2 RecName: Full=30S ribosomal protein S18
 gi|229560084|sp|B0U5H1|RS18_XYLFM RecName: Full=30S ribosomal protein S18
 gi|28057932|gb|AAO29774.1| 30S ribosomal protein S18 [Xylella fastidiosa Temecula1]
 gi|71164004|gb|EAO13719.1| Ribosomal protein S18 [Xylella fastidiosa Dixon]
 gi|71730424|gb|EAO32505.1| Ribosomal protein S18 [Xylella fastidiosa Ann-1]
 gi|71732014|gb|EAO34071.1| Ribosomal protein S18 [Xylella fastidiosa Ann-1]
 gi|167965979|gb|ACA12989.1| 30S ribosomal protein S18 [Xylella fastidiosa M12]
 gi|182632673|gb|ACB93449.1| ribosomal protein S18 [Xylella fastidiosa M23]
 gi|307578843|gb|ADN62812.1| 30S ribosomal protein S18 [Xylella fastidiosa subsp. fastidiosa
          GB514]
          Length = 76

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 44/71 (61%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               RRK C  + +G   IDYKD+  L ++L++ G+IVPSR++    K QR+L  A+K 
Sbjct: 2  SKFFRRRKFCKFTAEGIKEIDYKDLNTLRQYLTENGRIVPSRVTGTKSKYQRQLTTAVKL 61

Query: 72 ARYLGLIAYVN 82
          AR+L LI Y +
Sbjct: 62 ARFLALIPYTD 72


>gi|227824505|ref|ZP_03989337.1| 30S ribosomal protein S18 [Acidaminococcus sp. D21]
 gi|226905004|gb|EEH90922.1| 30S ribosomal protein S18 [Acidaminococcus sp. D21]
          Length = 79

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 38/63 (60%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD+  L +F+++RGKI+P RI+    K QR+L  AIKRAR + L+
Sbjct: 15 KVCSFCVDKVEEIDYKDVAKLRKFITERGKILPRRITGTCAKHQRQLTIAIKRARNVALL 74

Query: 79 AYV 81
           + 
Sbjct: 75 PFT 77


>gi|160940069|ref|ZP_02087414.1| hypothetical protein CLOBOL_04958 [Clostridium bolteae ATCC
          BAA-613]
 gi|239624860|ref|ZP_04667891.1| ribosomal protein S18 [Clostridiales bacterium 1_7_47_FAA]
 gi|158436649|gb|EDP14416.1| hypothetical protein CLOBOL_04958 [Clostridium bolteae ATCC
          BAA-613]
 gi|239521246|gb|EEQ61112.1| ribosomal protein S18 [Clostridiales bacterium 1_7_47FAA]
          Length = 89

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/64 (46%), Positives = 40/64 (62%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C   G     IDYKD+  L R++S+RGKI+P RI+    K QR L  AIKRAR++ L
Sbjct: 24 KKVCVFCGDKNGTIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHIAL 83

Query: 78 IAYV 81
          + Y 
Sbjct: 84 MPYT 87


>gi|328954270|ref|YP_004371604.1| 30S ribosomal protein S18 [Desulfobacca acetoxidans DSM 11109]
 gi|328454594|gb|AEB10423.1| 30S ribosomal protein S18 [Desulfobacca acetoxidans DSM 11109]
          Length = 85

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 44/73 (60%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
             RR + HRRK C         ID+KD+  L  F+++RGKI+P RIS    + QR++  
Sbjct: 6  KRKRRPIFHRRKVCRFCVDSKLVIDHKDVNTLRHFITERGKIIPRRISGNCARHQRKVTL 65

Query: 68 AIKRARYLGLIAY 80
          AIKRAR+L L+ Y
Sbjct: 66 AIKRARHLALMPY 78


>gi|330839912|ref|YP_004414492.1| 30S ribosomal protein S18 [Selenomonas sputigena ATCC 35185]
 gi|329747676|gb|AEC01033.1| 30S ribosomal protein S18 [Selenomonas sputigena ATCC 35185]
          Length = 77

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 38/63 (60%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD+  L RF+++RGKI+P RIS    K QR++  AIKRAR + L+
Sbjct: 13 KVCTFCVDKVDVIDYKDVAKLRRFITERGKILPRRISGNCAKHQRQVTLAIKRARNIALL 72

Query: 79 AYV 81
           + 
Sbjct: 73 PFT 75


>gi|299820814|ref|ZP_07052703.1| 30S ribosomal protein S18 [Listeria grayi DSM 20601]
 gi|299817835|gb|EFI85070.1| 30S ribosomal protein S18 [Listeria grayi DSM 20601]
          Length = 79

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/64 (46%), Positives = 44/64 (68%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKR+R + L
Sbjct: 12 KKVCYFTANGITHIDYKDVELLKKFVSERGKILPRRVTGTSAKYQRKLTVAIKRSRQMAL 71

Query: 78 IAYV 81
          + +V
Sbjct: 72 LPFV 75


>gi|298372706|ref|ZP_06982696.1| ribosomal protein S18 [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275610|gb|EFI17161.1| ribosomal protein S18 [Bacteroidetes oral taxon 274 str. F0058]
          Length = 93

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 46/69 (66%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
            +R+K C     G   IDYKD   L +FL+++GKI+P RI+  S K QR++A+A+KRAR
Sbjct: 21 DKNRKKYCRFKKSGIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRKVAQAVKRAR 80

Query: 74 YLGLIAYVN 82
          +L L+ YV 
Sbjct: 81 HLALLPYVT 89


>gi|323526189|ref|YP_004228342.1| 30S ribosomal protein S18 [Burkholderia sp. CCGE1001]
 gi|323383191|gb|ADX55282.1| ribosomal protein S18 [Burkholderia sp. CCGE1001]
          Length = 91

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 43/80 (53%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +       +  +  R+K C  +  G   IDYKDI  L  F+ + GKI P+R++      Q
Sbjct: 8  KFDKRRQQQNPLFKRKKFCRFTAAGVEYIDYKDIETLKDFIGENGKITPARLTGTKAHYQ 67

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 68 RQLDTAIKRARFLALVPYTD 87


>gi|162455220|ref|YP_001617587.1| hypothetical protein sce6938 [Sorangium cellulosum 'So ce 56']
 gi|205617507|sp|A9GXK6|RS18_SORC5 RecName: Full=30S ribosomal protein S18
 gi|161165802|emb|CAN97107.1| rpsR [Sorangium cellulosum 'So ce 56']
          Length = 106

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 42/70 (60%)

Query: 12  RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
           R  + R++ C      A  IDYKD + L  F+S+RGK+VP RIS    + QR++  +IKR
Sbjct: 34  RRRTGRKRVCRYCADKALVIDYKDPQALKYFISERGKVVPRRISGNCARHQRKVTLSIKR 93

Query: 72  ARYLGLIAYV 81
           AR + L+ + 
Sbjct: 94  ARNIALLPFT 103


>gi|94263201|ref|ZP_01287018.1| Ribosomal protein S18 [delta proteobacterium MLMS-1]
 gi|94270367|ref|ZP_01291725.1| Ribosomal protein S18 [delta proteobacterium MLMS-1]
 gi|93450833|gb|EAT01866.1| Ribosomal protein S18 [delta proteobacterium MLMS-1]
 gi|93456419|gb|EAT06539.1| Ribosomal protein S18 [delta proteobacterium MLMS-1]
          Length = 78

 Score = 98.9 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 44/72 (61%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + R+    RRK C      +  IDYKDI+ L  FL++RGKI+P RI     + QR+L +A
Sbjct: 1  MQRKKFFGRRKVCRFCADKSLVIDYKDIKNLRGFLTERGKIIPRRIYGNCARHQRQLCEA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR + L+ Y
Sbjct: 61 IKRARQIALLPY 72


>gi|110634267|ref|YP_674475.1| 30S ribosomal protein S18 [Mesorhizobium sp. BNC1]
 gi|122965901|sp|Q11H15|RS18_MESSB RecName: Full=30S ribosomal protein S18
 gi|110285251|gb|ABG63310.1| SSU ribosomal protein S18P [Chelativorans sp. BNC1]
          Length = 82

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    RRK+CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRRKTCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA+AIKRAR+LGL+ YV
Sbjct: 60 KQRELARAIKRARFLGLLPYV 80


>gi|73663680|ref|YP_302461.1| 30S ribosomal protein S18 [Staphylococcus saprophyticus subsp.
          saprophyticus ATCC 15305]
 gi|123747836|sp|Q49UQ2|RS18_STAS1 RecName: Full=30S ribosomal protein S18
 gi|72496195|dbj|BAE19516.1| 30S ribosomal protein S18 [Staphylococcus saprophyticus subsp.
          saprophyticus ATCC 15305]
          Length = 80

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKR+R++ L
Sbjct: 13 KKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTLAIKRSRHMAL 72

Query: 78 IAYV 81
          + YV
Sbjct: 73 LPYV 76


>gi|17987764|ref|NP_540398.1| 30S ribosomal protein S18 [Brucella melitensis bv. 1 str. 16M]
 gi|23501355|ref|NP_697482.1| 30S ribosomal protein S18 [Brucella suis 1330]
 gi|62289439|ref|YP_221232.1| 30S ribosomal protein S18 [Brucella abortus bv. 1 str. 9-941]
 gi|82699365|ref|YP_413939.1| 30S ribosomal protein S18 [Brucella melitensis biovar Abortus
          2308]
 gi|148560401|ref|YP_001258473.1| 30S ribosomal protein S18 [Brucella ovis ATCC 25840]
 gi|161618425|ref|YP_001592312.1| 30S ribosomal protein S18 [Brucella canis ATCC 23365]
 gi|189023689|ref|YP_001934457.1| 30S ribosomal protein S18 [Brucella abortus S19]
 gi|225626962|ref|ZP_03785001.1| ribosomal protein S18 [Brucella ceti str. Cudo]
 gi|225851990|ref|YP_002732223.1| 30S ribosomal protein S18 [Brucella melitensis ATCC 23457]
 gi|237814927|ref|ZP_04593925.1| ribosomal protein S18 [Brucella abortus str. 2308 A]
 gi|254688751|ref|ZP_05152005.1| 30S ribosomal protein S18 [Brucella abortus bv. 6 str. 870]
 gi|254693234|ref|ZP_05155062.1| 30S ribosomal protein S18 [Brucella abortus bv. 3 str. Tulya]
 gi|254696880|ref|ZP_05158708.1| 30S ribosomal protein S18 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701258|ref|ZP_05163086.1| 30S ribosomal protein S18 [Brucella suis bv. 5 str. 513]
 gi|254703805|ref|ZP_05165633.1| 30S ribosomal protein S18 [Brucella suis bv. 3 str. 686]
 gi|254707817|ref|ZP_05169645.1| 30S ribosomal protein S18 [Brucella pinnipedialis M163/99/10]
 gi|254709601|ref|ZP_05171412.1| 30S ribosomal protein S18 [Brucella pinnipedialis B2/94]
 gi|254712983|ref|ZP_05174794.1| 30S ribosomal protein S18 [Brucella ceti M644/93/1]
 gi|254716663|ref|ZP_05178474.1| 30S ribosomal protein S18 [Brucella ceti M13/05/1]
 gi|254718630|ref|ZP_05180441.1| 30S ribosomal protein S18 [Brucella sp. 83/13]
 gi|254729784|ref|ZP_05188362.1| 30S ribosomal protein S18 [Brucella abortus bv. 4 str. 292]
 gi|256031093|ref|ZP_05444707.1| 30S ribosomal protein S18 [Brucella pinnipedialis M292/94/1]
 gi|256044170|ref|ZP_05447077.1| 30S ribosomal protein S18 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060587|ref|ZP_05450755.1| 30S ribosomal protein S18 [Brucella neotomae 5K33]
 gi|256112978|ref|ZP_05453881.1| 30S ribosomal protein S18 [Brucella melitensis bv. 3 str. Ether]
 gi|256159166|ref|ZP_05456979.1| 30S ribosomal protein S18 [Brucella ceti M490/95/1]
 gi|256254496|ref|ZP_05460032.1| 30S ribosomal protein S18 [Brucella ceti B1/94]
 gi|256256998|ref|ZP_05462534.1| 30S ribosomal protein S18 [Brucella abortus bv. 9 str. C68]
 gi|256264503|ref|ZP_05467035.1| predicted protein [Brucella melitensis bv. 2 str. 63/9]
 gi|256368907|ref|YP_003106413.1| 30S ribosomal protein S18 [Brucella microti CCM 4915]
 gi|260168224|ref|ZP_05755035.1| 30S ribosomal protein S18 [Brucella sp. F5/99]
 gi|260545810|ref|ZP_05821551.1| predicted protein [Brucella abortus NCTC 8038]
 gi|260563528|ref|ZP_05834014.1| predicted protein [Brucella melitensis bv. 1 str. 16M]
 gi|260566942|ref|ZP_05837412.1| predicted protein [Brucella suis bv. 4 str. 40]
 gi|260754230|ref|ZP_05866578.1| SSU ribosomal protein S18P [Brucella abortus bv. 6 str. 870]
 gi|260757450|ref|ZP_05869798.1| SSU ribosomal protein S18P [Brucella abortus bv. 4 str. 292]
 gi|260761275|ref|ZP_05873618.1| SSU ribosomal protein S18P [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883256|ref|ZP_05894870.1| SSU ribosomal protein S18P [Brucella abortus bv. 9 str. C68]
 gi|261213477|ref|ZP_05927758.1| SSU ribosomal protein S18P [Brucella abortus bv. 3 str. Tulya]
 gi|261218464|ref|ZP_05932745.1| SSU ribosomal protein S18P [Brucella ceti M13/05/1]
 gi|261221670|ref|ZP_05935951.1| SSU ribosomal protein S18P [Brucella ceti B1/94]
 gi|261315304|ref|ZP_05954501.1| SSU ribosomal protein S18P [Brucella pinnipedialis M163/99/10]
 gi|261317129|ref|ZP_05956326.1| SSU ribosomal protein S18P [Brucella pinnipedialis B2/94]
 gi|261320686|ref|ZP_05959883.1| SSU ribosomal protein S18P [Brucella ceti M644/93/1]
 gi|261324583|ref|ZP_05963780.1| SSU ribosomal protein S18P [Brucella neotomae 5K33]
 gi|261751797|ref|ZP_05995506.1| SSU ribosomal protein S18P [Brucella suis bv. 5 str. 513]
 gi|261754452|ref|ZP_05998161.1| SSU ribosomal protein S18P [Brucella suis bv. 3 str. 686]
 gi|261757685|ref|ZP_06001394.1| predicted protein [Brucella sp. F5/99]
 gi|265983609|ref|ZP_06096344.1| SSU ribosomal protein S18P [Brucella sp. 83/13]
 gi|265988167|ref|ZP_06100724.1| SSU ribosomal protein S18P [Brucella pinnipedialis M292/94/1]
 gi|265990583|ref|ZP_06103140.1| SSU ribosomal protein S18P [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994413|ref|ZP_06106970.1| SSU ribosomal protein S18P [Brucella melitensis bv. 3 str. Ether]
 gi|265997633|ref|ZP_06110190.1| SSU ribosomal protein S18P [Brucella ceti M490/95/1]
 gi|297247851|ref|ZP_06931569.1| 30S ribosomal protein S18 [Brucella abortus bv. 5 str. B3196]
 gi|306839850|ref|ZP_07472648.1| ribosomal protein S18 [Brucella sp. NF 2653]
 gi|306842261|ref|ZP_07474924.1| ribosomal protein S18 [Brucella sp. BO2]
 gi|306845083|ref|ZP_07477663.1| ribosomal protein S18 [Brucella sp. BO1]
 gi|54039409|sp|P66454|RS18_BRUSU RecName: Full=30S ribosomal protein S18
 gi|54042144|sp|P66453|RS18_BRUME RecName: Full=30S ribosomal protein S18
 gi|75505331|sp|Q57ER3|RS18_BRUAB RecName: Full=30S ribosomal protein S18
 gi|123740899|sp|Q2YMH0|RS18_BRUA2 RecName: Full=30S ribosomal protein S18
 gi|166220928|sp|A5VP26|RS18_BRUO2 RecName: Full=30S ribosomal protein S18
 gi|189029650|sp|A9M8X7|RS18_BRUC2 RecName: Full=30S ribosomal protein S18
 gi|229559967|sp|B2S9V3|RS18_BRUA1 RecName: Full=30S ribosomal protein S18
 gi|254765414|sp|C0RHG1|RS18_BRUMB RecName: Full=30S ribosomal protein S18
 gi|17983486|gb|AAL52662.1| ssu ribosomal protein s18p [Brucella melitensis bv. 1 str. 16M]
 gi|23347248|gb|AAN29397.1| ribosomal protein S18 [Brucella suis 1330]
 gi|62195571|gb|AAX73871.1| RpsR, ribosomal protein s18 [Brucella abortus bv. 1 str. 9-941]
 gi|82615466|emb|CAJ10435.1| Ribosomal protein S18 [Brucella melitensis biovar Abortus 2308]
 gi|148371658|gb|ABQ61637.1| ribosomal protein S18 [Brucella ovis ATCC 25840]
 gi|161335236|gb|ABX61541.1| ribosomal protein S18 [Brucella canis ATCC 23365]
 gi|189019261|gb|ACD71983.1| Ribosomal protein S18 [Brucella abortus S19]
 gi|225618619|gb|EEH15662.1| ribosomal protein S18 [Brucella ceti str. Cudo]
 gi|225640355|gb|ACO00269.1| ribosomal protein S18 [Brucella melitensis ATCC 23457]
 gi|237789764|gb|EEP63974.1| ribosomal protein S18 [Brucella abortus str. 2308 A]
 gi|255999065|gb|ACU47464.1| 30S ribosomal protein S18 [Brucella microti CCM 4915]
 gi|260097217|gb|EEW81092.1| predicted protein [Brucella abortus NCTC 8038]
 gi|260153544|gb|EEW88636.1| predicted protein [Brucella melitensis bv. 1 str. 16M]
 gi|260156460|gb|EEW91540.1| predicted protein [Brucella suis bv. 4 str. 40]
 gi|260667768|gb|EEX54708.1| SSU ribosomal protein S18P [Brucella abortus bv. 4 str. 292]
 gi|260671707|gb|EEX58528.1| SSU ribosomal protein S18P [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674338|gb|EEX61159.1| SSU ribosomal protein S18P [Brucella abortus bv. 6 str. 870]
 gi|260872784|gb|EEX79853.1| SSU ribosomal protein S18P [Brucella abortus bv. 9 str. C68]
 gi|260915084|gb|EEX81945.1| SSU ribosomal protein S18P [Brucella abortus bv. 3 str. Tulya]
 gi|260920254|gb|EEX86907.1| SSU ribosomal protein S18P [Brucella ceti B1/94]
 gi|260923553|gb|EEX90121.1| SSU ribosomal protein S18P [Brucella ceti M13/05/1]
 gi|261293376|gb|EEX96872.1| SSU ribosomal protein S18P [Brucella ceti M644/93/1]
 gi|261296352|gb|EEX99848.1| SSU ribosomal protein S18P [Brucella pinnipedialis B2/94]
 gi|261300563|gb|EEY04060.1| SSU ribosomal protein S18P [Brucella neotomae 5K33]
 gi|261304330|gb|EEY07827.1| SSU ribosomal protein S18P [Brucella pinnipedialis M163/99/10]
 gi|261737669|gb|EEY25665.1| predicted protein [Brucella sp. F5/99]
 gi|261741550|gb|EEY29476.1| SSU ribosomal protein S18P [Brucella suis bv. 5 str. 513]
 gi|261744205|gb|EEY32131.1| SSU ribosomal protein S18P [Brucella suis bv. 3 str. 686]
 gi|262552101|gb|EEZ08091.1| SSU ribosomal protein S18P [Brucella ceti M490/95/1]
 gi|262765526|gb|EEZ11315.1| SSU ribosomal protein S18P [Brucella melitensis bv. 3 str. Ether]
 gi|263001367|gb|EEZ13942.1| SSU ribosomal protein S18P [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094836|gb|EEZ18574.1| predicted protein [Brucella melitensis bv. 2 str. 63/9]
 gi|264660364|gb|EEZ30625.1| SSU ribosomal protein S18P [Brucella pinnipedialis M292/94/1]
 gi|264662201|gb|EEZ32462.1| SSU ribosomal protein S18P [Brucella sp. 83/13]
 gi|297175020|gb|EFH34367.1| 30S ribosomal protein S18 [Brucella abortus bv. 5 str. B3196]
 gi|306274498|gb|EFM56293.1| ribosomal protein S18 [Brucella sp. BO1]
 gi|306287641|gb|EFM59088.1| ribosomal protein S18 [Brucella sp. BO2]
 gi|306405036|gb|EFM61317.1| ribosomal protein S18 [Brucella sp. NF 2653]
 gi|326408486|gb|ADZ65551.1| Ribosomal protein S18 [Brucella melitensis M28]
 gi|326538202|gb|ADZ86417.1| ribosomal protein S18 [Brucella melitensis M5-90]
          Length = 82

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    RRK+CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRRKTCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|225386697|ref|ZP_03756461.1| hypothetical protein CLOSTASPAR_00445 [Clostridium asparagiforme
          DSM 15981]
 gi|225047224|gb|EEG57470.1| hypothetical protein CLOSTASPAR_00445 [Clostridium asparagiforme
          DSM 15981]
          Length = 89

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/64 (46%), Positives = 40/64 (62%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C   G     IDYKD+  L R++S+RGKI+P RI+    K QR L  AIKRAR++ L
Sbjct: 24 KKVCVFCGDKNGTIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHIAL 83

Query: 78 IAYV 81
          + Y 
Sbjct: 84 MPYT 87


>gi|15834432|ref|NP_313205.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 str. Sakai]
 gi|16132024|ref|NP_418623.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K-12
          substr. MG1655]
 gi|16763210|ref|NP_458827.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. CT18]
 gi|24115555|ref|NP_710065.1| 30S ribosomal protein S18 [Shigella flexneri 2a str. 301]
 gi|26251099|ref|NP_757139.1| 30S ribosomal protein S18 [Escherichia coli CFT073]
 gi|29144689|ref|NP_808031.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. Ty2]
 gi|30065573|ref|NP_839744.1| 30S ribosomal protein S18 [Shigella flexneri 2a str. 2457T]
 gi|37528390|ref|NP_931735.1| 30S ribosomal protein S18 [Photorhabdus luminescens subsp.
          laumondii TTO1]
 gi|56416184|ref|YP_153259.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. ATCC 9150]
 gi|62182837|ref|YP_219254.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|74314683|ref|YP_313102.1| 30S ribosomal protein S18 [Shigella sonnei Ss046]
 gi|82546556|ref|YP_410503.1| 30S ribosomal protein S18 [Shigella boydii Sb227]
 gi|82779400|ref|YP_405749.1| 30S ribosomal protein S18 [Shigella dysenteriae Sd197]
 gi|89110922|ref|AP_004702.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K-12
          substr. W3110]
 gi|91213751|ref|YP_543737.1| 30S ribosomal protein S18 [Escherichia coli UTI89]
 gi|110644559|ref|YP_672289.1| 30S ribosomal protein S18 [Escherichia coli 536]
 gi|110808116|ref|YP_691636.1| 30S ribosomal protein S18 [Shigella flexneri 5 str. 8401]
 gi|146310038|ref|YP_001175112.1| 30S ribosomal protein S18 [Enterobacter sp. 638]
 gi|152973068|ref|YP_001338214.1| 30S ribosomal protein S18 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|156932423|ref|YP_001436339.1| 30S ribosomal protein S18 [Cronobacter sakazakii ATCC BAA-894]
 gi|157147826|ref|YP_001455145.1| 30S ribosomal protein S18 [Citrobacter koseri ATCC BAA-895]
 gi|157158640|ref|YP_001465702.1| 30S ribosomal protein S18 [Escherichia coli E24377A]
 gi|157163667|ref|YP_001460985.1| 30S ribosomal protein S18 [Escherichia coli HS]
 gi|161505105|ref|YP_001572217.1| 30S ribosomal protein S18 [Salmonella enterica subsp. arizonae
          serovar 62:z4,z23:-- str. RSK2980]
 gi|161617665|ref|YP_001591630.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Paratyphi B str. SPB7]
 gi|168263253|ref|ZP_02685226.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
 gi|168464722|ref|ZP_02698625.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|168751446|ref|ZP_02776468.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4113]
 gi|168754774|ref|ZP_02779781.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4401]
 gi|168760445|ref|ZP_02785452.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4501]
 gi|168766482|ref|ZP_02791489.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4486]
 gi|168774085|ref|ZP_02799092.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4196]
 gi|168780635|ref|ZP_02805642.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4076]
 gi|168784840|ref|ZP_02809847.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC869]
 gi|168801858|ref|ZP_02826865.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC508]
 gi|170021788|ref|YP_001726742.1| 30S ribosomal protein S18 [Escherichia coli ATCC 8739]
 gi|170083647|ref|YP_001732967.1| 30S ribosomal protein S18 [Escherichia coli str. K-12 substr.
          DH10B]
 gi|170680020|ref|YP_001746596.1| 30S ribosomal protein S18 [Escherichia coli SMS-3-5]
 gi|170766627|ref|ZP_02901080.1| ribosomal protein S18 [Escherichia albertii TW07627]
 gi|183600324|ref|ZP_02961817.1| hypothetical protein PROSTU_03885 [Providencia stuartii ATCC
          25827]
 gi|187732798|ref|YP_001882891.1| 30S ribosomal protein S18 [Shigella boydii CDC 3083-94]
 gi|188495594|ref|ZP_03002864.1| ribosomal protein S18 [Escherichia coli 53638]
 gi|188535071|ref|YP_001908868.1| 30S ribosomal protein S18 [Erwinia tasmaniensis Et1/99]
 gi|191165620|ref|ZP_03027460.1| ribosomal protein S18 [Escherichia coli B7A]
 gi|191170703|ref|ZP_03032255.1| ribosomal protein S18 [Escherichia coli F11]
 gi|193065998|ref|ZP_03047056.1| ribosomal protein S18 [Escherichia coli E22]
 gi|193070855|ref|ZP_03051787.1| ribosomal protein S18 [Escherichia coli E110019]
 gi|194426593|ref|ZP_03059147.1| ribosomal protein S18 [Escherichia coli B171]
 gi|194434584|ref|ZP_03066841.1| ribosomal protein S18 [Shigella dysenteriae 1012]
 gi|194439537|ref|ZP_03071611.1| ribosomal protein S18 [Escherichia coli 101-1]
 gi|194446807|ref|YP_002043646.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194449942|ref|YP_002048435.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|194472416|ref|ZP_03078400.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|194734283|ref|YP_002117333.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|195935992|ref|ZP_03081374.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 str. EC4024]
 gi|197249759|ref|YP_002149307.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|197261817|ref|ZP_03161891.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197287188|ref|YP_002153060.1| 30S ribosomal protein S18 [Proteus mirabilis HI4320]
 gi|197365107|ref|YP_002144744.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. AKU_12601]
 gi|198242690|ref|YP_002218274.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|200387853|ref|ZP_03214465.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|204927186|ref|ZP_03218388.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|205355148|ref|YP_002228949.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 287/91]
 gi|206579628|ref|YP_002240847.1| ribosomal protein S18 [Klebsiella pneumoniae 342]
 gi|207859538|ref|YP_002246189.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Enteritidis str. P125109]
 gi|208809011|ref|ZP_03251348.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4206]
 gi|208814274|ref|ZP_03255603.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4045]
 gi|208819004|ref|ZP_03259324.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4042]
 gi|209400527|ref|YP_002273743.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4115]
 gi|209921692|ref|YP_002295776.1| 30S ribosomal protein S18 [Escherichia coli SE11]
 gi|212709964|ref|ZP_03318092.1| hypothetical protein PROVALCAL_01015 [Providencia alcalifaciens
          DSM 30120]
 gi|213028576|ref|ZP_03343023.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. 404ty]
 gi|213161635|ref|ZP_03347345.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. E00-7866]
 gi|213419166|ref|ZP_03352232.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. E01-6750]
 gi|213428641|ref|ZP_03361391.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. E02-1180]
 gi|213582064|ref|ZP_03363890.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-0664]
 gi|213609732|ref|ZP_03369558.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-2068]
 gi|213649001|ref|ZP_03379054.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. J185]
 gi|213864943|ref|ZP_03387062.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. M223]
 gi|215489546|ref|YP_002331977.1| 30S ribosomal protein S18 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217326502|ref|ZP_03442586.1| ribosomal protein S18 [Escherichia coli O157:H7 str. TW14588]
 gi|218551472|ref|YP_002385264.1| 30S ribosomal protein S18 [Escherichia fergusonii ATCC 35469]
 gi|218556754|ref|YP_002389668.1| 30S ribosomal protein S18 [Escherichia coli IAI1]
 gi|218561361|ref|YP_002394274.1| 30S ribosomal protein S18 [Escherichia coli S88]
 gi|218692585|ref|YP_002400797.1| 30S ribosomal protein S18 [Escherichia coli ED1a]
 gi|218697953|ref|YP_002405620.1| 30S ribosomal protein S18 [Escherichia coli 55989]
 gi|218702898|ref|YP_002410527.1| 30S ribosomal protein S18 [Escherichia coli IAI39]
 gi|218707813|ref|YP_002415332.1| 30S ribosomal protein S18 [Escherichia coli UMN026]
 gi|224586232|ref|YP_002640031.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|226326632|ref|ZP_03802150.1| hypothetical protein PROPEN_00482 [Proteus penneri ATCC 35198]
 gi|227357118|ref|ZP_03841487.1| 30S ribosomal protein S18 [Proteus mirabilis ATCC 29906]
 gi|227886754|ref|ZP_04004559.1| 30S ribosomal protein S18 [Escherichia coli 83972]
 gi|237703870|ref|ZP_04534351.1| 30S ribosomal subunit protein S18 [Escherichia sp. 3_2_53FAA]
 gi|237729131|ref|ZP_04559612.1| 30S ribosomal protein S18 [Citrobacter sp. 30_2]
 gi|238755922|ref|ZP_04617250.1| 30S ribosomal protein S18 [Yersinia ruckeri ATCC 29473]
 gi|238892682|ref|YP_002917416.1| 30S ribosomal protein S18 [Klebsiella pneumoniae NTUH-K2044]
 gi|238903309|ref|YP_002929105.1| 30S ribosomal subunit protein S18 [Escherichia coli BW2952]
 gi|238910550|ref|ZP_04654387.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Tennessee str. CDC07-0191]
 gi|238918385|ref|YP_002931899.1| 30S ribosomal protein S18 [Edwardsiella ictaluri 93-146]
 gi|242238248|ref|YP_002986429.1| ribosomal protein S18 [Dickeya dadantii Ech703]
 gi|251788413|ref|YP_003003134.1| 30S ribosomal protein S18 [Dickeya zeae Ech1591]
 gi|253775173|ref|YP_003038004.1| 30S ribosomal protein S18 [Escherichia coli 'BL21-Gold(DE3)pLysS
          AG']
 gi|253991543|ref|YP_003042899.1| 30S ribosomal protein S18 [Photorhabdus asymbiotica subsp.
          asymbiotica ATCC 43949]
 gi|254037222|ref|ZP_04871299.1| ribosomal protein S18 [Escherichia sp. 1_1_43]
 gi|254164131|ref|YP_003047239.1| 30S ribosomal protein S18 [Escherichia coli B str. REL606]
 gi|254796221|ref|YP_003081058.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 str. TW14359]
 gi|256019847|ref|ZP_05433712.1| 30S ribosomal protein S18 [Shigella sp. D9]
 gi|256025137|ref|ZP_05439002.1| 30S ribosomal protein S18 [Escherichia sp. 4_1_40B]
 gi|259907191|ref|YP_002647547.1| 30S ribosomal protein S18 [Erwinia pyrifoliae Ep1/96]
 gi|260599460|ref|YP_003212031.1| 30S ribosomal protein S18 [Cronobacter turicensis z3032]
 gi|260847031|ref|YP_003224809.1| 30S ribosomal subunit protein S18 [Escherichia coli O103:H2 str.
          12009]
 gi|260858354|ref|YP_003232245.1| 30S ribosomal subunit protein S18 [Escherichia coli O26:H11 str.
          11368]
 gi|260870890|ref|YP_003237292.1| 30S ribosomal subunit protein S18 [Escherichia coli O111:H- str.
          11128]
 gi|261225322|ref|ZP_05939603.1| 30S ribosomal subunit protein S18 [Escherichia coli O157:H7 str.
          FRIK2000]
 gi|261255426|ref|ZP_05947959.1| 30S ribosomal subunit protein S18 [Escherichia coli O157:H7 str.
          FRIK966]
 gi|261345205|ref|ZP_05972849.1| ribosomal protein S18 [Providencia rustigianii DSM 4541]
 gi|262045370|ref|ZP_06018394.1| 50S ribosomal protein L21 [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|268592870|ref|ZP_06127091.1| ribosomal protein S18 [Providencia rettgeri DSM 1131]
 gi|269137725|ref|YP_003294425.1| 30S ribosomal protein S18 [Edwardsiella tarda EIB202]
 gi|271501889|ref|YP_003334915.1| 30S ribosomal protein S18 [Dickeya dadantii Ech586]
 gi|283786876|ref|YP_003366741.1| 30S ribosomal subunit protein S18 [Citrobacter rodentium ICC168]
 gi|283834822|ref|ZP_06354563.1| ribosomal protein S18 [Citrobacter youngae ATCC 29220]
 gi|288937503|ref|YP_003441562.1| ribosomal protein S18 [Klebsiella variicola At-22]
 gi|289811466|ref|ZP_06542095.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. AG3]
 gi|289829953|ref|ZP_06547404.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-3139]
 gi|290512241|ref|ZP_06551608.1| 30S ribosomal protein S18 [Klebsiella sp. 1_1_55]
 gi|291285614|ref|YP_003502432.1| 30S ribosomal protein S18 [Escherichia coli O55:H7 str. CB9615]
 gi|291619075|ref|YP_003521817.1| RpsR [Pantoea ananatis LMG 20103]
 gi|292489606|ref|YP_003532496.1| 30S ribosomal protein S18 [Erwinia amylovora CFBP1430]
 gi|292898173|ref|YP_003537542.1| 30s ribosomal protein S18 [Erwinia amylovora ATCC 49946]
 gi|293393197|ref|ZP_06637512.1| 50S ribosomal protein L21 [Serratia odorifera DSM 4582]
 gi|293402827|ref|ZP_06646924.1| 30S ribosomal protein S18 [Escherichia coli FVEC1412]
 gi|293407927|ref|ZP_06651767.1| 30S ribosomal protein S18 [Escherichia coli B354]
 gi|293417705|ref|ZP_06660327.1| 30S ribosomal protein S18 [Escherichia coli B185]
 gi|293476510|ref|ZP_06664918.1| 30S ribosomal protein S18 [Escherichia coli B088]
 gi|294634472|ref|ZP_06713007.1| ribosomal protein S18 [Edwardsiella tarda ATCC 23685]
 gi|296100965|ref|YP_003611111.1| ribosomal protein S18 [Enterobacter cloacae subsp. cloacae ATCC
          13047]
 gi|298378356|ref|ZP_06988240.1| 30S ribosomal protein S18 [Escherichia coli FVEC1302]
 gi|300816496|ref|ZP_07096717.1| ribosomal protein S18 [Escherichia coli MS 107-1]
 gi|300821296|ref|ZP_07101444.1| ribosomal protein S18 [Escherichia coli MS 119-7]
 gi|300899740|ref|ZP_07117965.1| ribosomal protein S18 [Escherichia coli MS 198-1]
 gi|300906032|ref|ZP_07123756.1| ribosomal protein S18 [Escherichia coli MS 84-1]
 gi|300918336|ref|ZP_07134937.1| ribosomal protein S18 [Escherichia coli MS 115-1]
 gi|300922390|ref|ZP_07138510.1| ribosomal protein S18 [Escherichia coli MS 182-1]
 gi|300928018|ref|ZP_07143571.1| ribosomal protein S18 [Escherichia coli MS 187-1]
 gi|300940689|ref|ZP_07155250.1| ribosomal protein S18 [Escherichia coli MS 21-1]
 gi|300949169|ref|ZP_07163211.1| ribosomal protein S18 [Escherichia coli MS 116-1]
 gi|300955265|ref|ZP_07167658.1| ribosomal protein S18 [Escherichia coli MS 175-1]
 gi|300987233|ref|ZP_07178062.1| ribosomal protein S18 [Escherichia coli MS 45-1]
 gi|300988551|ref|ZP_07178747.1| ribosomal protein S18 [Escherichia coli MS 200-1]
 gi|301024523|ref|ZP_07188198.1| ribosomal protein S18 [Escherichia coli MS 69-1]
 gi|301028025|ref|ZP_07191309.1| ribosomal protein S18 [Escherichia coli MS 196-1]
 gi|301045965|ref|ZP_07193148.1| ribosomal protein S18 [Escherichia coli MS 185-1]
 gi|301302619|ref|ZP_07208749.1| ribosomal protein S18 [Escherichia coli MS 124-1]
 gi|301325967|ref|ZP_07219388.1| ribosomal protein S18 [Escherichia coli MS 78-1]
 gi|301646650|ref|ZP_07246516.1| ribosomal protein S18 [Escherichia coli MS 146-1]
 gi|306815583|ref|ZP_07449732.1| 30S ribosomal protein S18 [Escherichia coli NC101]
 gi|307132412|ref|YP_003884428.1| 30S ribosomal subunit protein S18 [Dickeya dadantii 3937]
 gi|307140899|ref|ZP_07500255.1| 30S ribosomal protein S18 [Escherichia coli H736]
 gi|307314849|ref|ZP_07594441.1| ribosomal protein S18 [Escherichia coli W]
 gi|309787731|ref|ZP_07682342.1| ribosomal protein S18 [Shigella dysenteriae 1617]
 gi|309797014|ref|ZP_07691414.1| ribosomal protein S18 [Escherichia coli MS 145-7]
 gi|312965875|ref|ZP_07780101.1| ribosomal protein S18 [Escherichia coli 2362-75]
 gi|312973990|ref|ZP_07788161.1| ribosomal protein S18 [Escherichia coli 1827-70]
 gi|317049740|ref|YP_004117388.1| 30S ribosomal protein S18 [Pantoea sp. At-9b]
 gi|317493585|ref|ZP_07952006.1| ribosomal protein S18 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|320539666|ref|ZP_08039330.1| 30S ribosomal subunit protein S18 [Serratia symbiotica str.
          Tucson]
 gi|330003415|ref|ZP_08304613.1| ribosomal protein S18 [Klebsiella sp. MS 92-3]
 gi|331644954|ref|ZP_08346071.1| ribosomal protein S18 [Escherichia coli H736]
 gi|331650327|ref|ZP_08351399.1| ribosomal protein S18 [Escherichia coli M605]
 gi|331656030|ref|ZP_08357018.1| ribosomal protein S18 [Escherichia coli M718]
 gi|331660777|ref|ZP_08361709.1| ribosomal protein S18 [Escherichia coli TA206]
 gi|331665866|ref|ZP_08366760.1| ribosomal protein S18 [Escherichia coli TA143]
 gi|331671111|ref|ZP_08371944.1| ribosomal protein S18 [Escherichia coli TA271]
 gi|331671353|ref|ZP_08372151.1| ribosomal protein S18 [Escherichia coli TA280]
 gi|331680332|ref|ZP_08380991.1| ribosomal protein S18 [Escherichia coli H591]
 gi|331681220|ref|ZP_08381857.1| ribosomal protein S18 [Escherichia coli H299]
 gi|332280987|ref|ZP_08393400.1| ribosomal protein S18 [Shigella sp. D9]
 gi|67472372|sp|P0A7T7|RS18_ECOLI RecName: Full=30S ribosomal protein S18
 gi|67472373|sp|P0A7T8|RS18_ECOL6 RecName: Full=30S ribosomal protein S18
 gi|67472374|sp|P0A7T9|RS18_ECO57 RecName: Full=30S ribosomal protein S18
 gi|67472375|sp|P0A7U0|RS18_PHOLL RecName: Full=30S ribosomal protein S18
 gi|67472376|sp|P0A7U1|RS18_SALTI RecName: Full=30S ribosomal protein S18
 gi|67472377|sp|P0A7U2|RS18_SHIFL RecName: Full=30S ribosomal protein S18
 gi|75505387|sp|Q57GI9|RS18_SALCH RecName: Full=30S ribosomal protein S18
 gi|81677980|sp|Q5PJ56|RS18_SALPA RecName: Full=30S ribosomal protein S18
 gi|123047658|sp|Q0SX84|RS18_SHIF8 RecName: Full=30S ribosomal protein S18
 gi|123084302|sp|Q1R358|RS18_ECOUT RecName: Full=30S ribosomal protein S18
 gi|123343273|sp|Q0T9J1|RS18_ECOL5 RecName: Full=30S ribosomal protein S18
 gi|123728279|sp|Q31TD3|RS18_SHIBS RecName: Full=30S ribosomal protein S18
 gi|123728458|sp|Q328J7|RS18_SHIDS RecName: Full=30S ribosomal protein S18
 gi|123759489|sp|Q3YUE5|RS18_SHISS RecName: Full=30S ribosomal protein S18
 gi|166220942|sp|A8AMJ6|RS18_CITK8 RecName: Full=30S ribosomal protein S18
 gi|166220951|sp|A7MM78|RS18_ENTS8 RecName: Full=30S ribosomal protein S18
 gi|166220955|sp|A6THB3|RS18_KLEP7 RecName: Full=30S ribosomal protein S18
 gi|167011188|sp|A7ZV73|RS18_ECO24 RecName: Full=30S ribosomal protein S18
 gi|167011189|sp|A8A7U8|RS18_ECOHS RecName: Full=30S ribosomal protein S18
 gi|167011190|sp|A4W5T1|RS18_ENT38 RecName: Full=30S ribosomal protein S18
 gi|189029651|sp|A9N520|RS18_SALPB RecName: Full=30S ribosomal protein S18
 gi|189029677|sp|B1IT04|RS18_ECOLC RecName: Full=30S ribosomal protein S18
 gi|189029686|sp|A9MFK9|RS18_SALAR RecName: Full=30S ribosomal protein S18
 gi|226735113|sp|B7MLK7|RS18_ECO45 RecName: Full=30S ribosomal protein S18
 gi|226735114|sp|B7NTQ7|RS18_ECO7I RecName: Full=30S ribosomal protein S18
 gi|226735115|sp|B7M9G4|RS18_ECO8A RecName: Full=30S ribosomal protein S18
 gi|226735116|sp|B7NGD6|RS18_ECOLU RecName: Full=30S ribosomal protein S18
 gi|226735117|sp|B1LQM1|RS18_ECOSM RecName: Full=30S ribosomal protein S18
 gi|226735119|sp|B7LLY4|RS18_ESCF3 RecName: Full=30S ribosomal protein S18
 gi|229559983|sp|B6I2A8|RS18_ECOSE RecName: Full=30S ribosomal protein S18
 gi|229559984|sp|B2VCV9|RS18_ERWT9 RecName: Full=30S ribosomal protein S18
 gi|229559986|sp|B5Z2K7|RS18_ECO5E RecName: Full=30S ribosomal protein S18
 gi|229559987|sp|B1XDV2|RS18_ECODH RecName: Full=30S ribosomal protein S18
 gi|229560040|sp|B5Y306|RS18_KLEP3 RecName: Full=30S ribosomal protein S18
 gi|229560053|sp|B4F277|RS18_PROMH RecName: Full=30S ribosomal protein S18
 gi|229560058|sp|B5F3B9|RS18_SALA4 RecName: Full=30S ribosomal protein S18
 gi|229560059|sp|B5FSA3|RS18_SALDC RecName: Full=30S ribosomal protein S18
 gi|229560060|sp|B5R0S0|RS18_SALEP RecName: Full=30S ribosomal protein S18
 gi|229560061|sp|B5R9F0|RS18_SALG2 RecName: Full=30S ribosomal protein S18
 gi|229560062|sp|B4TFD7|RS18_SALHS RecName: Full=30S ribosomal protein S18
 gi|229560063|sp|B4T3F3|RS18_SALNS RecName: Full=30S ribosomal protein S18
 gi|229560064|sp|B5BKL1|RS18_SALPK RecName: Full=30S ribosomal protein S18
 gi|229560065|sp|B4TT35|RS18_SALSV RecName: Full=30S ribosomal protein S18
 gi|229560074|sp|B2TY75|RS18_SHIB3 RecName: Full=30S ribosomal protein S18
 gi|254765429|sp|B7UQL1|RS18_ECO27 RecName: Full=30S ribosomal protein S18
 gi|254765430|sp|B7LCR3|RS18_ECO55 RecName: Full=30S ribosomal protein S18
 gi|254765431|sp|B7MST2|RS18_ECO81 RecName: Full=30S ribosomal protein S18
 gi|254812953|sp|C0Q6G0|RS18_SALPC RecName: Full=30S ribosomal protein S18
 gi|259494808|sp|C4ZR79|RS18_ECOBW RecName: Full=30S ribosomal protein S18
 gi|259494809|sp|C5BF78|RS18_EDWI9 RecName: Full=30S ribosomal protein S18
 gi|25294828|pir||AI1052 30s ribosomal chain protein S18 [imported] - Salmonella enterica
          subsp. enterica serovar Typhi (strain CT18)
 gi|116666565|pdb|1VS5|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|116666617|pdb|1VS7|R Chain R, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|257097339|pdb|3I1M|R Chain R, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097391|pdb|3I1O|R Chain R, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097443|pdb|3I1Q|R Chain R, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097497|pdb|3I1S|R Chain R, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097551|pdb|3I1Z|R Chain R, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097606|pdb|3I21|R Chain R, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|290560324|pdb|3KC4|R Chain R, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
          Ribosomal Subnit. The 50s Ribosomal Subunit Can Be
          Found In Pdb Entry 3kcr
 gi|308198704|pdb|3OR9|R Chain R, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 30s Subunit Of The
          First 70s Ribosome.
 gi|308198725|pdb|3ORA|R Chain R, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 30s Subunit Of The
          Second 70s Ribosome.
 gi|326634296|pdb|3IZV|V Chain V, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Small Subunit Of A Ribosome Programmed With A
          Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
          Ef-Tu
 gi|326634321|pdb|3IZW|V Chain V, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding.This Entry Contains The
          Small Subunit Of A Ribosome Programmed With A Cognate
          Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
 gi|26111531|gb|AAN83713.1|AE016771_224 30S ribosomal protein S18 [Escherichia coli CFT073]
 gi|42847|emb|CAA27654.1| unnamed protein product [Escherichia coli]
 gi|537043|gb|AAA97098.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K-12
          substr. MG1655]
 gi|1790646|gb|AAC77159.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K-12
          substr. MG1655]
 gi|13364655|dbj|BAB38601.1| 30S ribosomal subunit protein S18 [Escherichia coli O157:H7 str.
          Sakai]
 gi|16505518|emb|CAD06870.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Typhi]
 gi|24054886|gb|AAN45772.1| 30S ribosomal subunit protein S18 [Shigella flexneri 2a str. 301]
 gi|29140328|gb|AAO71891.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Typhi str. Ty2]
 gi|30043837|gb|AAP19556.1| 30S ribosomal subunit protein S18 [Shigella flexneri 2a str.
          2457T]
 gi|36787828|emb|CAE16943.1| 30S ribosomal protein S18 [Photorhabdus luminescens subsp.
          laumondii TTO1]
 gi|56130441|gb|AAV79947.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|62130470|gb|AAX68173.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|73858160|gb|AAZ90867.1| 30S ribosomal subunit protein S18 [Shigella sonnei Ss046]
 gi|81243548|gb|ABB64258.1| 30S ribosomal subunit protein S18 [Shigella dysenteriae Sd197]
 gi|81247967|gb|ABB68675.1| 30S ribosomal subunit protein S18 [Shigella boydii Sb227]
 gi|85676953|dbj|BAE78203.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K12
          substr. W3110]
 gi|91075325|gb|ABE10206.1| 30S ribosomal subunit protein S18 [Escherichia coli UTI89]
 gi|110346151|gb|ABG72388.1| 30S ribosomal protein S18 [Escherichia coli 536]
 gi|110617664|gb|ABF06331.1| 30S ribosomal subunit protein S18 [Shigella flexneri 5 str. 8401]
 gi|145316914|gb|ABP59061.1| SSU ribosomal protein S18P [Enterobacter sp. 638]
 gi|150957917|gb|ABR79947.1| 30S ribosomal protein S18 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|156530677|gb|ABU75503.1| hypothetical protein ESA_00202 [Cronobacter sakazakii ATCC
          BAA-894]
 gi|157069347|gb|ABV08602.1| ribosomal protein S18 [Escherichia coli HS]
 gi|157080670|gb|ABV20378.1| ribosomal protein S18 [Escherichia coli E24377A]
 gi|157085031|gb|ABV14709.1| hypothetical protein CKO_03630 [Citrobacter koseri ATCC BAA-895]
 gi|160866452|gb|ABX23075.1| hypothetical protein SARI_03239 [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:--]
 gi|161367029|gb|ABX70797.1| hypothetical protein SPAB_05528 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|169756716|gb|ACA79415.1| ribosomal protein S18 [Escherichia coli ATCC 8739]
 gi|169891482|gb|ACB05189.1| 30S ribosomal subunit protein S18 [Escherichia coli str. K-12
          substr. DH10B]
 gi|170124065|gb|EDS92996.1| ribosomal protein S18 [Escherichia albertii TW07627]
 gi|170517738|gb|ACB15916.1| ribosomal protein S18 [Escherichia coli SMS-3-5]
 gi|187429790|gb|ACD09064.1| ribosomal protein S18 [Shigella boydii CDC 3083-94]
 gi|187770314|gb|EDU34158.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4196]
 gi|188014502|gb|EDU52624.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4113]
 gi|188020113|gb|EDU58153.1| hypothetical protein PROSTU_03885 [Providencia stuartii ATCC
          25827]
 gi|188030113|emb|CAO97999.1| 30S ribosomal protein S18 [Erwinia tasmaniensis Et1/99]
 gi|188490793|gb|EDU65896.1| ribosomal protein S18 [Escherichia coli 53638]
 gi|189001716|gb|EDU70702.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4076]
 gi|189357840|gb|EDU76259.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4401]
 gi|189364286|gb|EDU82705.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4486]
 gi|189368871|gb|EDU87287.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4501]
 gi|189374715|gb|EDU93131.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC869]
 gi|189376068|gb|EDU94484.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC508]
 gi|190904315|gb|EDV64024.1| ribosomal protein S18 [Escherichia coli B7A]
 gi|190908927|gb|EDV68514.1| ribosomal protein S18 [Escherichia coli F11]
 gi|192926321|gb|EDV80957.1| ribosomal protein S18 [Escherichia coli E22]
 gi|192955801|gb|EDV86272.1| ribosomal protein S18 [Escherichia coli E110019]
 gi|194405470|gb|ACF65692.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194408246|gb|ACF68465.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|194415332|gb|EDX31600.1| ribosomal protein S18 [Escherichia coli B171]
 gi|194417169|gb|EDX33281.1| ribosomal protein S18 [Shigella dysenteriae 1012]
 gi|194421536|gb|EDX37549.1| ribosomal protein S18 [Escherichia coli 101-1]
 gi|194458780|gb|EDX47619.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|194684675|emb|CAR46619.1| 30S ribosomal protein S18 [Proteus mirabilis HI4320]
 gi|194709785|gb|ACF89006.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|195632565|gb|EDX51019.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|197096584|emb|CAR62196.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|197213462|gb|ACH50859.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|197240072|gb|EDY22692.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197937206|gb|ACH74539.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|199604951|gb|EDZ03496.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|204323851|gb|EDZ09046.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|205274929|emb|CAR39998.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|205347928|gb|EDZ34559.1| ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
 gi|206568686|gb|ACI10462.1| ribosomal protein S18 [Klebsiella pneumoniae 342]
 gi|206711341|emb|CAR35719.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|208728812|gb|EDZ78413.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4206]
 gi|208735551|gb|EDZ84238.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4045]
 gi|208739127|gb|EDZ86809.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4042]
 gi|209161927|gb|ACI39360.1| ribosomal protein S18 [Escherichia coli O157:H7 str. EC4115]
 gi|209749988|gb|ACI73301.1| 30S ribosomal subunit protein S18 [Escherichia coli]
 gi|209749990|gb|ACI73302.1| 30S ribosomal subunit protein S18 [Escherichia coli]
 gi|209749992|gb|ACI73303.1| 30S ribosomal subunit protein S18 [Escherichia coli]
 gi|209749994|gb|ACI73304.1| 30S ribosomal subunit protein S18 [Escherichia coli]
 gi|209749996|gb|ACI73305.1| 30S ribosomal subunit protein S18 [Escherichia coli]
 gi|209914951|dbj|BAG80025.1| 30S ribosomal protein S18 [Escherichia coli SE11]
 gi|211638421|emb|CAR67043.1| 30s ribosomal subunit protein s18 [Photorhabdus asymbiotica
          subsp. asymbiotica ATCC 43949]
 gi|212687373|gb|EEB46901.1| hypothetical protein PROVALCAL_01015 [Providencia alcalifaciens
          DSM 30120]
 gi|215267618|emb|CAS12073.1| 30S ribosomal subunit protein S18 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217322723|gb|EEC31147.1| ribosomal protein S18 [Escherichia coli O157:H7 str. TW14588]
 gi|218354685|emb|CAV01702.1| 30S ribosomal subunit protein S18 [Escherichia coli 55989]
 gi|218359014|emb|CAQ91674.1| 30S ribosomal subunit protein S18 [Escherichia fergusonii ATCC
          35469]
 gi|218363523|emb|CAR01177.1| 30S ribosomal subunit protein S18 [Escherichia coli IAI1]
 gi|218368130|emb|CAR05937.1| 30S ribosomal subunit protein S18 [Escherichia coli S88]
 gi|218372884|emb|CAR20764.1| 30S ribosomal subunit protein S18 [Escherichia coli IAI39]
 gi|218430149|emb|CAR11007.1| 30S ribosomal subunit protein S18 [Escherichia coli ED1a]
 gi|218434910|emb|CAR15848.1| 30S ribosomal subunit protein S18 [Escherichia coli UMN026]
 gi|222035972|emb|CAP78717.1| 30S ribosomal protein S18 [Escherichia coli LF82]
 gi|224470760|gb|ACN48590.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|224962813|emb|CAX54271.1| 30S ribosomal protein S18 [Erwinia pyrifoliae Ep1/96]
 gi|225204853|gb|EEG87207.1| hypothetical protein PROPEN_00482 [Proteus penneri ATCC 35198]
 gi|226840328|gb|EEH72330.1| ribosomal protein S18 [Escherichia sp. 1_1_43]
 gi|226901782|gb|EEH88041.1| 30S ribosomal subunit protein S18 [Escherichia sp. 3_2_53FAA]
 gi|226908860|gb|EEH94778.1| 30S ribosomal protein S18 [Citrobacter sp. 30_2]
 gi|227162650|gb|EEI47617.1| 30S ribosomal protein S18 [Proteus mirabilis ATCC 29906]
 gi|227836327|gb|EEJ46793.1| 30S ribosomal protein S18 [Escherichia coli 83972]
 gi|238544998|dbj|BAH61349.1| 30S ribosomal protein S18 [Klebsiella pneumoniae subsp.
          pneumoniae NTUH-K2044]
 gi|238705881|gb|EEP98270.1| 30S ribosomal protein S18 [Yersinia ruckeri ATCC 29473]
 gi|238859792|gb|ACR61790.1| 30S ribosomal subunit protein S18 [Escherichia coli BW2952]
 gi|238867953|gb|ACR67664.1| ribosomal protein S18, putative [Edwardsiella ictaluri 93-146]
 gi|242130305|gb|ACS84607.1| ribosomal protein S18 [Dickeya dadantii Ech703]
 gi|242379723|emb|CAQ34548.1| 30S ribosomal subunit protein S18, subunit of 30S ribosomal
          subunit and ribosome [Escherichia coli BL21(DE3)]
 gi|247537034|gb|ACT05655.1| ribosomal protein S18 [Dickeya zeae Ech1591]
 gi|253326217|gb|ACT30819.1| ribosomal protein S18 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253782993|emb|CAQ86158.1| 30s ribosomal subunit protein s18 [Photorhabdus asymbiotica]
 gi|253976032|gb|ACT41703.1| 30S ribosomal protein S18 [Escherichia coli B str. REL606]
 gi|253980188|gb|ACT45858.1| 30S ribosomal protein S18 [Escherichia coli BL21(DE3)]
 gi|254595621|gb|ACT74982.1| 30S ribosomal subunit protein S18 [Escherichia coli O157:H7 str.
          TW14359]
 gi|257757003|dbj|BAI28505.1| 30S ribosomal subunit protein S18 [Escherichia coli O26:H11 str.
          11368]
 gi|257762178|dbj|BAI33675.1| 30S ribosomal subunit protein S18 [Escherichia coli O103:H2 str.
          12009]
 gi|257767246|dbj|BAI38741.1| 30S ribosomal subunit protein S18 [Escherichia coli O111:H- str.
          11128]
 gi|259037288|gb|EEW38535.1| 50S ribosomal protein L21 [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|260218637|emb|CBA33945.1| 30S ribosomal protein S18 [Cronobacter turicensis z3032]
 gi|260450971|gb|ACX41393.1| ribosomal protein S18 [Escherichia coli DH1]
 gi|261249483|emb|CBG27348.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. D23580]
 gi|267983385|gb|ACY83214.1| 30S ribosomal protein S18 [Edwardsiella tarda EIB202]
 gi|267996727|gb|ACY91612.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 14028S]
 gi|270345444|gb|ACZ78209.1| ribosomal protein S18 [Dickeya dadantii Ech586]
 gi|281181298|dbj|BAI57628.1| 30S ribosomal protein S18 [Escherichia coli SE15]
 gi|281603664|gb|ADA76648.1| 30S ribosomal protein S18 [Shigella flexneri 2002017]
 gi|282566898|gb|EFB72433.1| ribosomal protein S18 [Providencia rustigianii DSM 4541]
 gi|282950330|emb|CBG89977.1| 30S ribosomal subunit protein S18 [Citrobacter rodentium ICC168]
 gi|283477000|emb|CAY72892.1| 30S ribosomal protein S18 [Erwinia pyrifoliae DSM 12163]
 gi|284006637|emb|CBA71898.1| 30S ribosomal protein S18 [Arsenophonus nasoniae]
 gi|284924382|emb|CBG37504.1| 30S ribosomal subunit protein S18 [Escherichia coli 042]
 gi|288892212|gb|ADC60530.1| ribosomal protein S18 [Klebsiella variicola At-22]
 gi|289775236|gb|EFD83237.1| 30S ribosomal protein S18 [Klebsiella sp. 1_1_55]
 gi|290765487|gb|ADD59448.1| 30S ribosomal protein S18 [Escherichia coli O55:H7 str. CB9615]
 gi|291069070|gb|EFE07179.1| ribosomal protein S18 [Citrobacter youngae ATCC 29220]
 gi|291091986|gb|EFE24547.1| ribosomal protein S18 [Edwardsiella tarda ATCC 23685]
 gi|291154105|gb|ADD78689.1| RpsR [Pantoea ananatis LMG 20103]
 gi|291198021|emb|CBJ45124.1| 30s ribosomal subunit protein S18 [Erwinia amylovora ATCC 49946]
 gi|291311659|gb|EFE52112.1| ribosomal protein S18 [Providencia rettgeri DSM 1131]
 gi|291320963|gb|EFE60405.1| 30S ribosomal protein S18 [Escherichia coli B088]
 gi|291424343|gb|EFE97557.1| 50S ribosomal protein L21 [Serratia odorifera DSM 4582]
 gi|291429742|gb|EFF02756.1| 30S ribosomal protein S18 [Escherichia coli FVEC1412]
 gi|291430423|gb|EFF03421.1| 30S ribosomal protein S18 [Escherichia coli B185]
 gi|291472178|gb|EFF14660.1| 30S ribosomal protein S18 [Escherichia coli B354]
 gi|291555043|emb|CBA23114.1| 30S ribosomal protein S18 [Erwinia amylovora CFBP1430]
 gi|294492280|gb|ADE91036.1| ribosomal protein S18 [Escherichia coli IHE3034]
 gi|295055424|gb|ADF60162.1| ribosomal protein S18 [Enterobacter cloacae subsp. cloacae ATCC
          13047]
 gi|295098349|emb|CBK87439.1| ribosomal protein S18 [Enterobacter cloacae subsp. cloacae NCTC
          9394]
 gi|298280690|gb|EFI22191.1| 30S ribosomal protein S18 [Escherichia coli FVEC1302]
 gi|299878935|gb|EFI87146.1| ribosomal protein S18 [Escherichia coli MS 196-1]
 gi|300302008|gb|EFJ58393.1| ribosomal protein S18 [Escherichia coli MS 185-1]
 gi|300305897|gb|EFJ60417.1| ribosomal protein S18 [Escherichia coli MS 200-1]
 gi|300317842|gb|EFJ67626.1| ribosomal protein S18 [Escherichia coli MS 175-1]
 gi|300356712|gb|EFJ72582.1| ribosomal protein S18 [Escherichia coli MS 198-1]
 gi|300396522|gb|EFJ80060.1| ribosomal protein S18 [Escherichia coli MS 69-1]
 gi|300402199|gb|EFJ85737.1| ribosomal protein S18 [Escherichia coli MS 84-1]
 gi|300407710|gb|EFJ91248.1| ribosomal protein S18 [Escherichia coli MS 45-1]
 gi|300414468|gb|EFJ97778.1| ribosomal protein S18 [Escherichia coli MS 115-1]
 gi|300421209|gb|EFK04520.1| ribosomal protein S18 [Escherichia coli MS 182-1]
 gi|300451417|gb|EFK15037.1| ribosomal protein S18 [Escherichia coli MS 116-1]
 gi|300454577|gb|EFK18070.1| ribosomal protein S18 [Escherichia coli MS 21-1]
 gi|300463969|gb|EFK27462.1| ribosomal protein S18 [Escherichia coli MS 187-1]
 gi|300526185|gb|EFK47254.1| ribosomal protein S18 [Escherichia coli MS 119-7]
 gi|300530726|gb|EFK51788.1| ribosomal protein S18 [Escherichia coli MS 107-1]
 gi|300842144|gb|EFK69904.1| ribosomal protein S18 [Escherichia coli MS 124-1]
 gi|300847320|gb|EFK75080.1| ribosomal protein S18 [Escherichia coli MS 78-1]
 gi|301075197|gb|EFK90003.1| ribosomal protein S18 [Escherichia coli MS 146-1]
 gi|301160880|emb|CBW20412.1| 30s ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. SL1344]
 gi|304557782|gb|ADM40446.1| SSU ribosomal protein S18p [Edwardsiella tarda FL6-60]
 gi|305851245|gb|EFM51700.1| 30S ribosomal protein S18 [Escherichia coli NC101]
 gi|306529941|gb|ADM99871.1| 30S ribosomal subunit protein S18 [Dickeya dadantii 3937]
 gi|306905652|gb|EFN36181.1| ribosomal protein S18 [Escherichia coli W]
 gi|307556369|gb|ADN49144.1| 30S ribosomal protein S18 [Escherichia coli ABU 83972]
 gi|307629274|gb|ADN73578.1| 30S ribosomal protein S18 [Escherichia coli UM146]
 gi|308119427|gb|EFO56689.1| ribosomal protein S18 [Escherichia coli MS 145-7]
 gi|308924481|gb|EFP69977.1| ribosomal protein S18 [Shigella dysenteriae 1617]
 gi|309704706|emb|CBJ04057.1| 30S ribosomal subunit protein S18 [Escherichia coli ETEC H10407]
 gi|310331524|gb|EFP98780.1| ribosomal protein S18 [Escherichia coli 1827-70]
 gi|310765318|gb|ADP10268.1| 30S ribosomal protein S18 [Erwinia sp. Ejp617]
 gi|312173783|emb|CBX82037.1| 30S ribosomal protein S18 [Erwinia amylovora ATCC BAA-2158]
 gi|312289118|gb|EFR17012.1| ribosomal protein S18 [Escherichia coli 2362-75]
 gi|312915490|dbj|BAJ39464.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. T000240]
 gi|312948852|gb|ADR29679.1| 30S ribosomal subunit protein S18 [Escherichia coli O83:H1 str.
          NRG 857C]
 gi|313646322|gb|EFS10784.1| ribosomal protein S18 [Shigella flexneri 2a str. 2457T]
 gi|315063516|gb|ADT77843.1| 30S ribosomal subunit protein S18 [Escherichia coli W]
 gi|315138756|dbj|BAJ45915.1| ribosomal protein S18 [Escherichia coli DH1]
 gi|315255547|gb|EFU35515.1| ribosomal protein S18 [Escherichia coli MS 85-1]
 gi|315288483|gb|EFU47881.1| ribosomal protein S18 [Escherichia coli MS 110-3]
 gi|315293516|gb|EFU52868.1| ribosomal protein S18 [Escherichia coli MS 153-1]
 gi|315299082|gb|EFU58336.1| ribosomal protein S18 [Escherichia coli MS 16-3]
 gi|315617610|gb|EFU98216.1| ribosomal protein S18 [Escherichia coli 3431]
 gi|316918528|gb|EFV39866.1| ribosomal protein S18 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316951357|gb|ADU70832.1| ribosomal protein S18 [Pantoea sp. At-9b]
 gi|320030278|gb|EFW12293.1| 30S ribosomal subunit protein S18 [Serratia symbiotica str.
          Tucson]
 gi|320088819|emb|CBY98577.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. 2007-60-3289-1]
 gi|320176373|gb|EFW51428.1| SSU ribosomal protein S18p [Shigella dysenteriae CDC 74-1112]
 gi|320177567|gb|EFW52557.1| SSU ribosomal protein S18p [Shigella boydii ATCC 9905]
 gi|320187349|gb|EFW62043.1| SSU ribosomal protein S18p [Shigella flexneri CDC 796-83]
 gi|320190669|gb|EFW65319.1| SSU ribosomal protein S18p [Escherichia coli O157:H7 str. EC1212]
 gi|320193685|gb|EFW68320.1| SSU ribosomal protein S18p [Escherichia coli WV_060327]
 gi|320200670|gb|EFW75256.1| SSU ribosomal protein S18p [Escherichia coli EC4100B]
 gi|320638960|gb|EFX08606.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 str. G5101]
 gi|320644329|gb|EFX13394.1| 30S ribosomal protein S18 [Escherichia coli O157:H- str. 493-89]
 gi|320649647|gb|EFX18171.1| 30S ribosomal protein S18 [Escherichia coli O157:H- str. H 2687]
 gi|320655043|gb|EFX23004.1| 30S ribosomal protein S18 [Escherichia coli O55:H7 str. 3256-97
          TW 07815]
 gi|320660550|gb|EFX28011.1| 30S ribosomal protein S18 [Escherichia coli O55:H7 str. USDA
          5905]
 gi|320665819|gb|EFX32856.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 str. LSU-61]
 gi|321222643|gb|EFX47715.1| SSU ribosomal protein S18p [Salmonella enterica subsp. enterica
          serovar Typhimurium str. TN061786]
 gi|322615555|gb|EFY12475.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 315996572]
 gi|322618615|gb|EFY15504.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-1]
 gi|322621972|gb|EFY18822.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-3]
 gi|322627696|gb|EFY24487.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-4]
 gi|322631003|gb|EFY27767.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 515920-1]
 gi|322637778|gb|EFY34479.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 515920-2]
 gi|322642340|gb|EFY38945.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 531954]
 gi|322643989|gb|EFY40537.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. NC_MB110209-0054]
 gi|322650936|gb|EFY47321.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. OH_2009072675]
 gi|322653579|gb|EFY49907.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. CASC_09SCPH15965]
 gi|322659764|gb|EFY56007.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 19N]
 gi|322662025|gb|EFY58241.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 81038-01]
 gi|322666226|gb|EFY62404.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MD_MDA09249507]
 gi|322672646|gb|EFY68757.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 414877]
 gi|322676076|gb|EFY72147.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 366867]
 gi|322680560|gb|EFY76598.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 413180]
 gi|322684546|gb|EFY80550.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 446600]
 gi|322717339|gb|EFZ08910.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. A50]
 gi|323132730|gb|ADX20160.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 4/74]
 gi|323155981|gb|EFZ42143.1| ribosomal protein S18 [Escherichia coli EPECa14]
 gi|323161993|gb|EFZ47865.1| ribosomal protein S18 [Escherichia coli E128010]
 gi|323166685|gb|EFZ52443.1| ribosomal protein S18 [Shigella sonnei 53G]
 gi|323171640|gb|EFZ57286.1| ribosomal protein S18 [Escherichia coli LT-68]
 gi|323176040|gb|EFZ61632.1| ribosomal protein S18 [Escherichia coli 1180]
 gi|323182307|gb|EFZ67717.1| ribosomal protein S18 [Escherichia coli 1357]
 gi|323189920|gb|EFZ75198.1| ribosomal protein S18 [Escherichia coli RN587/1]
 gi|323192861|gb|EFZ78087.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 609458-1]
 gi|323197263|gb|EFZ82403.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 556150-1]
 gi|323201620|gb|EFZ86684.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 609460]
 gi|323206134|gb|EFZ91096.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 507440-20]
 gi|323213142|gb|EFZ97944.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 556152]
 gi|323215516|gb|EGA00260.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB101509-0077]
 gi|323219501|gb|EGA03986.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB102109-0047]
 gi|323227804|gb|EGA11958.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB110209-0055]
 gi|323228974|gb|EGA13103.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB111609-0052]
 gi|323236414|gb|EGA20490.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 2009083312]
 gi|323238681|gb|EGA22733.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 2009085258]
 gi|323241868|gb|EGA25897.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 315731156]
 gi|323247983|gb|EGA31920.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2009159199]
 gi|323254686|gb|EGA38497.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008282]
 gi|323258255|gb|EGA41932.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008283]
 gi|323263599|gb|EGA47120.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008284]
 gi|323265805|gb|EGA49301.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008285]
 gi|323270249|gb|EGA53697.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008287]
 gi|323380405|gb|ADX52673.1| ribosomal protein S18 [Escherichia coli KO11]
 gi|323935327|gb|EGB31675.1| ribosomal protein S18 [Escherichia coli E1520]
 gi|323940121|gb|EGB36315.1| ribosomal protein S18 [Escherichia coli E482]
 gi|323946051|gb|EGB42088.1| ribosomal protein S18 [Escherichia coli H120]
 gi|323950729|gb|EGB46607.1| ribosomal protein S18 [Escherichia coli H252]
 gi|323955489|gb|EGB51253.1| ribosomal protein S18 [Escherichia coli H263]
 gi|323960246|gb|EGB55887.1| ribosomal protein S18 [Escherichia coli H489]
 gi|323965589|gb|EGB61043.1| ribosomal protein S18 [Escherichia coli M863]
 gi|323970543|gb|EGB65802.1| ribosomal protein S18 [Escherichia coli TA007]
 gi|323975456|gb|EGB70557.1| ribosomal protein S18 [Escherichia coli TW10509]
 gi|324005266|gb|EGB74485.1| ribosomal protein S18 [Escherichia coli MS 57-2]
 gi|324013801|gb|EGB83020.1| ribosomal protein S18 [Escherichia coli MS 60-1]
 gi|324019380|gb|EGB88599.1| ribosomal protein S18 [Escherichia coli MS 117-3]
 gi|324112201|gb|EGC06179.1| ribosomal protein S18 [Escherichia fergusonii B253]
 gi|324118768|gb|EGC12660.1| ribosomal protein S18 [Escherichia coli E1167]
 gi|325499736|gb|EGC97595.1| 30S ribosomal protein S18 [Escherichia fergusonii ECD227]
 gi|326345469|gb|EGD69212.1| SSU ribosomal protein S18p [Escherichia coli O157:H7 str. 1125]
 gi|326346674|gb|EGD70408.1| SSU ribosomal protein S18p [Escherichia coli O157:H7 str. 1044]
 gi|326626080|gb|EGE32425.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Dublin str. 3246]
 gi|326630306|gb|EGE36649.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 9]
 gi|327250142|gb|EGE61861.1| ribosomal protein S18 [Escherichia coli STEC_7v]
 gi|327395407|dbj|BAK12829.1| 30S ribosomal protein S18 RpsR [Pantoea ananatis AJ13355]
 gi|328536975|gb|EGF63268.1| ribosomal protein S18 [Klebsiella sp. MS 92-3]
 gi|330908543|gb|EGH37062.1| SSU ribosomal protein S18p [Escherichia coli AA86]
 gi|331035929|gb|EGI08167.1| ribosomal protein S18 [Escherichia coli H736]
 gi|331040721|gb|EGI12879.1| ribosomal protein S18 [Escherichia coli M605]
 gi|331046384|gb|EGI18474.1| ribosomal protein S18 [Escherichia coli M718]
 gi|331051819|gb|EGI23858.1| ribosomal protein S18 [Escherichia coli TA206]
 gi|331056917|gb|EGI28911.1| ribosomal protein S18 [Escherichia coli TA143]
 gi|331061700|gb|EGI33626.1| ribosomal protein S18 [Escherichia coli TA271]
 gi|331071198|gb|EGI42555.1| ribosomal protein S18 [Escherichia coli TA280]
 gi|331071795|gb|EGI43131.1| ribosomal protein S18 [Escherichia coli H591]
 gi|331081441|gb|EGI52602.1| ribosomal protein S18 [Escherichia coli H299]
 gi|332083203|gb|EGI88434.1| ribosomal protein S18 [Shigella boydii 5216-82]
 gi|332083716|gb|EGI88934.1| ribosomal protein S18 [Shigella dysenteriae 155-74]
 gi|332087075|gb|EGI92209.1| ribosomal protein S18 [Shigella boydii 3594-74]
 gi|332103339|gb|EGJ06685.1| ribosomal protein S18 [Shigella sp. D9]
 gi|332346283|gb|AEE59617.1| ribosomal protein S18 RpsR [Escherichia coli UMNK88]
 gi|332749078|gb|EGJ79501.1| ribosomal protein S18 [Shigella flexneri K-671]
 gi|332749345|gb|EGJ79766.1| ribosomal protein S18 [Shigella flexneri 4343-70]
 gi|332761898|gb|EGJ92172.1| ribosomal protein S18 [Shigella flexneri 2747-71]
 gi|332763253|gb|EGJ93496.1| ribosomal protein S18 [Shigella flexneri 2930-71]
 gi|332991204|gb|AEF10187.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. UK-1]
 gi|333007702|gb|EGK27179.1| ribosomal protein S18 [Shigella flexneri VA-6]
 gi|333009033|gb|EGK28489.1| ribosomal protein S18 [Shigella flexneri K-218]
 gi|333011183|gb|EGK30597.1| ribosomal protein S18 [Shigella flexneri K-272]
 gi|333012623|gb|EGK32003.1| ribosomal protein S18 [Shigella flexneri K-227]
 gi|333022347|gb|EGK41585.1| ribosomal protein S18 [Shigella flexneri K-304]
          Length = 75

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|319407054|emb|CBI80691.1| 30S ribosomal protein S18 [Bartonella sp. 1-1C]
          Length = 82

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR   HRRK+CP SG  AP+IDYKDI+LL R++S+RGKI+PSRI++VS KKQRELA AIK
Sbjct: 10 RRPFHHRRKTCPFSGANAPKIDYKDIKLLQRYISERGKIIPSRITAVSQKKQRELANAIK 69

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 70 RARFLGLLPYV 80


>gi|331089019|ref|ZP_08337926.1| hypothetical protein HMPREF1025_01509 [Lachnospiraceae bacterium
          3_1_46FAA]
 gi|330406471|gb|EGG85984.1| hypothetical protein HMPREF1025_01509 [Lachnospiraceae bacterium
          3_1_46FAA]
          Length = 88

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 44/72 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R     R+K C   GK    I+YKD+  L +++S+RGKI+P RI+    K QR L  AI
Sbjct: 15 RRGPARRRKKVCVFCGKENNEINYKDVAKLKKYVSERGKILPRRITGNCAKHQRALTVAI 74

Query: 70 KRARYLGLIAYV 81
          KRAR++ L+ YV
Sbjct: 75 KRARHIALMPYV 86


>gi|254467876|ref|ZP_05081282.1| ribosomal protein S18 [beta proteobacterium KB13]
 gi|207086686|gb|EDZ63969.1| ribosomal protein S18 [beta proteobacterium KB13]
          Length = 75

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 48/73 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R++  RR+ C  S +G   +DYKD+ LL  F+ + GKI+P+RI+    + QR+L  A+
Sbjct: 1  MARDMIRRRRYCRFSAEGIKEVDYKDVDLLKDFILENGKIIPARITGTKARYQRQLTTAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|304405909|ref|ZP_07387567.1| ribosomal protein S18 [Paenibacillus curdlanolyticus YK9]
 gi|304345152|gb|EFM10988.1| ribosomal protein S18 [Paenibacillus curdlanolyticus YK9]
          Length = 92

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 44/72 (61%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          R+  + RRK C  +      IDYKD  LL +F+S+RGKI+P R++  S K QR L  AIK
Sbjct: 20 RKGRNKRRKVCFFTVNKIKHIDYKDTDLLRKFISERGKILPRRVTGTSAKYQRLLTVAIK 79

Query: 71 RARYLGLIAYVN 82
          R+R + L+ Y  
Sbjct: 80 RSRQIALLPYTT 91


>gi|296285060|ref|ZP_06863058.1| 30S ribosomal protein S18 [Citromicrobium bathyomarinum JL354]
          Length = 74

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 60/72 (83%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK+CP SGK AP IDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELAKAI
Sbjct: 1  MARPFFRRRKTCPFSGKNAPVIDYKDVRLLQGFMSERGKIVPSRITAVSAKKQRELAKAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ YV
Sbjct: 61 KRARHIGLLPYV 72


>gi|163759110|ref|ZP_02166196.1| 30S ribosomal protein S18 [Hoeflea phototrophica DFL-43]
 gi|162283514|gb|EDQ33799.1| 30S ribosomal protein S18 [Hoeflea phototrophica DFL-43]
          Length = 82

 Score = 98.5 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRRKTCPFSGANAPKIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|254418129|ref|ZP_05031853.1| ribosomal protein S18 [Brevundimonas sp. BAL3]
 gi|196184306|gb|EDX79282.1| ribosomal protein S18 [Brevundimonas sp. BAL3]
          Length = 92

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 59/71 (83%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELAKAIK
Sbjct: 20 RRPFYRRRKVCPFSGANAPKIDYKDVKLLQRYVSERGKIVPSRITAVSQKKQRELAKAIK 79

Query: 71 RARYLGLIAYV 81
          RARYL L+ YV
Sbjct: 80 RARYLALLPYV 90


>gi|146319486|ref|YP_001199198.1| 30S ribosomal protein S18 [Streptococcus suis 05ZYH33]
 gi|146321678|ref|YP_001201389.1| 30S ribosomal protein S18 [Streptococcus suis 98HAH33]
 gi|223934218|ref|ZP_03626153.1| ribosomal protein S18 [Streptococcus suis 89/1591]
 gi|253752497|ref|YP_003025638.1| 30S ribosomal protein S18 [Streptococcus suis SC84]
 gi|253754323|ref|YP_003027464.1| 30S ribosomal protein S18 [Streptococcus suis P1/7]
 gi|253756257|ref|YP_003029397.1| 30S ribosomal protein S18 [Streptococcus suis BM407]
 gi|302024436|ref|ZP_07249647.1| 30S ribosomal protein S18 [Streptococcus suis 05HAS68]
 gi|330833440|ref|YP_004402265.1| 30S ribosomal protein S18 [Streptococcus suis ST3]
 gi|166222247|sp|A4W3Q0|RS18_STRS2 RecName: Full=30S ribosomal protein S18
 gi|166222249|sp|A4VXF9|RS18_STRSY RecName: Full=30S ribosomal protein S18
 gi|145690292|gb|ABP90798.1| 30S ribosomal protein S18 [Streptococcus suis 05ZYH33]
 gi|145692484|gb|ABP92989.1| 30S ribosomal protein S18 [Streptococcus suis 98HAH33]
 gi|223897115|gb|EEF63541.1| ribosomal protein S18 [Streptococcus suis 89/1591]
 gi|251816786|emb|CAZ52429.1| 30S ribosomal protein S18 [Streptococcus suis SC84]
 gi|251818721|emb|CAZ56557.1| 30S ribosomal protein S18 [Streptococcus suis BM407]
 gi|251820569|emb|CAR47325.1| 30S ribosomal protein S18 [Streptococcus suis P1/7]
 gi|292559103|gb|ADE32104.1| 30S ribosomal protein S18 [Streptococcus suis GZ1]
 gi|319758905|gb|ADV70847.1| 30S ribosomal protein S18 [Streptococcus suis JS14]
 gi|329307663|gb|AEB82079.1| 30S ribosomal protein S18 [Streptococcus suis ST3]
          Length = 79

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 46/74 (62%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
            R     R+K   ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  A
Sbjct: 4  QRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFISERGKILPRRVTGTSAKNQRKVTTA 63

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ +VN
Sbjct: 64 IKRARVMALLPFVN 77


>gi|260101870|ref|ZP_05752107.1| 30S ribosomal protein S18 [Lactobacillus helveticus DSM 20075]
 gi|260084298|gb|EEW68418.1| 30S ribosomal protein S18 [Lactobacillus helveticus DSM 20075]
          Length = 76

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 49/73 (67%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + ++    RRK   ++      +DYKD+ LL RF+S+RGKI+P R++  S K QR++A A
Sbjct: 1  MAQQRRGGRRKVDYIAANHIDYVDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKVANA 60

Query: 69 IKRARYLGLIAYV 81
          IKRAR +GL+ +V
Sbjct: 61 IKRARIMGLLPFV 73


>gi|163731326|ref|ZP_02138773.1| 30S ribosomal protein S18 [Roseobacter litoralis Och 149]
 gi|161394780|gb|EDQ19102.1| 30S ribosomal protein S18 [Roseobacter litoralis Och 149]
          Length = 75

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 46/72 (63%), Positives = 57/72 (79%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP+IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA+A
Sbjct: 1  MATKPFFRRRKVCPFSGDNAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|229542337|ref|ZP_04431397.1| ribosomal protein S18 [Bacillus coagulans 36D1]
 gi|229326757|gb|EEN92432.1| ribosomal protein S18 [Bacillus coagulans 36D1]
          Length = 79

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ 
Sbjct: 14 VCYFTANHITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTTAIKRARQMALLP 73

Query: 80 YV 81
          YV
Sbjct: 74 YV 75


>gi|85058325|ref|YP_454027.1| 30S ribosomal protein S18 [Sodalis glossinidius str. 'morsitans']
 gi|123766478|sp|Q2NW53|RS18_SODGM RecName: Full=30S ribosomal protein S18
 gi|256032361|pdb|3E1A|K Chain K, Structure Of The 30s Subunit And The Trnas Of E. Coli
          Ribosome In Pre-Accommodation State
 gi|256032418|pdb|3E1C|K Chain K, Structure Of The 30s Subunit And The Trnas Of E. Coli
          Ribosome In Post-Accommodation State
 gi|84778845|dbj|BAE73622.1| 30S ribosomal protein S18 [Sodalis glossinidius str. 'morsitans']
          Length = 75

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTTEGVVEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|149913883|ref|ZP_01902415.1| 30S ribosomal protein S18 [Roseobacter sp. AzwK-3b]
 gi|149812167|gb|EDM71998.1| 30S ribosomal protein S18 [Roseobacter sp. AzwK-3b]
          Length = 75

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 56/72 (77%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP IDYKD +LL R++S+RGKIVPSRI++VS KKQREL++A
Sbjct: 1  MAAKPFFRRRKVCPFSGDNAPAIDYKDTKLLQRYISERGKIVPSRITAVSAKKQRELSRA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|323487706|ref|ZP_08092964.1| ribosomal protein S18 [Planococcus donghaensis MPA1U2]
 gi|323398440|gb|EGA91228.1| ribosomal protein S18 [Planococcus donghaensis MPA1U2]
          Length = 78

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 45/71 (63%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    R+K C  +      IDYKD  LL +F+S+RGKI+P R++  S K QR+L  AIK
Sbjct: 4  RRGGKKRKKVCYFTSNNITHIDYKDTDLLKKFISERGKILPRRVTGTSAKWQRKLTIAIK 63

Query: 71 RARYLGLIAYV 81
          R+R + L+ +V
Sbjct: 64 RSRIMALLPFV 74


>gi|319404042|emb|CBI77630.1| 30S ribosomal protein S18 [Bartonella rochalimae ATCC BAA-1498]
          Length = 83

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 63/81 (77%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M        +RR   HRRK+CP SG  AP+IDYKDI+LL R++S+RGKI+PSRI++VS K
Sbjct: 1  MMTDIQQTSIRRPFHHRRKTCPFSGANAPKIDYKDIKLLQRYISERGKIIPSRITAVSQK 60

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA AIKRAR+LGL+ YV
Sbjct: 61 KQRELANAIKRARFLGLLPYV 81


>gi|313884313|ref|ZP_07818076.1| ribosomal protein S18 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620466|gb|EFR31892.1| ribosomal protein S18 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 77

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 37/62 (59%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C          DYKD+ LL RF+S +GKI+P R++    K QR L  AIKRAR +GL+
Sbjct: 12 KVCYFCANHIDHPDYKDVELLQRFISDKGKILPRRVTGTCAKHQRALTIAIKRARIMGLL 71

Query: 79 AY 80
           +
Sbjct: 72 PF 73


>gi|83589003|ref|YP_429012.1| 30S ribosomal protein S18 [Moorella thermoacetica ATCC 39073]
 gi|123753003|sp|Q2RM70|RS18_MOOTA RecName: Full=30S ribosomal protein S18
 gi|83571917|gb|ABC18469.1| SSU ribosomal protein S18P [Moorella thermoacetica ATCC 39073]
          Length = 75

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 38/62 (61%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C        ++DYKD+  L R++S+RGKI+P RIS      QR+L +AIKRAR L L+ 
Sbjct: 12 VCSFCVDKIEQVDYKDVNRLRRYISERGKILPRRISGNCAHHQRQLTRAIKRARALALLP 71

Query: 80 YV 81
          Y 
Sbjct: 72 YT 73


>gi|99080885|ref|YP_613039.1| 30S ribosomal protein S18 [Ruegeria sp. TM1040]
 gi|126728811|ref|ZP_01744626.1| 30S ribosomal protein S18 [Sagittula stellata E-37]
 gi|254460821|ref|ZP_05074237.1| ribosomal protein S18 [Rhodobacterales bacterium HTCC2083]
 gi|259418563|ref|ZP_05742480.1| ribosomal protein S18 [Silicibacter sp. TrichCH4B]
 gi|123252446|sp|Q1GHT9|RS18_SILST RecName: Full=30S ribosomal protein S18
 gi|99037165|gb|ABF63777.1| SSU ribosomal protein S18P [Ruegeria sp. TM1040]
 gi|126710741|gb|EBA09792.1| 30S ribosomal protein S18 [Sagittula stellata E-37]
 gi|206677410|gb|EDZ41897.1| ribosomal protein S18 [Rhodobacteraceae bacterium HTCC2083]
 gi|259344785|gb|EEW56639.1| ribosomal protein S18 [Silicibacter sp. TrichCH4B]
          Length = 75

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 46/72 (63%), Positives = 58/72 (80%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG+ AP+IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA+A
Sbjct: 1  MAAKPFFRRRKVCPFSGENAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|329850896|ref|ZP_08265741.1| ribosomal protein S18 [Asticcacaulis biprosthecum C19]
 gi|328841211|gb|EGF90782.1| ribosomal protein S18 [Asticcacaulis biprosthecum C19]
          Length = 92

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 55/63 (87%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELAKAIKRAR+L L+
Sbjct: 28 KVCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQKKQRELAKAIKRARFLALL 87

Query: 79 AYV 81
           YV
Sbjct: 88 PYV 90


>gi|292493500|ref|YP_003528939.1| ribosomal protein S18 [Nitrosococcus halophilus Nc4]
 gi|291582095|gb|ADE16552.1| ribosomal protein S18 [Nitrosococcus halophilus Nc4]
          Length = 74

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+L++A+KRA
Sbjct: 3  RYFRRRKFCRFTAEGVKEIDYKDLATLKEYITETGKIVPSRITGTKAKYQRQLSRAVKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLALLPYCD 72


>gi|90416567|ref|ZP_01224498.1| 30S ribosomal protein S18 [marine gamma proteobacterium HTCC2207]
 gi|90331766|gb|EAS46994.1| 30S ribosomal protein S18 [marine gamma proteobacterium HTCC2207]
          Length = 75

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 48/70 (68%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  S +GAP IDYKD+  L  ++S+ GKIVPSRI+    + QR+LA+AIKRA
Sbjct: 3  KFVRRRKFCRFSAEGAPEIDYKDLDTLKGYVSESGKIVPSRITGTKARYQRQLAEAIKRA 62

Query: 73 RYLGLIAYVN 82
          RY+ L+ Y +
Sbjct: 63 RYIALLPYTD 72


>gi|301062683|ref|ZP_07203301.1| ribosomal protein S18 [delta proteobacterium NaphS2]
 gi|300443206|gb|EFK07353.1| ribosomal protein S18 [delta proteobacterium NaphS2]
          Length = 93

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 42/77 (54%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P     R   HRRK C      +  IDYKD+++L  F ++RGKI P RIS    K QR L
Sbjct: 13 PNRGRFRKTYHRRKVCKFCADSSLSIDYKDVKILRYFTTERGKITPRRISGNCAKHQRML 72

Query: 66 AKAIKRARYLGLIAYVN 82
            AIKRAR + L+ Y  
Sbjct: 73 TVAIKRARNIALLPYTT 89


>gi|83945280|ref|ZP_00957629.1| 30S ribosomal protein S18 [Oceanicaulis alexandrii HTCC2633]
 gi|83851450|gb|EAP89306.1| 30S ribosomal protein S18 [Oceanicaulis alexandrii HTCC2633]
          Length = 84

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 48/70 (68%), Positives = 58/70 (82%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK CP SG+ AP+IDYKDI+LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 12 RRAFQRRRKVCPFSGENAPKIDYKDIKLLQRYMSERGKIVPSRITAVSAKKQRELARAIK 71

Query: 71 RARYLGLIAY 80
          RAR L L+ Y
Sbjct: 72 RARVLALLPY 81


>gi|290473411|ref|YP_003466277.1| 30S ribosomal subunit protein S18 [Xenorhabdus bovienii SS-2004]
 gi|289172710|emb|CBJ79481.1| 30S ribosomal subunit protein S18 [Xenorhabdus bovienii SS-2004]
          Length = 75

 Score = 98.5 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVQEIDYKDIVTLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|319408306|emb|CBI81959.1| 30S ribosomal protein S18 [Bartonella schoenbuchensis R1]
          Length = 82

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 54/81 (66%), Positives = 66/81 (81%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M E+  TP+ RR    RRK+CP SG  AP+IDYKDI+LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MIEINQTPV-RRPFHRRRKTCPFSGANAPKIDYKDIKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELA AIKRAR+LGL+ YV
Sbjct: 60 KQRELANAIKRARFLGLLPYV 80


>gi|83949661|ref|ZP_00958394.1| 30S ribosomal protein S18 [Roseovarius nubinhibens ISM]
 gi|84503441|ref|ZP_01001501.1| 30S ribosomal protein S18 [Oceanicola batsensis HTCC2597]
 gi|83837560|gb|EAP76856.1| 30S ribosomal protein S18 [Roseovarius nubinhibens ISM]
 gi|84388228|gb|EAQ01180.1| 30S ribosomal protein S18 [Oceanicola batsensis HTCC2597]
          Length = 75

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/72 (62%), Positives = 58/72 (80%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG+ AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+A
Sbjct: 1  MAAKPFFRRRKVCPFSGENAPKIDYKDTKLLQRYISERGKIVPSRITAVSAKKQRELARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|270308305|ref|YP_003330363.1| ribosomal protein S18 [Dehalococcoides sp. VS]
 gi|270154197|gb|ACZ62035.1| ribosomal protein S18 [Dehalococcoides sp. VS]
          Length = 147

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 44/77 (57%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P    R   + +RK C    +   RIDYKD   L R++S RGKI P R +    + QR L
Sbjct: 10 PARGGRGRYTPKRKICSFCAEKVSRIDYKDSAKLARYISDRGKIEPRRRTGTCARHQRAL 69

Query: 66 AKAIKRARYLGLIAYVN 82
          A AIKRAR++ L+ +V+
Sbjct: 70 ANAIKRARFIALMPFVS 86


>gi|86138735|ref|ZP_01057307.1| 30S ribosomal protein S18 [Roseobacter sp. MED193]
 gi|126739374|ref|ZP_01755067.1| 30S ribosomal protein S18 [Roseobacter sp. SK209-2-6]
 gi|159044730|ref|YP_001533524.1| 30S ribosomal protein S18 [Dinoroseobacter shibae DFL 12]
 gi|163736681|ref|ZP_02144100.1| 30S ribosomal protein S18 [Phaeobacter gallaeciensis BS107]
 gi|163742692|ref|ZP_02150077.1| 30S ribosomal protein S18 [Phaeobacter gallaeciensis 2.10]
 gi|254463996|ref|ZP_05077407.1| ribosomal protein S18 [Rhodobacterales bacterium Y4I]
 gi|254475704|ref|ZP_05089090.1| ribosomal protein S18 [Ruegeria sp. R11]
 gi|254511035|ref|ZP_05123102.1| ribosomal protein S18 [Rhodobacteraceae bacterium KLH11]
 gi|260433335|ref|ZP_05787306.1| ribosomal protein S18 [Silicibacter lacuscaerulensis ITI-1157]
 gi|189029676|sp|A8LQQ6|RS18_DINSH RecName: Full=30S ribosomal protein S18
 gi|85824382|gb|EAQ44585.1| 30S ribosomal protein S18 [Roseobacter sp. MED193]
 gi|126719474|gb|EBA16183.1| 30S ribosomal protein S18 [Roseobacter sp. SK209-2-6]
 gi|157912490|gb|ABV93923.1| 30S ribosomal protein S18 [Dinoroseobacter shibae DFL 12]
 gi|161383947|gb|EDQ08331.1| 30S ribosomal protein S18 [Phaeobacter gallaeciensis 2.10]
 gi|161390551|gb|EDQ14901.1| 30S ribosomal protein S18 [Phaeobacter gallaeciensis BS107]
 gi|206684904|gb|EDZ45386.1| ribosomal protein S18 [Rhodobacterales bacterium Y4I]
 gi|214029947|gb|EEB70782.1| ribosomal protein S18 [Ruegeria sp. R11]
 gi|221534746|gb|EEE37734.1| ribosomal protein S18 [Rhodobacteraceae bacterium KLH11]
 gi|260417163|gb|EEX10422.1| ribosomal protein S18 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 75

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 46/72 (63%), Positives = 57/72 (79%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP+IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA+A
Sbjct: 1  MAAKPFFRRRKVCPFSGDNAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|30248220|ref|NP_840290.1| 30S ribosomal protein S18 [Nitrosomonas europaea ATCC 19718]
 gi|30180105|emb|CAD84107.1| Ribosomal protein S18 [Nitrosomonas europaea ATCC 19718]
          Length = 92

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 48/80 (60%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +     +  R +  R+K C  + +G   IDYKDI LL  F+S+ G+I+P+RI+      Q
Sbjct: 11 KRMKDRMANRPLFKRKKFCRFTAEGIKHIDYKDIDLLKDFVSENGRIIPARITGTRAYYQ 70

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AI+RAR+L L+ Y +
Sbjct: 71 RQLNLAIERARFLALLPYTD 90


>gi|253681270|ref|ZP_04862068.1| ribosomal protein S18 [Clostridium botulinum D str. 1873]
 gi|331268206|ref|YP_004394698.1| 30S ribosomal protein S18 [Clostridium botulinum BKT015925]
 gi|253562508|gb|EES91959.1| ribosomal protein S18 [Clostridium botulinum D str. 1873]
 gi|329124756|gb|AEB74701.1| ribosomal protein S18 [Clostridium botulinum BKT015925]
          Length = 78

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 38/63 (60%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C      +  IDYKD+  L +F+++RGKI+P RIS    K QREL  AIKRAR + L+ 
Sbjct: 15 VCAFCADKSSFIDYKDVNKLRKFVTERGKILPRRISGNCAKHQRELTLAIKRARNVALLP 74

Query: 80 YVN 82
          +  
Sbjct: 75 FTT 77


>gi|312898031|ref|ZP_07757437.1| ribosomal protein S18 [Megasphaera micronuciformis F0359]
 gi|310620856|gb|EFQ04410.1| ribosomal protein S18 [Megasphaera micronuciformis F0359]
          Length = 76

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 37/63 (58%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD   L RF ++RGKI+P R+S V  K QR+L  AIKRAR + L+
Sbjct: 12 KVCNFCVDHIEEIDYKDTAKLRRFTTERGKILPRRVSGVCAKHQRKLTVAIKRARAIALL 71

Query: 79 AYV 81
           Y 
Sbjct: 72 PYT 74


>gi|255284244|ref|ZP_05348799.1| ribosomal protein S18 [Bryantella formatexigens DSM 14469]
 gi|255265197|gb|EET58402.1| ribosomal protein S18 [Bryantella formatexigens DSM 14469]
          Length = 87

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 50/79 (63%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          + A +P+ RR    R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K Q
Sbjct: 7  DRADSPMKRRGGRRRKKVCVFCGKENNEIDYKDVAKLKKYVSERGKILPRRITGTCAKHQ 66

Query: 63 RELAKAIKRARYLGLIAYV 81
          R L  AIKRAR+L ++ YV
Sbjct: 67 RSLTVAIKRARHLAMMPYV 85


>gi|328956357|ref|YP_004373690.1| SSU ribosomal protein S18P [Coriobacterium glomerans PW2]
 gi|328456681|gb|AEB07875.1| SSU ribosomal protein S18P [Coriobacterium glomerans PW2]
          Length = 88

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 41/68 (60%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             RRK C    +    IDYKDI+LL ++++ RGKI P R++    + Q ++A AIKRAR
Sbjct: 8  RQPRRKYCQFCKENTEHIDYKDIQLLRKYMTDRGKIKPRRVTGTCTQHQHDIANAIKRAR 67

Query: 74 YLGLIAYV 81
           + L+ Y 
Sbjct: 68 EMALLPYT 75


>gi|259500769|ref|ZP_05743671.1| 30S ribosomal protein S18 [Lactobacillus iners DSM 13335]
 gi|302190780|ref|ZP_07267034.1| ribosomal protein S18 [Lactobacillus iners AB-1]
 gi|309804084|ref|ZP_07698165.1| ribosomal protein S18 [Lactobacillus iners LactinV 11V1-d]
 gi|309804852|ref|ZP_07698914.1| ribosomal protein S18 [Lactobacillus iners LactinV 09V1-c]
 gi|309805906|ref|ZP_07699938.1| ribosomal protein S18 [Lactobacillus iners LactinV 03V1-b]
 gi|309807825|ref|ZP_07701757.1| ribosomal protein S18 [Lactobacillus iners LactinV 01V1-a]
 gi|309809776|ref|ZP_07703630.1| ribosomal protein S18 [Lactobacillus iners SPIN 2503V10-D]
 gi|312871319|ref|ZP_07731417.1| ribosomal protein S18 [Lactobacillus iners LEAF 3008A-a]
 gi|312872794|ref|ZP_07732859.1| ribosomal protein S18 [Lactobacillus iners LEAF 2062A-h1]
 gi|312873277|ref|ZP_07733332.1| ribosomal protein S18 [Lactobacillus iners LEAF 2052A-d]
 gi|312874897|ref|ZP_07734916.1| ribosomal protein S18 [Lactobacillus iners LEAF 2053A-b]
 gi|315654139|ref|ZP_07907055.1| 30S ribosomal protein S18 [Lactobacillus iners ATCC 55195]
 gi|325912331|ref|ZP_08174728.1| ribosomal protein S18 [Lactobacillus iners UPII 143-D]
 gi|325913704|ref|ZP_08176066.1| ribosomal protein S18 [Lactobacillus iners UPII 60-B]
 gi|329919826|ref|ZP_08276777.1| ribosomal protein S18 [Lactobacillus iners SPIN 1401G]
 gi|259167463|gb|EEW51958.1| 30S ribosomal protein S18 [Lactobacillus iners DSM 13335]
 gi|308163852|gb|EFO66118.1| ribosomal protein S18 [Lactobacillus iners LactinV 11V1-d]
 gi|308165791|gb|EFO68012.1| ribosomal protein S18 [Lactobacillus iners LactinV 09V1-c]
 gi|308167682|gb|EFO69829.1| ribosomal protein S18 [Lactobacillus iners LactinV 03V1-b]
 gi|308168927|gb|EFO71013.1| ribosomal protein S18 [Lactobacillus iners LactinV 01V1-a]
 gi|308169955|gb|EFO71994.1| ribosomal protein S18 [Lactobacillus iners SPIN 2503V10-D]
 gi|311089642|gb|EFQ48067.1| ribosomal protein S18 [Lactobacillus iners LEAF 2053A-b]
 gi|311091157|gb|EFQ49546.1| ribosomal protein S18 [Lactobacillus iners LEAF 2052A-d]
 gi|311091836|gb|EFQ50215.1| ribosomal protein S18 [Lactobacillus iners LEAF 2062A-h1]
 gi|311093333|gb|EFQ51679.1| ribosomal protein S18 [Lactobacillus iners LEAF 3008A-a]
 gi|315488835|gb|EFU78481.1| 30S ribosomal protein S18 [Lactobacillus iners ATCC 55195]
 gi|325475990|gb|EGC79159.1| ribosomal protein S18 [Lactobacillus iners UPII 143-D]
 gi|325477063|gb|EGC80213.1| ribosomal protein S18 [Lactobacillus iners UPII 60-B]
 gi|328937173|gb|EGG33601.1| ribosomal protein S18 [Lactobacillus iners SPIN 1401G]
          Length = 78

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 43/64 (67%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   +S      IDYKD+ LL RF+S+RGKI+P R++  S K QR L  AIKRAR +GL+
Sbjct: 13 KVDFISANHIDYIDYKDVDLLKRFISERGKILPRRVTGTSAKNQRMLTVAIKRARVMGLL 72

Query: 79 AYVN 82
           +V+
Sbjct: 73 PFVS 76


>gi|119713694|gb|ABL97744.1| ribosomal protein S18 [uncultured marine bacterium EB0_41B09]
          Length = 75

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 50/73 (68%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R++  RR+ C  S +G   +DYKD+ +L  F+++ GK++P+RI+    + QR+L+ A+
Sbjct: 1  MARDMYKRRRYCRFSAEGISEVDYKDVSILKDFITENGKLIPARITGTKARYQRQLSTAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ + +
Sbjct: 61 KRARFLALLPFTD 73


>gi|56697143|ref|YP_167506.1| 30S ribosomal protein S18 [Ruegeria pomeroyi DSS-3]
 gi|84684848|ref|ZP_01012748.1| 30S ribosomal protein S18 [Maritimibacter alkaliphilus HTCC2654]
 gi|81676223|sp|Q5LR49|RS18_SILPO RecName: Full=30S ribosomal protein S18
 gi|56678880|gb|AAV95546.1| ribosomal protein S18 [Ruegeria pomeroyi DSS-3]
 gi|84667183|gb|EAQ13653.1| 30S ribosomal protein S18 [Rhodobacterales bacterium HTCC2654]
          Length = 75

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/72 (62%), Positives = 57/72 (79%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+A
Sbjct: 1  MAAKPFFRRRKVCPFSGDNAPKIDYKDTKLLQRYISERGKIVPSRITAVSAKKQRELARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|16799118|ref|NP_469386.1| 30S ribosomal protein S18 [Listeria innocua Clip11262]
 gi|16802094|ref|NP_463579.1| 30S ribosomal protein S18 [Listeria monocytogenes EGD-e]
 gi|46906277|ref|YP_012666.1| 30S ribosomal protein S18 [Listeria monocytogenes serotype 4b
          str. F2365]
 gi|47092171|ref|ZP_00229963.1| ribosomal protein S18 [Listeria monocytogenes str. 4b H7858]
 gi|47095114|ref|ZP_00232726.1| ribosomal protein S18 [Listeria monocytogenes str. 1/2a F6854]
 gi|116871459|ref|YP_848240.1| 30S ribosomal protein S18 [Listeria welshimeri serovar 6b str.
          SLCC5334]
 gi|217965895|ref|YP_002351573.1| ribosomal protein S18 [Listeria monocytogenes HCC23]
 gi|224498256|ref|ZP_03666605.1| 30S ribosomal protein S18 [Listeria monocytogenes Finland 1988]
 gi|224503029|ref|ZP_03671336.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL R2-561]
 gi|226222691|ref|YP_002756798.1| ribosomal protein S18 [Listeria monocytogenes Clip81459]
 gi|254824725|ref|ZP_05229726.1| rpsR [Listeria monocytogenes FSL J1-194]
 gi|254827477|ref|ZP_05232164.1| ribosomal protein S18 [Listeria monocytogenes FSL N3-165]
 gi|254830661|ref|ZP_05235316.1| 30S ribosomal protein S18 [Listeria monocytogenes 10403S]
 gi|254851788|ref|ZP_05241136.1| rpsR [Listeria monocytogenes FSL R2-503]
 gi|254899633|ref|ZP_05259557.1| 30S ribosomal protein S18 [Listeria monocytogenes J0161]
 gi|254913164|ref|ZP_05263176.1| ribosomal protein S18 [Listeria monocytogenes J2818]
 gi|254930815|ref|ZP_05264174.1| ribosomal protein S18 [Listeria monocytogenes HPB2262]
 gi|254937545|ref|ZP_05269242.1| ribosomal protein S18 [Listeria monocytogenes F6900]
 gi|254992264|ref|ZP_05274454.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J2-064]
 gi|255017794|ref|ZP_05289920.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL F2-515]
 gi|255022435|ref|ZP_05294421.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J1-208]
 gi|255025177|ref|ZP_05297163.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J2-003]
 gi|255030368|ref|ZP_05302319.1| 30S ribosomal protein S18 [Listeria monocytogenes LO28]
 gi|255519953|ref|ZP_05387190.1| 30S ribosomal protein S18 [Listeria monocytogenes FSL J1-175]
 gi|284803213|ref|YP_003415078.1| 30S ribosomal protein S18 [Listeria monocytogenes 08-5578]
 gi|284996354|ref|YP_003418122.1| 30S ribosomal protein S18 [Listeria monocytogenes 08-5923]
 gi|289433406|ref|YP_003463278.1| 30S ribosomal protein S18 [Listeria seeligeri serovar 1/2b str.
          SLCC3954]
 gi|290892370|ref|ZP_06555365.1| ribosomal protein S18 [Listeria monocytogenes FSL J2-071]
 gi|300765696|ref|ZP_07075673.1| ribosomal protein S18 [Listeria monocytogenes FSL N1-017]
 gi|54039413|sp|P66462|RS18_LISIN RecName: Full=30S ribosomal protein S18
 gi|54042148|sp|P66461|RS18_LISMO RecName: Full=30S ribosomal protein S18
 gi|59798761|sp|Q725B8|RS18_LISMF RecName: Full=30S ribosomal protein S18
 gi|123463368|sp|A0AEM3|RS18_LISW6 RecName: Full=30S ribosomal protein S18
 gi|254812945|sp|B8DAM0|RS18_LISMH RecName: Full=30S ribosomal protein S18
 gi|259494813|sp|C1KV87|RS18_LISMC RecName: Full=30S ribosomal protein S18
 gi|16409405|emb|CAC98261.1| ribosomal protein S18 [Listeria monocytogenes EGD-e]
 gi|16412460|emb|CAC95272.1| ribosomal protein S18 [Listeria innocua Clip11262]
 gi|46879541|gb|AAT02843.1| ribosomal protein S18 [Listeria monocytogenes serotype 4b str.
          F2365]
 gi|47016459|gb|EAL07380.1| ribosomal protein S18 [Listeria monocytogenes str. 1/2a F6854]
 gi|47019373|gb|EAL10114.1| ribosomal protein S18 [Listeria monocytogenes str. 4b H7858]
 gi|116740337|emb|CAK19455.1| 30S ribosomal protein S18 [Listeria welshimeri serovar 6b str.
          SLCC5334]
 gi|217335165|gb|ACK40959.1| ribosomal protein S18 [Listeria monocytogenes HCC23]
 gi|225875153|emb|CAS03845.1| ribosomal protein S18 [Listeria monocytogenes serotype 4b str.
          CLIP 80459]
 gi|258599854|gb|EEW13179.1| ribosomal protein S18 [Listeria monocytogenes FSL N3-165]
 gi|258605081|gb|EEW17689.1| rpsR [Listeria monocytogenes FSL R2-503]
 gi|258610146|gb|EEW22754.1| ribosomal protein S18 [Listeria monocytogenes F6900]
 gi|284058775|gb|ADB69716.1| 30S ribosomal protein S18 [Listeria monocytogenes 08-5578]
 gi|284061821|gb|ADB72760.1| 30S ribosomal protein S18 [Listeria monocytogenes 08-5923]
 gi|289169650|emb|CBH26186.1| 30S ribosomal protein S18 [Listeria seeligeri serovar 1/2b str.
          SLCC3954]
 gi|290558196|gb|EFD91715.1| ribosomal protein S18 [Listeria monocytogenes FSL J2-071]
 gi|293582357|gb|EFF94389.1| ribosomal protein S18 [Listeria monocytogenes HPB2262]
 gi|293591165|gb|EFF99499.1| ribosomal protein S18 [Listeria monocytogenes J2818]
 gi|293593964|gb|EFG01725.1| rpsR [Listeria monocytogenes FSL J1-194]
 gi|300513569|gb|EFK40639.1| ribosomal protein S18 [Listeria monocytogenes FSL N1-017]
 gi|307569562|emb|CAR82741.1| rpsR [Listeria monocytogenes L99]
 gi|328468374|gb|EGF39380.1| 30S ribosomal protein S18 [Listeria monocytogenes 1816]
 gi|328476182|gb|EGF46888.1| 30S ribosomal protein S18 [Listeria monocytogenes 220]
 gi|332310392|gb|EGJ23487.1| 30S ribosomal protein S18 [Listeria monocytogenes str. Scott A]
          Length = 79

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/64 (46%), Positives = 44/64 (68%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C  +  G   IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKR+R + L
Sbjct: 12 KKVCYFTSNGITHIDYKDVELLKKFVSERGKILPRRVTGTSAKYQRKLTVAIKRSRQMAL 71

Query: 78 IAYV 81
          + +V
Sbjct: 72 LPFV 75


>gi|260881441|ref|ZP_05404417.2| ribosomal protein S18 [Mitsuokella multacida DSM 20544]
 gi|260848791|gb|EEX68798.1| ribosomal protein S18 [Mitsuokella multacida DSM 20544]
          Length = 77

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 38/63 (60%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD+  L RF+++RGKI+P RIS    K QR++  AIKRAR + L+
Sbjct: 13 KVCSFCVDKVDHIDYKDVAKLRRFVTERGKILPRRISGNCAKHQRQVTVAIKRARNIALL 72

Query: 79 AYV 81
           + 
Sbjct: 73 PFT 75


>gi|332185156|ref|ZP_08386905.1| ribosomal protein S18 [Sphingomonas sp. S17]
 gi|332014880|gb|EGI56936.1| ribosomal protein S18 [Sphingomonas sp. S17]
          Length = 74

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 52/72 (72%), Positives = 60/72 (83%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP S K APRIDYKD+RLL  F+S+RGKIVPSRI+SVS KKQRELA+AI
Sbjct: 1  MARPFFRRRKSCPFSAKDAPRIDYKDVRLLQGFVSERGKIVPSRITSVSAKKQRELAQAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR+LGL+ YV
Sbjct: 61 KRARHLGLLPYV 72


>gi|288572897|ref|ZP_06391254.1| ribosomal protein S18 [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288568638|gb|EFC90195.1| ribosomal protein S18 [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 79

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 41/70 (58%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +R    R K C         +DYKD+  L +++S+RGKIVP R++      QR+L  A+K
Sbjct: 7  KRRGKRRPKVCFYCVDKIDSVDYKDVDRLRKYISERGKIVPRRVTGNCANHQRQLTVALK 66

Query: 71 RARYLGLIAY 80
          RARY+ L+ Y
Sbjct: 67 RARYMALLPY 76


>gi|331003444|ref|ZP_08326943.1| hypothetical protein HMPREF0491_01805 [Lachnospiraceae oral taxon
          107 str. F0167]
 gi|330412490|gb|EGG91879.1| hypothetical protein HMPREF0491_01805 [Lachnospiraceae oral taxon
          107 str. F0167]
          Length = 89

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 43/67 (64%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            R+K C   G     IDYKD+  L +++S+RGKI+P RIS    K QRE+  AIK+AR+
Sbjct: 21 RRRKKVCTFCGDKEKAIDYKDVATLRKYISERGKILPRRISGSCAKHQREITVAIKKARH 80

Query: 75 LGLIAYV 81
          + L+ YV
Sbjct: 81 IALLPYV 87


>gi|315652548|ref|ZP_07905530.1| 30S ribosomal protein S18 [Eubacterium saburreum DSM 3986]
 gi|315485191|gb|EFU75591.1| 30S ribosomal protein S18 [Eubacterium saburreum DSM 3986]
          Length = 89

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 45/75 (60%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
                 +  R+K C   G+    IDYKD+  L +++S+RGKI+P RIS    K QRE+ 
Sbjct: 13 KRRPANGLRRRKKVCAFCGEKEKAIDYKDVATLRKYISERGKILPRRISGSCAKHQREIT 72

Query: 67 KAIKRARYLGLIAYV 81
           AIK+AR++ L+ YV
Sbjct: 73 VAIKKARHIALLPYV 87


>gi|304392028|ref|ZP_07373970.1| ribosomal protein S18 [Ahrensia sp. R2A130]
 gi|303296257|gb|EFL90615.1| ribosomal protein S18 [Ahrensia sp. R2A130]
          Length = 82

 Score = 98.1 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 48/71 (67%), Positives = 61/71 (85%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G+ AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 10 RRPFQRRRKTCPFTGENAPKIDYKDVKLLQRYISERGKIVPSRITAVSLKKQRELARAIK 69

Query: 71 RARYLGLIAYV 81
          RAR+L LI YV
Sbjct: 70 RARFLALIPYV 80


>gi|226323516|ref|ZP_03799034.1| hypothetical protein COPCOM_01291 [Coprococcus comes ATCC 27758]
 gi|225208200|gb|EEG90554.1| hypothetical protein COPCOM_01291 [Coprococcus comes ATCC 27758]
          Length = 87

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 47/79 (59%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
              +P+ RR    R+K C   GK    IDYKD   L +++S+RGKI+P RI+    K Q
Sbjct: 7  NRPDSPMKRRGGRRRKKVCVFCGKENNEIDYKDTAKLKKYVSERGKILPRRITGNCAKHQ 66

Query: 63 RELAKAIKRARYLGLIAYV 81
          R L  AIKRAR++ L+ YV
Sbjct: 67 RALTVAIKRARHIALMPYV 85


>gi|75763190|ref|ZP_00742955.1| SSU ribosomal protein S18P [Bacillus thuringiensis serovar
          israelensis ATCC 35646]
 gi|74489322|gb|EAO52773.1| SSU ribosomal protein S18P [Bacillus thuringiensis serovar
          israelensis ATCC 35646]
          Length = 64

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 43/61 (70%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G  RIDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR + L+ Y
Sbjct: 2  CFFTANGITRIDYKDVDLLKRFVSERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLPY 61

Query: 81 V 81
          V
Sbjct: 62 V 62


>gi|258546023|ref|ZP_05706257.1| 50S ribosomal protein L21 [Cardiobacterium hominis ATCC 15826]
 gi|258518752|gb|EEV87611.1| 50S ribosomal protein L21 [Cardiobacterium hominis ATCC 15826]
          Length = 70

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR+SC  + +G   IDYKD+  L  FL++ GKIVP+RI+  +   QR+LA AIKRAR+L 
Sbjct: 3  RRRSCRFTAEGVKEIDYKDLETLKAFLTETGKIVPARITGTNAFYQRQLATAIKRARFLA 62

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 63 LLPYSD 68


>gi|22537851|ref|NP_688702.1| 30S ribosomal protein S18 [Streptococcus agalactiae 2603V/R]
 gi|25011796|ref|NP_736191.1| 30S ribosomal protein S18 [Streptococcus agalactiae NEM316]
 gi|76786818|ref|YP_330321.1| 30S ribosomal protein S18 [Streptococcus agalactiae A909]
 gi|76798964|ref|ZP_00781165.1| ribosomal protein S18 [Streptococcus agalactiae 18RS21]
 gi|77406986|ref|ZP_00784002.1| ribosomal protein S18 [Streptococcus agalactiae H36B]
 gi|77410339|ref|ZP_00786755.1| ribosomal protein S18 [Streptococcus agalactiae COH1]
 gi|77412637|ref|ZP_00788913.1| ribosomal protein S18 [Streptococcus agalactiae CJB111]
 gi|228477147|ref|ZP_04061785.1| ribosomal protein S18 [Streptococcus salivarius SK126]
 gi|312863068|ref|ZP_07723306.1| ribosomal protein S18 [Streptococcus vestibularis F0396]
 gi|322516033|ref|ZP_08068970.1| 30S ribosomal protein S18 [Streptococcus vestibularis ATCC 49124]
 gi|59798902|sp|Q8DXY3|RS18_STRA5 RecName: Full=30S ribosomal protein S18
 gi|59798903|sp|Q8E3K2|RS18_STRA3 RecName: Full=30S ribosomal protein S18
 gi|123601328|sp|Q3JZI2|RS18_STRA1 RecName: Full=30S ribosomal protein S18
 gi|22534746|gb|AAN00575.1|AE014269_19 ribosomal protein S18 [Streptococcus agalactiae 2603V/R]
 gi|24413337|emb|CAD47416.1| 30S ribosomal protein S18 [Streptococcus agalactiae NEM316]
 gi|76561875|gb|ABA44459.1| ribosomal protein S18 [Streptococcus agalactiae A909]
 gi|76585685|gb|EAO62242.1| ribosomal protein S18 [Streptococcus agalactiae 18RS21]
 gi|77161309|gb|EAO72344.1| ribosomal protein S18 [Streptococcus agalactiae CJB111]
 gi|77171052|gb|EAO74505.1| ribosomal protein S18 [Streptococcus agalactiae COH1]
 gi|77174410|gb|EAO77263.1| ribosomal protein S18 [Streptococcus agalactiae H36B]
 gi|228251166|gb|EEK10337.1| ribosomal protein S18 [Streptococcus salivarius SK126]
 gi|311100604|gb|EFQ58809.1| ribosomal protein S18 [Streptococcus vestibularis F0396]
 gi|319745682|gb|EFV97981.1| 30S ribosomal protein S18 [Streptococcus agalactiae ATCC 13813]
 gi|322125448|gb|EFX96794.1| 30S ribosomal protein S18 [Streptococcus vestibularis ATCC 49124]
          Length = 79

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 46/74 (62%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
            R     R+K   ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  A
Sbjct: 4  QRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTA 63

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ YVN
Sbjct: 64 IKRARVMALMPYVN 77


>gi|114332337|ref|YP_748559.1| 30S ribosomal protein S18 [Nitrosomonas eutropha C91]
 gi|114309351|gb|ABI60594.1| SSU ribosomal protein S18P [Nitrosomonas eutropha C91]
          Length = 92

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/80 (37%), Positives = 48/80 (60%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
                +  R +  R+K C  + +G  +IDYKD+ LL  F+S+ G+I+P+RI+      Q
Sbjct: 11 NKMKDRMANRPLFKRKKFCRFTAEGIKKIDYKDVDLLKDFISENGRIIPARITGTRSYYQ 70

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AI+RAR+L L+ Y +
Sbjct: 71 RQLNLAIERARFLALLPYTD 90


>gi|15675656|ref|NP_269830.1| 30S ribosomal protein S18 [Streptococcus pyogenes M1 GAS]
 gi|19746762|ref|NP_607898.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS8232]
 gi|21911116|ref|NP_665384.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS315]
 gi|28895199|ref|NP_801549.1| 30S ribosomal protein S18 [Streptococcus pyogenes SSI-1]
 gi|50914911|ref|YP_060883.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS10394]
 gi|71904202|ref|YP_281005.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS6180]
 gi|71911366|ref|YP_282916.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS5005]
 gi|94989188|ref|YP_597289.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS9429]
 gi|94991129|ref|YP_599229.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS10270]
 gi|94993075|ref|YP_601174.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS2096]
 gi|94995008|ref|YP_603106.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS10750]
 gi|139473173|ref|YP_001127888.1| 30S ribosomal protein S18 [Streptococcus pyogenes str. Manfredo]
 gi|195977489|ref|YP_002122733.1| 30S ribosomal protein S18 [Streptococcus equi subsp.
          zooepidemicus MGCS10565]
 gi|222153664|ref|YP_002562841.1| 30S ribosomal protein S18 [Streptococcus uberis 0140J]
 gi|225869195|ref|YP_002745143.1| 30S ribosomal protein S18 [Streptococcus equi subsp.
          zooepidemicus]
 gi|225869851|ref|YP_002745798.1| 30S ribosomal protein S18 [Streptococcus equi subsp. equi 4047]
 gi|251783273|ref|YP_002997578.1| 30S ribosomal protein S18 [Streptococcus dysgalactiae subsp.
          equisimilis GGS_124]
 gi|306826730|ref|ZP_07460032.1| 30S ribosomal protein S18 [Streptococcus pyogenes ATCC 10782]
 gi|313889713|ref|ZP_07823356.1| ribosomal protein S18 [Streptococcus pseudoporcinus SPIN 20026]
 gi|332523695|ref|ZP_08399947.1| ribosomal protein S18 [Streptococcus porcinus str. Jelinkova 176]
 gi|54039418|sp|P66476|RS18_STRP3 RecName: Full=30S ribosomal protein S18
 gi|54039419|sp|P66477|RS18_STRP8 RecName: Full=30S ribosomal protein S18
 gi|54042151|sp|P66475|RS18_STRP1 RecName: Full=30S ribosomal protein S18
 gi|59798612|sp|Q5XA63|RS18_STRP6 RecName: Full=30S ribosomal protein S18
 gi|122986815|sp|Q1J524|RS18_STRPF RecName: Full=30S ribosomal protein S18
 gi|123080292|sp|Q1JF74|RS18_STRPD RecName: Full=30S ribosomal protein S18
 gi|123382262|sp|Q1JA31|RS18_STRPB RecName: Full=30S ribosomal protein S18
 gi|123382494|sp|Q1JK78|RS18_STRPC RecName: Full=30S ribosomal protein S18
 gi|123761392|sp|Q48RL0|RS18_STRPM RecName: Full=30S ribosomal protein S18
 gi|166222246|sp|A2RCR6|RS18_STRPG RecName: Full=30S ribosomal protein S18
 gi|229560067|sp|B4U153|RS18_STREM RecName: Full=30S ribosomal protein S18
 gi|254812956|sp|C0MB81|RS18_STRE4 RecName: Full=30S ribosomal protein S18
 gi|254812959|sp|B9DVK2|RS18_STRU0 RecName: Full=30S ribosomal protein S18
 gi|259494819|sp|C0MEL9|RS18_STRS7 RecName: Full=30S ribosomal protein S18
 gi|13622868|gb|AAK34551.1| 30S ribosomal protein S18 [Streptococcus pyogenes M1 GAS]
 gi|19748993|gb|AAL98397.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS8232]
 gi|21905326|gb|AAM80187.1| 30S ribosomal protein S18 [Streptococcus pyogenes MGAS315]
 gi|28810445|dbj|BAC63382.1| 30S ribosomal protein S18 [Streptococcus pyogenes SSI-1]
 gi|50903985|gb|AAT87700.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS10394]
 gi|71803297|gb|AAX72650.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS6180]
 gi|71854148|gb|AAZ52171.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS5005]
 gi|94542696|gb|ABF32745.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS9429]
 gi|94544637|gb|ABF34685.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS10270]
 gi|94546583|gb|ABF36630.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS2096]
 gi|94548516|gb|ABF38562.1| SSU ribosomal protein S18P [Streptococcus pyogenes MGAS10750]
 gi|134271419|emb|CAM29639.1| 30S ribosomal protein S18 [Streptococcus pyogenes str. Manfredo]
 gi|195974194|gb|ACG61720.1| 30S ribosomal protein S18 [Streptococcus equi subsp.
          zooepidemicus MGCS10565]
 gi|222114477|emb|CAR43335.1| 30S ribosomal protein S18 [Streptococcus uberis 0140J]
 gi|225699255|emb|CAW92568.1| 30S ribosomal protein S18 [Streptococcus equi subsp. equi 4047]
 gi|225702471|emb|CAX00375.1| 30S ribosomal protein S18 [Streptococcus equi subsp.
          zooepidemicus]
 gi|242391905|dbj|BAH82364.1| 30S ribosomal protein S18 [Streptococcus dysgalactiae subsp.
          equisimilis GGS_124]
 gi|304431019|gb|EFM34026.1| 30S ribosomal protein S18 [Streptococcus pyogenes ATCC 10782]
 gi|313122010|gb|EFR45106.1| ribosomal protein S18 [Streptococcus pseudoporcinus SPIN 20026]
 gi|322412656|gb|EFY03564.1| 30S ribosomal protein S18 [Streptococcus dysgalactiae subsp.
          dysgalactiae ATCC 27957]
 gi|323127997|gb|ADX25294.1| 30S ribosomal protein S18 [Streptococcus dysgalactiae subsp.
          equisimilis ATCC 12394]
 gi|332314959|gb|EGJ27944.1| ribosomal protein S18 [Streptococcus porcinus str. Jelinkova 176]
          Length = 79

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 46/74 (62%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
            R     R+K   ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  A
Sbjct: 4  QRRGGFKRRKKVDFIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTA 63

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ YVN
Sbjct: 64 IKRARVMALMPYVN 77


>gi|297585576|ref|YP_003701356.1| 30S ribosomal protein S18 [Bacillus selenitireducens MLS10]
 gi|297144033|gb|ADI00791.1| ribosomal protein S18 [Bacillus selenitireducens MLS10]
          Length = 75

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 48/74 (64%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR    RRK C  +     +IDYKD  LL +F+S+RGKI+P R++  S K QR+L +A
Sbjct: 1  MARRGRPKRRKVCYFTVNKITKIDYKDTDLLKKFISERGKILPRRVTGTSAKYQRQLTRA 60

Query: 69 IKRARYLGLIAYVN 82
          +KR+R + L+ +V 
Sbjct: 61 VKRSRTMALLPFVT 74


>gi|15804791|ref|NP_290832.1| 30S ribosomal protein S18 [Escherichia coli O157:H7 EDL933]
 gi|12519193|gb|AAG59398.1|AE005652_15 30S ribosomal subunit protein S18 [Escherichia coli O157:H7 str.
          EDL933]
          Length = 75

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDY+DI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVQEIDYEDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|114569762|ref|YP_756442.1| 30S ribosomal protein S18P [Maricaulis maris MCS10]
 gi|122316234|sp|Q0AQD3|RS18_MARMM RecName: Full=30S ribosomal protein S18
 gi|114340224|gb|ABI65504.1| SSU ribosomal protein S18P [Maricaulis maris MCS10]
          Length = 84

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 57/71 (80%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK CP SG+ AP ID+KD +LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 12 RRPFMRRRKVCPFSGENAPAIDFKDPKLLLRYMSERGKIVPSRITAVSAKKQRELARAIK 71

Query: 71 RARYLGLIAYV 81
          RAR L L+ YV
Sbjct: 72 RARQLALLPYV 82


>gi|110680236|ref|YP_683243.1| 30S ribosomal protein S18 [Roseobacter denitrificans OCh 114]
 gi|123065436|sp|Q164N6|RS18_ROSDO RecName: Full=30S ribosomal protein S18
 gi|109456352|gb|ABG32557.1| ribosomal protein S18 [Roseobacter denitrificans OCh 114]
          Length = 75

 Score = 98.1 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 46/72 (63%), Positives = 57/72 (79%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP+IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA+A
Sbjct: 1  MASKPFFRRRKVCPFSGDNAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|225850831|ref|YP_002731065.1| ribosomal protein S18 [Persephonella marina EX-H1]
 gi|225646076|gb|ACO04262.1| ribosomal protein S18 [Persephonella marina EX-H1]
          Length = 84

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 3/85 (3%)

Query: 1  MAEVAPTPLLRRN--VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVS 58
          MA    +P  +       R+K C    +G    +YKD   L +F+S+RGKI+P RIS   
Sbjct: 1  MANNVKSPTAQNKPFFQKRKKYCKFCAEGKEP-NYKDTEYLKQFISERGKIIPRRISGTC 59

Query: 59 HKKQRELAKAIKRARYLGLIAYVNL 83
           K QR+L   IKRAR L L+ YV +
Sbjct: 60 GKHQRKLTVEIKRARQLALLPYVIM 84


>gi|206901836|ref|YP_002251075.1| ribosomal protein S18 [Dictyoglomus thermophilum H-6-12]
 gi|254765427|sp|B5YEW7|RS18_DICT6 RecName: Full=30S ribosomal protein S18
 gi|206740939|gb|ACI19997.1| ribosomal protein S18 [Dictyoglomus thermophilum H-6-12]
          Length = 84

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 45/68 (66%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
           S ++K C    +    IDYK++  L RF++++GKI+P RIS    + QR+L+ AIKRAR
Sbjct: 15 YSSKKKFCVFCSEKIDYIDYKNVERLKRFMTEKGKIIPRRISGNCARHQRQLSTAIKRAR 74

Query: 74 YLGLIAYV 81
          Y+ L+ YV
Sbjct: 75 YMALLPYV 82


>gi|313205958|ref|YP_004045135.1| SSU ribosomal protein s18p [Riemerella anatipestifer DSM 15868]
 gi|312445274|gb|ADQ81629.1| SSU ribosomal protein S18P [Riemerella anatipestifer DSM 15868]
 gi|315022271|gb|EFT35299.1| SSU ribosomal protein S18p [Riemerella anatipestifer RA-YM]
 gi|325336603|gb|ADZ12877.1| Ribosomal protein S18 [Riemerella anatipestifer RA-GD]
          Length = 100

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 43/69 (62%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
          N    +K C     G   +DYKD   L +F++++GKI+P R +  S K QR+++ AIKRA
Sbjct: 27 NTKSEKKYCRFKKYGIKYVDYKDADFLLQFVNEQGKILPRRYTGTSLKYQRKVSAAIKRA 86

Query: 73 RYLGLIAYV 81
          R+L L+ YV
Sbjct: 87 RHLALMPYV 95


>gi|294851832|ref|ZP_06792505.1| 30S ribosomal protein S18 [Brucella sp. NVSL 07-0026]
 gi|294820421|gb|EFG37420.1| 30S ribosomal protein S18 [Brucella sp. NVSL 07-0026]
          Length = 82

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 64/81 (79%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    RRK+CP S   AP+IDYKD++LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRRKTCPFSSANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|260655513|ref|ZP_05861001.1| ribosomal protein S18 [Jonquetella anthropi E3_33 E1]
 gi|260629961|gb|EEX48155.1| ribosomal protein S18 [Jonquetella anthropi E3_33 E1]
          Length = 82

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 38/64 (59%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
           K C          DYKD+  L +++S+RGKIVP R++    K QR+L  AIKRAR++ L
Sbjct: 17 PKVCYYCADKLEHADYKDVDRLRKYVSERGKIVPRRVTGNCAKHQRQLTIAIKRARFMAL 76

Query: 78 IAYV 81
          + Y 
Sbjct: 77 LPYT 80


>gi|163857367|ref|YP_001631665.1| 30S ribosomal protein S18 [Bordetella petrii DSM 12804]
 gi|229559965|sp|A9IT96|RS18_BORPD RecName: Full=30S ribosomal protein S18
 gi|163261095|emb|CAP43397.1| 30S ribosomal protein S18 [Bordetella petrii]
          Length = 90

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 43/72 (59%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +  +  RRK C  +  G   IDYKD+  L  F+ + GKI+P+R++      QR+L  AIK
Sbjct: 16 QNPLFKRRKFCRFTAAGVEEIDYKDLDTLRDFVQENGKIIPARLTGTKAHYQRQLDTAIK 75

Query: 71 RARYLGLIAYVN 82
          RAR+L L+ Y +
Sbjct: 76 RARFLALLPYTD 87


>gi|149182312|ref|ZP_01860791.1| RpsR [Bacillus sp. SG-1]
 gi|148850004|gb|EDL64175.1| RpsR [Bacillus sp. SG-1]
          Length = 65

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/61 (50%), Positives = 42/61 (68%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C  +  G   IDYKD+ LL +F+S+RGKI+P R++  S K QR L +AIKRAR + L+ Y
Sbjct: 2  CYFTSNGITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRRLTRAIKRARTMALLPY 61

Query: 81 V 81
          V
Sbjct: 62 V 62


>gi|18311622|ref|NP_563556.1| 30S ribosomal protein S18 [Clostridium perfringens str. 13]
 gi|110801194|ref|YP_697330.1| 30S ribosomal protein S18 [Clostridium perfringens ATCC 13124]
 gi|110801451|ref|YP_699889.1| 30S ribosomal protein S18 [Clostridium perfringens SM101]
 gi|168207913|ref|ZP_02633918.1| ribosomal protein S18 [Clostridium perfringens E str. JGS1987]
 gi|168211574|ref|ZP_02637199.1| ribosomal protein S18 [Clostridium perfringens B str. ATCC 3626]
 gi|168214826|ref|ZP_02640451.1| ribosomal protein S18 [Clostridium perfringens CPE str. F4969]
 gi|168218034|ref|ZP_02643659.1| ribosomal protein S18 [Clostridium perfringens NCTC 8239]
 gi|169343454|ref|ZP_02864454.1| ribosomal protein S18 [Clostridium perfringens C str. JGS1495]
 gi|182626399|ref|ZP_02954152.1| ribosomal protein S18 [Clostridium perfringens D str. JGS1721]
 gi|20978678|sp|Q8XH45|RS18_CLOPE RecName: Full=30S ribosomal protein S18
 gi|122958625|sp|Q0TM10|RS18_CLOP1 RecName: Full=30S ribosomal protein S18
 gi|123341463|sp|Q0SPR8|RS18_CLOPS RecName: Full=30S ribosomal protein S18
 gi|18146306|dbj|BAB82346.1| 30S ribosomal protein S18 [Clostridium perfringens str. 13]
 gi|110675841|gb|ABG84828.1| 30S ribosomal protein S18 [Clostridium perfringens ATCC 13124]
 gi|110681952|gb|ABG85322.1| 30S ribosomal protein S18 [Clostridium perfringens SM101]
 gi|169298406|gb|EDS80495.1| ribosomal protein S18 [Clostridium perfringens C str. JGS1495]
 gi|170660796|gb|EDT13479.1| ribosomal protein S18 [Clostridium perfringens E str. JGS1987]
 gi|170710455|gb|EDT22637.1| ribosomal protein S18 [Clostridium perfringens B str. ATCC 3626]
 gi|170713723|gb|EDT25905.1| ribosomal protein S18 [Clostridium perfringens CPE str. F4969]
 gi|177908273|gb|EDT70826.1| ribosomal protein S18 [Clostridium perfringens D str. JGS1721]
 gi|182379953|gb|EDT77432.1| ribosomal protein S18 [Clostridium perfringens NCTC 8239]
          Length = 80

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 3/82 (3%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M+ V      RR    R+K C      A  IDYKD+  L +++++RGKI+P RIS    K
Sbjct: 1  MSNVKRGGKFRRA---RKKVCIFCVDKAESIDYKDVAKLKKYITERGKILPRRISGTCAK 57

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
           QR+L  AIKR+R + L+ +  
Sbjct: 58 HQRQLTDAIKRSRNIALLPFTT 79


>gi|55821724|ref|YP_140166.1| 30S ribosomal protein S18 [Streptococcus thermophilus LMG 18311]
 gi|55823644|ref|YP_142085.1| 30S ribosomal protein S18 [Streptococcus thermophilus CNRZ1066]
 gi|116628444|ref|YP_821063.1| 30S ribosomal protein S18 [Streptococcus thermophilus LMD-9]
 gi|81676514|sp|Q5LY50|RS18_STRT1 RecName: Full=30S ribosomal protein S18
 gi|81676666|sp|Q5M2Q5|RS18_STRT2 RecName: Full=30S ribosomal protein S18
 gi|122266961|sp|Q03IV5|RS18_STRTD RecName: Full=30S ribosomal protein S18
 gi|55737709|gb|AAV61351.1| 30S ribosomal protein S18 [Streptococcus thermophilus LMG 18311]
 gi|55739629|gb|AAV63270.1| 30S ribosomal protein S18 [Streptococcus thermophilus CNRZ1066]
 gi|116101721|gb|ABJ66867.1| SSU ribosomal protein S18P [Streptococcus thermophilus LMD-9]
 gi|312279064|gb|ADQ63721.1| 30S ribosomal protein S18 [Streptococcus thermophilus ND03]
          Length = 79

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 46/74 (62%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
            R     R+K   ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  A
Sbjct: 4  QRRGGFKRRKKFDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTA 63

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ YVN
Sbjct: 64 IKRARVMALMPYVN 77


>gi|222054669|ref|YP_002537031.1| ribosomal protein S18 [Geobacter sp. FRC-32]
 gi|254812941|sp|B9M5U9|RS18_GEOSF RecName: Full=30S ribosomal protein S18
 gi|221563958|gb|ACM19930.1| ribosomal protein S18 [Geobacter sp. FRC-32]
          Length = 91

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 41/70 (58%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++    RRK C         IDYKD R L  F+S+RGKI+P RIS    K QRE+ +AI
Sbjct: 14 RKKRPFQRRKVCRFCADKQVTIDYKDPRTLRYFISERGKIIPRRISGNCAKHQREITEAI 73

Query: 70 KRARYLGLIA 79
          KRAR + L+ 
Sbjct: 74 KRARNIALLP 83


>gi|153007913|ref|YP_001369128.1| 30S ribosomal protein S18 [Ochrobactrum anthropi ATCC 49188]
 gi|239831324|ref|ZP_04679653.1| ribosomal protein S18 [Ochrobactrum intermedium LMG 3301]
 gi|166220966|sp|A6WWE5|RS18_OCHA4 RecName: Full=30S ribosomal protein S18
 gi|151559801|gb|ABS13299.1| ribosomal protein S18 [Ochrobactrum anthropi ATCC 49188]
 gi|239823591|gb|EEQ95159.1| ribosomal protein S18 [Ochrobactrum intermedium LMG 3301]
          Length = 82

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    RRK+CP SG  AP+IDYKDI+LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRRKTCPFSGANAPKIDYKDIKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|27904981|ref|NP_778107.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Bp (Baizongia
          pistaciae)]
 gi|29611842|sp|P59502|RS18_BUCBP RecName: Full=30S ribosomal protein S18
 gi|27904379|gb|AAO27212.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Bp (Baizongia
          pistaciae)]
          Length = 75

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 47/70 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKD+ +L  ++++ GKIVPSRI+  S + QR+LA+AIKRA
Sbjct: 3  RYFRRRKFCRFTVEKIKEIDYKDLSMLKNYITESGKIVPSRITGTSARYQRQLARAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|291614206|ref|YP_003524363.1| ribosomal protein S18 [Sideroxydans lithotrophicus ES-1]
 gi|291584318|gb|ADE11976.1| ribosomal protein S18 [Sideroxydans lithotrophicus ES-1]
          Length = 89

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 48/72 (66%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R +  RRK C  + +    +DYKDI +L  F+++ GK++P+RI+    + QR+L+ A+KR
Sbjct: 17 RQLFKRRKFCRFTAEKIAEVDYKDINILKEFITENGKLIPARITGTKTRFQRQLSVAVKR 76

Query: 72 ARYLGLIAYVNL 83
          AR+L L+ Y +L
Sbjct: 77 ARFLALLPYTDL 88


>gi|39936141|ref|NP_948417.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris CGA009]
 gi|192291859|ref|YP_001992464.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris TIE-1]
 gi|316933692|ref|YP_004108674.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris DX-1]
 gi|59798743|sp|Q6N5A3|RS18_RHOPA RecName: Full=30S ribosomal protein S18; AltName: Full=RRP-S18
 gi|229560057|sp|B3Q9T6|RS18_RHOPT RecName: Full=30S ribosomal protein S18
 gi|39649995|emb|CAE28519.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris CGA009]
 gi|192285608|gb|ACF01989.1| ribosomal protein S18 [Rhodopseudomonas palustris TIE-1]
 gi|315601406|gb|ADU43941.1| ribosomal protein S18 [Rhodopseudomonas palustris DX-1]
          Length = 79

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 48/71 (67%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 7  RRPFFRRRKTCPFTGANAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|15901383|ref|NP_345987.1| 30S ribosomal protein S18 [Streptococcus pneumoniae TIGR4]
 gi|15903437|ref|NP_358987.1| 30S ribosomal protein S18 [Streptococcus pneumoniae R6]
 gi|24380218|ref|NP_722173.1| 30S ribosomal protein S18 [Streptococcus mutans UA159]
 gi|111658382|ref|ZP_01409069.1| hypothetical protein SpneT_02000461 [Streptococcus pneumoniae
          TIGR4]
 gi|116516750|ref|YP_816828.1| 30S ribosomal protein S18 [Streptococcus pneumoniae D39]
 gi|125717306|ref|YP_001034439.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK36]
 gi|148984887|ref|ZP_01818140.1| hypothetical protein CGSSp3BS71_09631 [Streptococcus pneumoniae
          SP3-BS71]
 gi|148988585|ref|ZP_01820018.1| hypothetical protein CGSSp6BS73_08674 [Streptococcus pneumoniae
          SP6-BS73]
 gi|148992571|ref|ZP_01822239.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP9-BS68]
 gi|148997397|ref|ZP_01825002.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP11-BS70]
 gi|149003239|ref|ZP_01828135.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP14-BS69]
 gi|149007548|ref|ZP_01831183.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP18-BS74]
 gi|149011777|ref|ZP_01832973.1| hypothetical protein CGSSp19BS75_07412 [Streptococcus pneumoniae
          SP19-BS75]
 gi|149021813|ref|ZP_01835820.1| hypothetical protein CGSSp23BS72_09623 [Streptococcus pneumoniae
          SP23-BS72]
 gi|157150434|ref|YP_001451145.1| 30S ribosomal protein S18 [Streptococcus gordonii str. Challis
          substr. CH1]
 gi|168484972|ref|ZP_02709917.1| ribosomal protein S18 [Streptococcus pneumoniae CDC1873-00]
 gi|168487509|ref|ZP_02712017.1| ribosomal protein S18 [Streptococcus pneumoniae CDC1087-00]
 gi|168488799|ref|ZP_02712998.1| ribosomal protein S18 [Streptococcus pneumoniae SP195]
 gi|168491569|ref|ZP_02715712.1| ribosomal protein S18 [Streptococcus pneumoniae CDC0288-04]
 gi|168493440|ref|ZP_02717583.1| ribosomal protein S18 [Streptococcus pneumoniae CDC3059-06]
 gi|168575265|ref|ZP_02721228.1| ribosomal protein S18 [Streptococcus pneumoniae MLV-016]
 gi|169832520|ref|YP_001694944.1| 30S ribosomal protein S18 [Streptococcus pneumoniae Hungary19A-6]
 gi|171779262|ref|ZP_02920233.1| hypothetical protein STRINF_01110 [Streptococcus infantarius
          subsp. infantarius ATCC BAA-102]
 gi|182684495|ref|YP_001836242.1| 30S ribosomal protein S18 [Streptococcus pneumoniae CGSP14]
 gi|221232250|ref|YP_002511403.1| 30S ribosomal protein S18 [Streptococcus pneumoniae ATCC 700669]
 gi|225854979|ref|YP_002736491.1| 30S ribosomal protein S18 [Streptococcus pneumoniae JJA]
 gi|225857165|ref|YP_002738676.1| 30S ribosomal protein S18 [Streptococcus pneumoniae P1031]
 gi|225859294|ref|YP_002740804.1| 30S ribosomal protein S18 [Streptococcus pneumoniae 70585]
 gi|225861370|ref|YP_002742879.1| 30S ribosomal protein S18 [Streptococcus pneumoniae Taiwan19F-14]
 gi|237650221|ref|ZP_04524473.1| 30S ribosomal protein S18 [Streptococcus pneumoniae CCRI 1974]
 gi|237820896|ref|ZP_04596741.1| 30S ribosomal protein S18 [Streptococcus pneumoniae CCRI 1974M2]
 gi|262283523|ref|ZP_06061289.1| ribosomal protein S18 [Streptococcus sp. 2_1_36FAA]
 gi|270292432|ref|ZP_06198643.1| ribosomal protein S18 [Streptococcus sp. M143]
 gi|288906099|ref|YP_003431321.1| ribosomal protein S18 [Streptococcus gallolyticus UCN34]
 gi|289168354|ref|YP_003446623.1| 30S ribosomal protein S18 [Streptococcus mitis B6]
 gi|290579807|ref|YP_003484199.1| 30S ribosomal protein S18 [Streptococcus mutans NN2025]
 gi|293365826|ref|ZP_06612531.1| 30S ribosomal protein S18 [Streptococcus oralis ATCC 35037]
 gi|296875865|ref|ZP_06899926.1| 30S ribosomal protein S18 [Streptococcus parasanguinis ATCC
          15912]
 gi|298230728|ref|ZP_06964409.1| 30S ribosomal protein S18 [Streptococcus pneumoniae str. Canada
          MDR_19F]
 gi|298254951|ref|ZP_06978537.1| 30S ribosomal protein S18 [Streptococcus pneumoniae str. Canada
          MDR_19A]
 gi|298503275|ref|YP_003725215.1| 30S ribosomal protein S18 [Streptococcus pneumoniae TCH8431/19A]
 gi|303255325|ref|ZP_07341395.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS455]
 gi|303260166|ref|ZP_07346138.1| 30S ribosomal protein S18 [Streptococcus pneumoniae SP-BS293]
 gi|303262556|ref|ZP_07348497.1| 30S ribosomal protein S18 [Streptococcus pneumoniae SP14-BS292]
 gi|303264958|ref|ZP_07350873.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS397]
 gi|303266421|ref|ZP_07352309.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS457]
 gi|303269403|ref|ZP_07355173.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS458]
 gi|306824869|ref|ZP_07458213.1| 30S ribosomal protein S18 [Streptococcus sp. oral taxon 071 str.
          73H25AP]
 gi|306829849|ref|ZP_07463036.1| 30S ribosomal protein S18 [Streptococcus mitis ATCC 6249]
 gi|306832138|ref|ZP_07465292.1| 30S ribosomal protein S18 [Streptococcus gallolyticus subsp.
          gallolyticus TX20005]
 gi|306834252|ref|ZP_07467371.1| 30S ribosomal protein S18 [Streptococcus bovis ATCC 700338]
 gi|307068183|ref|YP_003877149.1| hypothetical protein SPAP_1561 [Streptococcus pneumoniae AP200]
 gi|307127747|ref|YP_003879778.1| 30S ribosomal protein S18 [Streptococcus pneumoniae 670-6B]
 gi|307703305|ref|ZP_07640250.1| ribosomal protein S18 [Streptococcus oralis ATCC 35037]
 gi|307704416|ref|ZP_07641328.1| ribosomal protein S18 [Streptococcus mitis SK597]
 gi|307705993|ref|ZP_07642816.1| ribosomal protein S18 [Streptococcus mitis SK564]
 gi|307706202|ref|ZP_07643019.1| ribosomal protein S18 [Streptococcus mitis SK321]
 gi|307708378|ref|ZP_07644845.1| ribosomal protein S18 [Streptococcus mitis NCTC 12261]
 gi|309798591|ref|ZP_07692866.1| ribosomal protein S18 [Streptococcus infantis SK1302]
 gi|312864919|ref|ZP_07725149.1| ribosomal protein S18 [Streptococcus downei F0415]
 gi|312868477|ref|ZP_07728677.1| ribosomal protein S18 [Streptococcus parasanguinis F0405]
 gi|315222303|ref|ZP_07864209.1| ribosomal protein S18 [Streptococcus anginosus F0211]
 gi|315613509|ref|ZP_07888416.1| 30S ribosomal protein S18 [Streptococcus sanguinis ATCC 49296]
 gi|319939919|ref|ZP_08014274.1| 30S ribosomal protein S18 [Streptococcus anginosus 1_2_62CV]
 gi|319946353|ref|ZP_08020591.1| 30S ribosomal protein S18 [Streptococcus australis ATCC 700641]
 gi|320547485|ref|ZP_08041771.1| 30S ribosomal protein S18 [Streptococcus equinus ATCC 9812]
 gi|322373706|ref|ZP_08048242.1| ribosomal protein S18 [Streptococcus sp. C150]
 gi|322375590|ref|ZP_08050102.1| ribosomal protein S18 [Streptococcus sp. C300]
 gi|322377026|ref|ZP_08051519.1| ribosomal protein S18 [Streptococcus sp. M334]
 gi|322386752|ref|ZP_08060376.1| 30S ribosomal protein S18 [Streptococcus cristatus ATCC 51100]
 gi|322387422|ref|ZP_08061032.1| 30S ribosomal protein S18 [Streptococcus infantis ATCC 700779]
 gi|322390175|ref|ZP_08063707.1| 30S ribosomal protein S18 [Streptococcus parasanguinis ATCC 903]
 gi|322391659|ref|ZP_08065127.1| 30S ribosomal protein S18 [Streptococcus peroris ATCC 700780]
 gi|323353389|ref|ZP_08087922.1| 30S ribosomal protein S18 [Streptococcus sanguinis VMC66]
 gi|331266016|ref|YP_004325646.1| 30S ribosomal protein S18 [Streptococcus oralis Uo5]
 gi|54039416|sp|P66473|RS18_STRR6 RecName: Full=30S ribosomal protein S18
 gi|54039417|sp|P66474|RS18_STRMU RecName: Full=30S ribosomal protein S18
 gi|54042150|sp|P66472|RS18_STRPN RecName: Full=30S ribosomal protein S18
 gi|122278326|sp|Q04JL0|RS18_STRP2 RecName: Full=30S ribosomal protein S18
 gi|166222248|sp|A3CL34|RS18_STRSV RecName: Full=30S ribosomal protein S18
 gi|189029694|sp|A8AZD5|RS18_STRGC RecName: Full=30S ribosomal protein S18
 gi|229560071|sp|B1ICV9|RS18_STRPI RecName: Full=30S ribosomal protein S18
 gi|229560072|sp|B2IR58|RS18_STRPS RecName: Full=30S ribosomal protein S18
 gi|254812957|sp|C1C8C8|RS18_STRP7 RecName: Full=30S ribosomal protein S18
 gi|254812958|sp|B8ZLD9|RS18_STRPJ RecName: Full=30S ribosomal protein S18
 gi|254812960|sp|C1CFC0|RS18_STRZJ RecName: Full=30S ribosomal protein S18
 gi|254812961|sp|C1CLN8|RS18_STRZP RecName: Full=30S ribosomal protein S18
 gi|254812962|sp|C1CSF7|RS18_STRZT RecName: Full=30S ribosomal protein S18
 gi|24378225|gb|AAN59479.1|AE015012_8 30S ribosomal protein S18 [Streptococcus mutans UA159]
 gi|14973029|gb|AAK75627.1| ribosomal protein S18 [Streptococcus pneumoniae TIGR4]
 gi|15459045|gb|AAL00198.1| 30S Ribosomal protein S18 [Streptococcus pneumoniae R6]
 gi|116077326|gb|ABJ55046.1| ribosomal protein S18 [Streptococcus pneumoniae D39]
 gi|125497223|gb|ABN43889.1| 30S ribosomal protein S18, putative [Streptococcus sanguinis
          SK36]
 gi|147756452|gb|EDK63493.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP11-BS70]
 gi|147758699|gb|EDK65696.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP14-BS69]
 gi|147760907|gb|EDK67877.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP18-BS74]
 gi|147764208|gb|EDK71140.1| hypothetical protein CGSSp19BS75_07412 [Streptococcus pneumoniae
          SP19-BS75]
 gi|147922909|gb|EDK74025.1| hypothetical protein CGSSp3BS71_09631 [Streptococcus pneumoniae
          SP3-BS71]
 gi|147925786|gb|EDK76861.1| hypothetical protein CGSSp6BS73_08674 [Streptococcus pneumoniae
          SP6-BS73]
 gi|147928588|gb|EDK79602.1| 30S ribosomal protein S18, putative [Streptococcus pneumoniae
          SP9-BS68]
 gi|147930049|gb|EDK81036.1| hypothetical protein CGSSp23BS72_09623 [Streptococcus pneumoniae
          SP23-BS72]
 gi|157075228|gb|ABV09911.1| ribosomal protein S18 [Streptococcus gordonii str. Challis
          substr. CH1]
 gi|168995022|gb|ACA35634.1| ribosomal protein S18 [Streptococcus pneumoniae Hungary19A-6]
 gi|171282318|gb|EDT47745.1| hypothetical protein STRINF_01110 [Streptococcus infantarius
          subsp. infantarius ATCC BAA-102]
 gi|172041899|gb|EDT49945.1| ribosomal protein S18 [Streptococcus pneumoniae CDC1873-00]
 gi|182629829|gb|ACB90777.1| 30S ribosomal protein S18 [Streptococcus pneumoniae CGSP14]
 gi|183569672|gb|EDT90200.1| ribosomal protein S18 [Streptococcus pneumoniae CDC1087-00]
 gi|183572611|gb|EDT93139.1| ribosomal protein S18 [Streptococcus pneumoniae SP195]
 gi|183574282|gb|EDT94810.1| ribosomal protein S18 [Streptococcus pneumoniae CDC0288-04]
 gi|183576411|gb|EDT96939.1| ribosomal protein S18 [Streptococcus pneumoniae CDC3059-06]
 gi|183578889|gb|EDT99417.1| ribosomal protein S18 [Streptococcus pneumoniae MLV-016]
 gi|220674711|emb|CAR69284.1| 30S ribosomal protein S18 [Streptococcus pneumoniae ATCC 700669]
 gi|225721900|gb|ACO17754.1| ribosomal protein S18 [Streptococcus pneumoniae 70585]
 gi|225723663|gb|ACO19516.1| ribosomal protein S18 [Streptococcus pneumoniae JJA]
 gi|225724494|gb|ACO20346.1| ribosomal protein S18 [Streptococcus pneumoniae P1031]
 gi|225728310|gb|ACO24161.1| ribosomal protein S18 [Streptococcus pneumoniae Taiwan19F-14]
 gi|254996706|dbj|BAH87307.1| 30S ribosomal protein S18 [Streptococcus mutans NN2025]
 gi|262261014|gb|EEY79714.1| ribosomal protein S18 [Streptococcus sp. 2_1_36FAA]
 gi|270278411|gb|EFA24257.1| ribosomal protein S18 [Streptococcus sp. M143]
 gi|288732825|emb|CBI14401.1| ribosomal protein S18 [Streptococcus gallolyticus UCN34]
 gi|288907921|emb|CBJ22761.1| 30S ribosomal protein S18 [Streptococcus mitis B6]
 gi|291315650|gb|EFE56098.1| 30S ribosomal protein S18 [Streptococcus oralis ATCC 35037]
 gi|296433106|gb|EFH18892.1| 30S ribosomal protein S18 [Streptococcus parasanguinis ATCC
          15912]
 gi|298238870|gb|ADI70001.1| 30S ribosomal protein S18 [Streptococcus pneumoniae TCH8431/19A]
 gi|301794548|emb|CBW36992.1| 30S ribosomal protein S18 [Streptococcus pneumoniae INV104]
 gi|301800372|emb|CBW33003.1| 30S ribosomal protein S18 [Streptococcus pneumoniae OXC141]
 gi|301802257|emb|CBW35009.1| 30S ribosomal protein S18 [Streptococcus pneumoniae INV200]
 gi|302597693|gb|EFL64769.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS455]
 gi|302636273|gb|EFL66767.1| 30S ribosomal protein S18 [Streptococcus pneumoniae SP14-BS292]
 gi|302638663|gb|EFL69126.1| 30S ribosomal protein S18 [Streptococcus pneumoniae SP-BS293]
 gi|302641071|gb|EFL71448.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS458]
 gi|302643999|gb|EFL74258.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS457]
 gi|302645477|gb|EFL75709.1| 30S ribosomal protein S18 [Streptococcus pneumoniae BS397]
 gi|304423601|gb|EFM26748.1| 30S ribosomal protein S18 [Streptococcus bovis ATCC 700338]
 gi|304425577|gb|EFM28695.1| 30S ribosomal protein S18 [Streptococcus gallolyticus subsp.
          gallolyticus TX20005]
 gi|304427860|gb|EFM30953.1| 30S ribosomal protein S18 [Streptococcus mitis ATCC 6249]
 gi|304433080|gb|EFM36052.1| 30S ribosomal protein S18 [Streptococcus sp. oral taxon 071 str.
          73H25AP]
 gi|306409720|gb|ADM85147.1| hypothetical protein SPAP_1561 [Streptococcus pneumoniae AP200]
 gi|306484809|gb|ADM91678.1| ribosomal protein S18 [Streptococcus pneumoniae 670-6B]
 gi|307615824|gb|EFN95030.1| ribosomal protein S18 [Streptococcus mitis NCTC 12261]
 gi|307618392|gb|EFN97542.1| ribosomal protein S18 [Streptococcus mitis SK321]
 gi|307620412|gb|EFN99525.1| ribosomal protein S18 [Streptococcus mitis SK564]
 gi|307622029|gb|EFO01054.1| ribosomal protein S18 [Streptococcus mitis SK597]
 gi|307623171|gb|EFO02163.1| ribosomal protein S18 [Streptococcus oralis ATCC 35037]
 gi|308117827|gb|EFO55228.1| ribosomal protein S18 [Streptococcus infantis SK1302]
 gi|311096222|gb|EFQ54466.1| ribosomal protein S18 [Streptococcus parasanguinis F0405]
 gi|311099539|gb|EFQ57753.1| ribosomal protein S18 [Streptococcus downei F0415]
 gi|315188636|gb|EFU22345.1| ribosomal protein S18 [Streptococcus anginosus F0211]
 gi|315314200|gb|EFU62245.1| 30S ribosomal protein S18 [Streptococcus sanguinis ATCC 49296]
 gi|319747506|gb|EFV99761.1| 30S ribosomal protein S18 [Streptococcus australis ATCC 700641]
 gi|319810930|gb|EFW07249.1| 30S ribosomal protein S18 [Streptococcus anginosus 1_2_62CV]
 gi|320447830|gb|EFW88587.1| 30S ribosomal protein S18 [Streptococcus equinus ATCC 9812]
 gi|321141951|gb|EFX37446.1| 30S ribosomal protein S18 [Streptococcus infantis ATCC 700779]
 gi|321143135|gb|EFX38581.1| 30S ribosomal protein S18 [Streptococcus parasanguinis ATCC 903]
 gi|321145470|gb|EFX40863.1| 30S ribosomal protein S18 [Streptococcus peroris ATCC 700780]
 gi|321269034|gb|EFX51970.1| 30S ribosomal protein S18 [Streptococcus cristatus ATCC 51100]
 gi|321278748|gb|EFX55817.1| ribosomal protein S18 [Streptococcus sp. C150]
 gi|321279298|gb|EFX56339.1| ribosomal protein S18 [Streptococcus sp. C300]
 gi|321282833|gb|EFX59840.1| ribosomal protein S18 [Streptococcus sp. M334]
 gi|322121335|gb|EFX93098.1| 30S ribosomal protein S18 [Streptococcus sanguinis VMC66]
 gi|324990242|gb|EGC22180.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK353]
 gi|324992066|gb|EGC23988.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK405]
 gi|324994159|gb|EGC26073.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK678]
 gi|325688012|gb|EGD30031.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK72]
 gi|325690403|gb|EGD32407.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK115]
 gi|325693669|gb|EGD35588.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK150]
 gi|325697625|gb|EGD39510.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK160]
 gi|326682688|emb|CBZ00305.1| 30S ribosomal protein S18 [Streptococcus oralis Uo5]
 gi|327389725|gb|EGE88070.1| ribosomal protein S18 [Streptococcus pneumoniae GA04375]
 gi|327458971|gb|EGF05319.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK1057]
 gi|327459368|gb|EGF05714.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK1]
 gi|327469240|gb|EGF14712.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK330]
 gi|327472789|gb|EGF18216.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK408]
 gi|327490584|gb|EGF22365.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK1058]
 gi|328945789|gb|EGG39940.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK1087]
 gi|332072332|gb|EGI82815.1| ribosomal protein S18 [Streptococcus pneumoniae GA17570]
 gi|332073877|gb|EGI84355.1| ribosomal protein S18 [Streptococcus pneumoniae GA41301]
 gi|332074294|gb|EGI84771.1| ribosomal protein S18 [Streptococcus pneumoniae GA17545]
 gi|332199584|gb|EGJ13659.1| ribosomal protein S18 [Streptococcus pneumoniae GA41317]
 gi|332200101|gb|EGJ14174.1| ribosomal protein S18 [Streptococcus pneumoniae GA47368]
 gi|332200980|gb|EGJ15051.1| ribosomal protein S18 [Streptococcus pneumoniae GA47901]
 gi|332357976|gb|EGJ35809.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK1056]
 gi|332363248|gb|EGJ41033.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK49]
 gi|332363798|gb|EGJ41577.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK355]
 gi|332364668|gb|EGJ42437.1| 30S ribosomal protein S18 [Streptococcus sanguinis SK1059]
          Length = 79

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 46/74 (62%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
            R     R+K   ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  A
Sbjct: 4  QRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTA 63

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ +VN
Sbjct: 64 IKRARVMALMPFVN 77


>gi|262369755|ref|ZP_06063083.1| 30S ribosomal protein S18 [Acinetobacter johnsonii SH046]
 gi|262375305|ref|ZP_06068538.1| ribosomal protein S18 [Acinetobacter lwoffii SH145]
 gi|262309559|gb|EEY90689.1| ribosomal protein S18 [Acinetobacter lwoffii SH145]
 gi|262315823|gb|EEY96862.1| 30S ribosomal protein S18 [Acinetobacter johnsonii SH046]
          Length = 75

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI  L +++++ GKIVPSRI+    + QR+LA AIK+A
Sbjct: 3  RFYRRRKFCRFTAENVTYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQA 62

Query: 73 RYLGLIAYVN 82
          RYL LI Y +
Sbjct: 63 RYLSLIPYTD 72


>gi|16125914|ref|NP_420478.1| 30S ribosomal protein S18 [Caulobacter crescentus CB15]
 gi|167646473|ref|YP_001684136.1| 30S ribosomal protein S18 [Caulobacter sp. K31]
 gi|221234677|ref|YP_002517113.1| 30S ribosomal protein S18 [Caulobacter crescentus NA1000]
 gi|20978733|sp|Q9A7Q2|RS18_CAUCR RecName: Full=30S ribosomal protein S18
 gi|189029669|sp|B0SWL0|RS18_CAUSK RecName: Full=30S ribosomal protein S18
 gi|254765418|sp|B8GVN5|RS18_CAUCN RecName: Full=30S ribosomal protein S18
 gi|13423076|gb|AAK23646.1| ribosomal protein S18 [Caulobacter crescentus CB15]
 gi|167348903|gb|ABZ71638.1| ribosomal protein S18 [Caulobacter sp. K31]
 gi|220963849|gb|ACL95205.1| SSU ribosomal protein S18P [Caulobacter crescentus NA1000]
          Length = 92

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 47/68 (69%), Positives = 57/68 (83%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             RRK CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELAKAIKRAR
Sbjct: 23 FFRRRKVCPFSGANAPKIDYKDVKLLQRYVSERGKIVPSRITAVSAKKQRELAKAIKRAR 82

Query: 74 YLGLIAYV 81
          +L L+ YV
Sbjct: 83 FLALLPYV 90


>gi|300857396|ref|YP_003782380.1| 30S ribosomal protein S18 [Clostridium ljungdahlii DSM 13528]
 gi|300437511|gb|ADK17278.1| 30S ribosomal protein S18 [Clostridium ljungdahlii DSM 13528]
          Length = 85

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 42/71 (59%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          +    +RK C      +  IDYKDI  L +++++RGKI+P RIS    K QREL  AIKR
Sbjct: 14 KMRRAKRKVCAFCMDKSEFIDYKDINKLRKYVTERGKILPRRISGNCAKHQRELTVAIKR 73

Query: 72 ARYLGLIAYVN 82
          AR + L+ +  
Sbjct: 74 ARNIALLPFTT 84


>gi|124009489|ref|ZP_01694165.1| ribosomal protein S18 [Microscilla marina ATCC 23134]
 gi|123984938|gb|EAY24901.1| ribosomal protein S18 [Microscilla marina ATCC 23134]
          Length = 83

 Score = 97.7 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 45/67 (67%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R+K C     G   IDYKD   L +F++ +GKI+P RI+  S K QR++++A+KRAR+L
Sbjct: 13 NRKKYCRFKKNGIKYIDYKDPNFLLKFVNDQGKILPRRITGTSLKYQRKVSQAVKRARHL 72

Query: 76 GLIAYVN 82
           L+ YV 
Sbjct: 73 ALLPYVT 79


>gi|315499768|ref|YP_004088571.1| ribosomal protein s18 [Asticcacaulis excentricus CB 48]
 gi|315417780|gb|ADU14420.1| ribosomal protein S18 [Asticcacaulis excentricus CB 48]
          Length = 92

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 55/63 (87%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELAKAIKRAR+L L+
Sbjct: 28 KVCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQKKQRELAKAIKRARFLALL 87

Query: 79 AYV 81
           YV
Sbjct: 88 PYV 90


>gi|325979062|ref|YP_004288778.1| 30S ribosomal protein S18 [Streptococcus gallolyticus subsp.
          gallolyticus ATCC BAA-2069]
 gi|325178990|emb|CBZ49034.1| 30S ribosomal protein S18 [Streptococcus gallolyticus subsp.
          gallolyticus ATCC BAA-2069]
          Length = 79

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 46/74 (62%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
            R     R+K   ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  A
Sbjct: 4  QRRSGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTA 63

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ +VN
Sbjct: 64 IKRARVMALMPFVN 77


>gi|15896953|ref|NP_350302.1| 30S ribosomal protein S18 [Clostridium acetobutylicum ATCC 824]
 gi|20978716|sp|Q97CX4|RS18_CLOAB RecName: Full=30S ribosomal protein S18
 gi|15026828|gb|AAK81642.1|AE007867_9 Ribosomal protein S18 [Clostridium acetobutylicum ATCC 824]
 gi|325511130|gb|ADZ22766.1| 30S ribosomal protein S18 [Clostridium acetobutylicum EA 2018]
          Length = 90

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/77 (42%), Positives = 45/77 (58%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
            P   RN   +RK C    + +  IDYKDI  L +++++RGKI+P RIS    K QREL
Sbjct: 13 KRPNGGRNRKMKRKICSFCMEKSESIDYKDINKLRKYVTERGKILPRRISGNCAKHQREL 72

Query: 66 AKAIKRARYLGLIAYVN 82
            AIKRAR + L+ +  
Sbjct: 73 TIAIKRARNIALLPFTT 89


>gi|240850218|ref|YP_002971611.1| 30S ribosomal protein S18 [Bartonella grahamii as4aup]
 gi|240267341|gb|ACS50929.1| 30S ribosomal protein S18 [Bartonella grahamii as4aup]
          Length = 82

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKDI+LL R++S+RGKIVPSRI++VS KKQRELA AIK
Sbjct: 10 RRPFHRRRKTCPFSGTNAPKIDYKDIKLLQRYISERGKIVPSRITAVSQKKQRELANAIK 69

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 70 RARFLGLLPYV 80


>gi|116626134|ref|YP_828290.1| 30S ribosomal protein S18 [Candidatus Solibacter usitatus
          Ellin6076]
 gi|122251818|sp|Q01QR5|RS18_SOLUE RecName: Full=30S ribosomal protein S18
 gi|116229296|gb|ABJ88005.1| SSU ribosomal protein S18P [Candidatus Solibacter usitatus
          Ellin6076]
          Length = 99

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 44/70 (62%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++    R+K C    +    I+YKD+++L+ F+++RGKIVP RIS V    QR L  AIK
Sbjct: 26 KKQYFRRKKVCRFCVEKIDDINYKDVKMLHAFVAERGKIVPRRISGVCAPHQRRLTDAIK 85

Query: 71 RARYLGLIAY 80
          +AR + L+ +
Sbjct: 86 KARNIALLPF 95


>gi|168187295|ref|ZP_02621930.1| ribosomal protein S18 [Clostridium botulinum C str. Eklund]
 gi|169294783|gb|EDS76916.1| ribosomal protein S18 [Clostridium botulinum C str. Eklund]
          Length = 78

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 38/63 (60%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C      +  IDYKD+  L +++++RGKI+P RIS    K QREL  AIKRAR + L+ 
Sbjct: 15 VCAFCADKSSSIDYKDVNKLRKYVTERGKILPRRISGNCAKHQRELTLAIKRARNVALLP 74

Query: 80 YVN 82
          +  
Sbjct: 75 FTT 77


>gi|118444188|ref|YP_876991.1| 30S ribosomal protein S18 [Clostridium novyi NT]
 gi|166220947|sp|A0PX89|RS18_CLONN RecName: Full=30S ribosomal protein S18
 gi|118134644|gb|ABK61688.1| ribosomal protein S18 [Clostridium novyi NT]
          Length = 78

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 38/63 (60%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C      +  IDYKD+  L +++++RGKI+P RIS    K QREL  AIKRAR + L+ 
Sbjct: 15 VCAFCADKSSSIDYKDVNKLRKYVTERGKILPRRISGNCAKHQRELTLAIKRARNVALLP 74

Query: 80 YVN 82
          +  
Sbjct: 75 FTT 77


>gi|218135342|ref|ZP_03464146.1| hypothetical protein BACPEC_03247 [Bacteroides pectinophilus ATCC
          43243]
 gi|217990727|gb|EEC56738.1| hypothetical protein BACPEC_03247 [Bacteroides pectinophilus ATCC
          43243]
          Length = 90

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 41/63 (65%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C      +  IDYKD+ LL R++S+RGKI+P RI+    K QR L  A+KRAR++ L
Sbjct: 25 KKVCIFCADQSKAIDYKDVNLLKRYVSERGKILPRRITGNCAKHQRALTVAVKRARHIAL 84

Query: 78 IAY 80
          + Y
Sbjct: 85 MPY 87


>gi|157694460|ref|YP_001488922.1| 30S ribosomal protein S18 [Bacillus pumilus SAFR-032]
 gi|167011187|sp|A8FJE5|RS18_BACP2 RecName: Full=30S ribosomal protein S18
 gi|157683218|gb|ABV64362.1| ribosomal protein S18 [Bacillus pumilus SAFR-032]
          Length = 79

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 42/63 (66%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +  G   IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIK++R + L+ 
Sbjct: 15 VCFFTSNGITHIDYKDVDLLRKFVSERGKILPRRVTGTSAKYQRKLTLAIKKSRQMALLP 74

Query: 80 YVN 82
          YV 
Sbjct: 75 YVT 77


>gi|270160072|ref|ZP_06188728.1| ribosomal protein S18 [Legionella longbeachae D-4968]
 gi|289165147|ref|YP_003455285.1| 30S ribosomal subunit protein S18 [Legionella longbeachae NSW150]
 gi|269988411|gb|EEZ94666.1| ribosomal protein S18 [Legionella longbeachae D-4968]
 gi|288858320|emb|CBJ12188.1| 30S ribosomal subunit protein S18 [Legionella longbeachae NSW150]
          Length = 75

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 47/69 (68%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             R+K C  S +G   IDYKDI LL  ++S+ GKIVPSRI+    + QR+LA+AI +AR
Sbjct: 4  YFRRKKMCRFSAEGGNEIDYKDINLLKNYISETGKIVPSRITGTHTRFQRQLARAIMQAR 63

Query: 74 YLGLIAYVN 82
          +LGL+ Y +
Sbjct: 64 FLGLLPYCD 72


>gi|15677187|ref|NP_274340.1| 30S ribosomal protein S18 [Neisseria meningitidis MC58]
 gi|59801014|ref|YP_207726.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae FA 1090]
 gi|121635032|ref|YP_975277.1| 30S ribosomal protein S18 [Neisseria meningitidis FAM18]
 gi|161870196|ref|YP_001599366.1| 30S ribosomal protein S18 [Neisseria meningitidis 053442]
 gi|194098898|ref|YP_002001963.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae NCCP11945]
 gi|218768341|ref|YP_002342853.1| 30S ribosomal protein S18 [Neisseria meningitidis Z2491]
 gi|239999181|ref|ZP_04719105.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae 35/02]
 gi|240013911|ref|ZP_04720824.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae DGI18]
 gi|240016353|ref|ZP_04722893.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae FA6140]
 gi|240080472|ref|ZP_04725015.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae FA19]
 gi|240113160|ref|ZP_04727650.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae MS11]
 gi|240115916|ref|ZP_04729978.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID18]
 gi|240118214|ref|ZP_04732276.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID1]
 gi|240121480|ref|ZP_04734442.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID24-1]
 gi|240123762|ref|ZP_04736718.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID332]
 gi|240125953|ref|ZP_04738839.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae SK-92-679]
 gi|240128465|ref|ZP_04741126.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae SK-93-1035]
 gi|254493952|ref|ZP_05107123.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae 1291]
 gi|254805120|ref|YP_003083341.1| 30S ribosomal protein S18 [Neisseria meningitidis alpha14]
 gi|260440269|ref|ZP_05794085.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae DGI2]
 gi|261379073|ref|ZP_05983646.1| ribosomal protein S18 [Neisseria cinerea ATCC 14685]
 gi|268595011|ref|ZP_06129178.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae 35/02]
 gi|268596609|ref|ZP_06130776.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae FA19]
 gi|268599239|ref|ZP_06133406.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae MS11]
 gi|268601586|ref|ZP_06135753.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID18]
 gi|268603925|ref|ZP_06138092.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID1]
 gi|268682388|ref|ZP_06149250.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID332]
 gi|268684546|ref|ZP_06151408.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae SK-92-679]
 gi|268686856|ref|ZP_06153718.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae SK-93-1035]
 gi|291043563|ref|ZP_06569279.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae DGI2]
 gi|293398877|ref|ZP_06643042.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae F62]
 gi|296314492|ref|ZP_06864433.1| ribosomal protein S18 [Neisseria polysaccharea ATCC 43768]
 gi|304387368|ref|ZP_07369560.1| 30S ribosomal protein S18 [Neisseria meningitidis ATCC 13091]
 gi|313668458|ref|YP_004048742.1| 30S ribosomal protein S18 [Neisseria lactamica ST-640]
 gi|60397121|sp|P0A0X6|RS18_NEIMA RecName: Full=30S ribosomal protein S18
 gi|60397126|sp|P0A0X7|RS18_NEIMB RecName: Full=30S ribosomal protein S18
 gi|60397129|sp|P0A0X8|RS18_NEIGO RecName: Full=30S ribosomal protein S18
 gi|75507399|sp|Q5F923|RS18_NEIG1 RecName: Full=30S ribosomal protein S18
 gi|166220963|sp|A1KUE8|RS18_NEIMF RecName: Full=30S ribosomal protein S18
 gi|189029682|sp|A9LZQ1|RS18_NEIM0 RecName: Full=30S ribosomal protein S18
 gi|229560046|sp|B4RMH8|RS18_NEIG2 RecName: Full=30S ribosomal protein S18
 gi|2196759|gb|AAB61230.1| ribosomal protein S18 [Neisseria gonorrhoeae]
 gi|7226563|gb|AAF41696.1| 30S ribosomal protein S18 [Neisseria meningitidis MC58]
 gi|59717909|gb|AAW89314.1| putative 30S ribosomal protein S18 [Neisseria gonorrhoeae FA
          1090]
 gi|120866738|emb|CAM10491.1| 30S ribosomal protein S18 [Neisseria meningitidis FAM18]
 gi|121052349|emb|CAM08681.1| 30S ribosomal protein S18 [Neisseria meningitidis Z2491]
 gi|161595749|gb|ABX73409.1| 30S ribosomal protein S18 [Neisseria meningitidis 053442]
 gi|193934188|gb|ACF30012.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae NCCP11945]
 gi|226512992|gb|EEH62337.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae 1291]
 gi|254668662|emb|CBA06343.1| 30S ribosomal protein S18 [Neisseria meningitidis alpha14]
 gi|254671749|emb|CBA09574.1| 30S ribosomal protein S18 [Neisseria meningitidis alpha153]
 gi|254673115|emb|CBA07862.1| 30S ribosomal protein S18 [Neisseria meningitidis alpha275]
 gi|261392399|emb|CAX49941.1| 30S ribosomal protein S18 [Neisseria meningitidis 8013]
 gi|268548400|gb|EEZ43818.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae 35/02]
 gi|268550397|gb|EEZ45416.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae FA19]
 gi|268583370|gb|EEZ48046.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae MS11]
 gi|268585717|gb|EEZ50393.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID18]
 gi|268588056|gb|EEZ52732.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID1]
 gi|268622672|gb|EEZ55072.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae PID332]
 gi|268624830|gb|EEZ57230.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae SK-92-679]
 gi|268627140|gb|EEZ59540.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae SK-93-1035]
 gi|269144452|gb|EEZ70870.1| ribosomal protein S18 [Neisseria cinerea ATCC 14685]
 gi|291012026|gb|EFE04015.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae DGI2]
 gi|291610291|gb|EFF39401.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae F62]
 gi|296838794|gb|EFH22732.1| ribosomal protein S18 [Neisseria polysaccharea ATCC 43768]
 gi|304338619|gb|EFM04737.1| 30S ribosomal protein S18 [Neisseria meningitidis ATCC 13091]
 gi|308389439|gb|ADO31759.1| 30S ribosomal protein S18 [Neisseria meningitidis alpha710]
 gi|309379250|emb|CBX22207.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313005920|emb|CBN87377.1| 30S ribosomal protein S18 [Neisseria lactamica 020-06]
 gi|316984123|gb|EFV63101.1| ribosomal protein S18 [Neisseria meningitidis H44/76]
 gi|317164469|gb|ADV08010.1| 30S ribosomal protein S18 [Neisseria gonorrhoeae TCDC-NG08107]
 gi|319410587|emb|CBY90956.1| 30S ribosomal protein S18 [Neisseria meningitidis WUE 2594]
 gi|325128382|gb|EGC51265.1| ribosomal protein S18 [Neisseria meningitidis N1568]
 gi|325130390|gb|EGC53155.1| ribosomal protein S18 [Neisseria meningitidis OX99.30304]
 gi|325132479|gb|EGC55172.1| ribosomal protein S18 [Neisseria meningitidis M6190]
 gi|325134439|gb|EGC57084.1| ribosomal protein S18 [Neisseria meningitidis M13399]
 gi|325136176|gb|EGC58784.1| ribosomal protein S18 [Neisseria meningitidis M0579]
 gi|325138253|gb|EGC60822.1| ribosomal protein S18 [Neisseria meningitidis ES14902]
 gi|325140455|gb|EGC62976.1| ribosomal protein S18 [Neisseria meningitidis CU385]
 gi|325142508|gb|EGC64909.1| ribosomal protein S18 [Neisseria meningitidis 961-5945]
 gi|325144539|gb|EGC66838.1| ribosomal protein S18 [Neisseria meningitidis M01-240013]
 gi|325198472|gb|ADY93928.1| ribosomal protein S18 [Neisseria meningitidis G2136]
 gi|325200054|gb|ADY95509.1| ribosomal protein S18 [Neisseria meningitidis H44/76]
 gi|325201969|gb|ADY97423.1| ribosomal protein S18 [Neisseria meningitidis M01-240149]
 gi|325204320|gb|ADY99773.1| ribosomal protein S18 [Neisseria meningitidis M01-240355]
 gi|325205907|gb|ADZ01360.1| ribosomal protein S18 [Neisseria meningitidis M04-240196]
 gi|325208280|gb|ADZ03732.1| ribosomal protein S18 [Neisseria meningitidis NZ-05/33]
          Length = 76

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 45/73 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK C  + +    +DYK + LL  F+S+ GKI+P+RI+      QR+LA A+
Sbjct: 1  MARQSFKRRKFCRFTAEKIQEVDYKQVDLLKDFISENGKIIPARITGTKAFYQRQLAVAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|78224039|ref|YP_385786.1| 30S ribosomal protein S18 [Geobacter metallireducens GS-15]
 gi|123742790|sp|Q39RR3|RS18_GEOMG RecName: Full=30S ribosomal protein S18
 gi|78195294|gb|ABB33061.1| SSU ribosomal protein S18P [Geobacter metallireducens GS-15]
          Length = 106

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 42/70 (60%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +R    RRK C         IDYKD R+L  F+++RGKIVP RIS    K QRE+ +AI
Sbjct: 29 RKRRPFQRRKVCRFCADKDLVIDYKDPRVLRSFITERGKIVPRRISGNCSKHQREITEAI 88

Query: 70 KRARYLGLIA 79
          KRAR + LI 
Sbjct: 89 KRARNIALIP 98


>gi|88800242|ref|ZP_01115809.1| ribosomal protein S18 [Reinekea sp. MED297]
 gi|88776957|gb|EAR08165.1| ribosomal protein S18 [Reinekea sp. MED297]
          Length = 75

 Score = 97.7 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 43/59 (72%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+ LL  ++++ GKIVPSRI+  S K QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGITEIDYKDVDLLKGYITETGKIVPSRITGTSAKYQRQLATAIKRARYLALLPYTD 72


>gi|304438788|ref|ZP_07398715.1| 30S ribosomal protein S18 [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372711|gb|EFM26290.1| 30S ribosomal protein S18 [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 74

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 43/71 (60%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++R    RRK C         IDYKD + L RF+S++GKI+P R++    K QRE+  AI
Sbjct: 1  MQRRFRSRRKVCAFCQDPNKVIDYKDSQSLRRFISEKGKILPRRVTGSCAKHQREVTSAI 60

Query: 70 KRARYLGLIAY 80
          KRAR + L+ Y
Sbjct: 61 KRARQIALLPY 71


>gi|114777954|ref|ZP_01452868.1| ribosomal protein S18 [Mariprofundus ferrooxydans PV-1]
 gi|114551741|gb|EAU54293.1| ribosomal protein S18 [Mariprofundus ferrooxydans PV-1]
          Length = 119

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 40/81 (49%)

Query: 3   EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
           +             RRK C    +    IDYK+  LL  F+++R KI+PSR++      Q
Sbjct: 36  DRPQRRPAAGRFQRRRKFCKFCAEKNVTIDYKNPDLLRGFITERYKILPSRVTGTCSSHQ 95

Query: 63  RELAKAIKRARYLGLIAYVNL 83
           R L  AIKRAR L LI +  L
Sbjct: 96  RRLTTAIKRARVLALIPFTPL 116


>gi|27379189|ref|NP_770718.1| 30S ribosomal protein S18 [Bradyrhizobium japonicum USDA 110]
 gi|59798894|sp|Q89MW4|RS18_BRAJA RecName: Full=30S ribosomal protein S18
 gi|27352340|dbj|BAC49343.1| 30S ribosomal protein S18 [Bradyrhizobium japonicum USDA 110]
          Length = 79

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 7  RRPFFRRRKSCPFTGANAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|187777390|ref|ZP_02993863.1| hypothetical protein CLOSPO_00946 [Clostridium sporogenes ATCC
          15579]
 gi|187774318|gb|EDU38120.1| hypothetical protein CLOSPO_00946 [Clostridium sporogenes ATCC
          15579]
          Length = 80

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/66 (46%), Positives = 43/66 (65%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          +RK C    + +  IDYKDI  L +F+++RGKI+P RIS    K QREL +AIKRAR + 
Sbjct: 14 KRKVCTFCMEKSEAIDYKDINKLRKFVTERGKILPRRISGNCAKHQRELTRAIKRARNIA 73

Query: 77 LIAYVN 82
          L+ +  
Sbjct: 74 LLPFTT 79


>gi|73539550|ref|YP_299917.1| 30S ribosomal protein S18 [Ralstonia eutropha JMP134]
 gi|123773854|sp|Q46P61|RS182_RALEJ RecName: Full=30S ribosomal protein S18 2
 gi|72122887|gb|AAZ65073.1| SSU ribosomal protein S18P [Ralstonia eutropha JMP134]
          Length = 92

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 41/69 (59%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            R++ C  +  G  +IDYKD+  L  F+   GKI P+R++      QR+L  AIKRAR+
Sbjct: 21 FKRKRYCRFTVAGVEQIDYKDLDTLKDFIGDNGKITPARLTGTKAHYQRQLNTAIKRARF 80

Query: 75 LGLIAYVNL 83
          L L+ Y +L
Sbjct: 81 LALLPYTDL 89


>gi|299769499|ref|YP_003731525.1| 30S ribosomal protein S18 [Acinetobacter sp. DR1]
 gi|298699587|gb|ADI90152.1| 30S ribosomal protein S18 [Acinetobacter sp. DR1]
          Length = 75

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI  L +++++ GKIVPSRI+    + QR+LA AIK+A
Sbjct: 3  RFYRRRKFCRFTAENVVYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQA 62

Query: 73 RYLGLIAYVN 82
          RYL LI Y +
Sbjct: 63 RYLSLIPYTD 72


>gi|238917873|ref|YP_002931390.1| small subunit ribosomal protein S18 [Eubacterium eligens ATCC
          27750]
 gi|238873233|gb|ACR72943.1| small subunit ribosomal protein S18 [Eubacterium eligens ATCC
          27750]
          Length = 87

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 38/63 (60%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C         +DYKD+  L  ++S+RGKI+P RI+    K QR L  A+KRAR++ L
Sbjct: 22 KKVCAFCADANKVLDYKDVATLKHYVSERGKILPRRITGNCAKHQRALTVAVKRARHVAL 81

Query: 78 IAY 80
          + Y
Sbjct: 82 LPY 84


>gi|117929338|ref|YP_873889.1| 30S ribosomal protein S18 [Acidothermus cellulolyticus 11B]
 gi|166220918|sp|A0LWU3|RS18_ACIC1 RecName: Full=30S ribosomal protein S18
 gi|117649801|gb|ABK53903.1| SSU ribosomal protein S18P [Acidothermus cellulolyticus 11B]
          Length = 78

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C    +G   +DYKD  LL +F+S RGKI   R++    + QR++A AIK +R + L+ 
Sbjct: 13 VCVFCKEGITYVDYKDTNLLRKFISDRGKIRARRVTGNCAQHQRDVATAIKNSREMALLP 72

Query: 80 YVN 82
          Y N
Sbjct: 73 YTN 75


>gi|322420134|ref|YP_004199357.1| 30S ribosomal protein S18 [Geobacter sp. M18]
 gi|320126521|gb|ADW14081.1| ribosomal protein S18 [Geobacter sp. M18]
          Length = 93

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 41/70 (58%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++    RRK C         IDYKD R L  F+S+RGKI+P RIS    K QRE+ +AI
Sbjct: 16 RKKRPFQRRKVCRFCADKQVSIDYKDPRTLRYFVSERGKIIPRRISGNCSKHQREITEAI 75

Query: 70 KRARYLGLIA 79
          KRAR + L+ 
Sbjct: 76 KRARNIALLP 85


>gi|116667427|pdb|2GY9|R Chain R, Structure Of The 30s Subunit Of A Pre-Translocational E.
          Coli Ribosome Obtained By Fitting Atomic Models For Rna
          And Protein Components Into Cryo-Em Map Emd-1056
 gi|116667479|pdb|2GYB|R Chain R, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli
          Ribosome Complex Obtained By Fitting Atomic Models For
          Rna And Protein Components Into Cryo-Em Map Emd-1143
          Length = 69

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 1  RRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLS 60

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 61 LLPYTD 66


>gi|297621053|ref|YP_003709190.1| 30S ribosomal protein S18 [Waddlia chondrophila WSU 86-1044]
 gi|297376354|gb|ADI38184.1| 30S ribosomal protein S18 [Waddlia chondrophila WSU 86-1044]
          Length = 88

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 49/78 (62%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
           +    +      R+K CP +  G   IDYK+I  L++F+++RGKI+P RI+ VS   QR
Sbjct: 9  RSRLARMTGGRPRRKKRCPFTTAGVKEIDYKNIEQLSKFITERGKILPRRITGVSAHHQR 68

Query: 64 ELAKAIKRARYLGLIAYV 81
           L+ AIKRAR++ L+ +V
Sbjct: 69 MLSTAIKRARHMALLPFV 86


>gi|170692294|ref|ZP_02883457.1| ribosomal protein S18 [Burkholderia graminis C4D1M]
 gi|307729539|ref|YP_003906763.1| 30S ribosomal protein S18 [Burkholderia sp. CCGE1003]
 gi|170142724|gb|EDT10889.1| ribosomal protein S18 [Burkholderia graminis C4D1M]
 gi|307584074|gb|ADN57472.1| ribosomal protein S18 [Burkholderia sp. CCGE1003]
          Length = 91

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 43/80 (53%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +       +  +  R+K C  +  G   IDYKDI  L  F+ + GKI P+R++      Q
Sbjct: 8  KFDKRRQQQNPLFKRKKFCRFTAAGVEYIDYKDIETLKDFIGENGKITPARLTGTKSHYQ 67

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 68 RQLDTAIKRARFLALVPYTD 87


>gi|91977454|ref|YP_570113.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris BisB5]
 gi|123721763|sp|Q135M7|RS18_RHOPS RecName: Full=30S ribosomal protein S18
 gi|91683910|gb|ABE40212.1| SSU ribosomal protein S18P [Rhodopseudomonas palustris BisB5]
          Length = 79

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 48/71 (67%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 7  RRPFFRRRKTCPFTGTNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|52841821|ref|YP_095620.1| 30S ribosomal protein S18 [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|54294365|ref|YP_126780.1| 30S ribosomal protein S18 [Legionella pneumophila str. Lens]
 gi|54297504|ref|YP_123873.1| 30S ribosomal protein S18 [Legionella pneumophila str. Paris]
 gi|148359128|ref|YP_001250335.1| 30S ribosomal protein S18 [Legionella pneumophila str. Corby]
 gi|296107176|ref|YP_003618876.1| rpsR 30S ribosomal protein S18 [Legionella pneumophila 2300/99
          Alcoy]
 gi|81679230|sp|Q5WWL9|RS18_LEGPL RecName: Full=30S ribosomal protein S18
 gi|81679473|sp|Q5X4X1|RS18_LEGPA RecName: Full=30S ribosomal protein S18
 gi|81680465|sp|Q5ZV49|RS18_LEGPH RecName: Full=30S ribosomal protein S18
 gi|166220957|sp|A5IC89|RS18_LEGPC RecName: Full=30S ribosomal protein S18
 gi|52628932|gb|AAU27673.1| 30S ribosomal protein S18 [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|53751289|emb|CAH12700.1| 30S ribosomal subunit protein S18 [Legionella pneumophila str.
          Paris]
 gi|53754197|emb|CAH15674.1| 30S ribosomal subunit protein S18 [Legionella pneumophila str.
          Lens]
 gi|148280901|gb|ABQ54989.1| 30S ribosomal protein S18 [Legionella pneumophila str. Corby]
 gi|295649077|gb|ADG24924.1| rpsR 30S ribosomal protein S18 [Legionella pneumophila 2300/99
          Alcoy]
 gi|307610291|emb|CBW99855.1| 30S ribosomal subunit protein S18 [Legionella pneumophila 130b]
          Length = 75

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 47/69 (68%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             R+K C  S +G   IDYKDI LL  ++++ GKIVPSRI+    + QR+LAKAIK AR
Sbjct: 4  YFRRKKMCRFSAEGGNEIDYKDINLLKNYITETGKIVPSRITGTQTRFQRQLAKAIKHAR 63

Query: 74 YLGLIAYVN 82
          ++GL+ Y +
Sbjct: 64 FIGLLPYCD 72


>gi|71906857|ref|YP_284444.1| SSU ribosomal protein S18P [Dechloromonas aromatica RCB]
 gi|71846478|gb|AAZ45974.1| SSU ribosomal protein S18P [Dechloromonas aromatica RCB]
          Length = 91

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 42/68 (61%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RRK C  + +   +IDYKD+ +L  F+ +  KI+P+R++      QR+L  AIKRAR+
Sbjct: 21 FKRRKFCRFTAEKVEQIDYKDVDVLKEFIQENAKIMPARLTGTKAGYQRQLGTAIKRARF 80

Query: 75 LGLIAYVN 82
          + L+ Y +
Sbjct: 81 MALLPYTD 88


>gi|85707088|ref|ZP_01038176.1| 30S ribosomal protein S18 [Roseovarius sp. 217]
 gi|149203937|ref|ZP_01880905.1| 30S ribosomal protein S18 [Roseovarius sp. TM1035]
 gi|85668374|gb|EAQ23247.1| 30S ribosomal protein S18 [Roseovarius sp. 217]
 gi|149142379|gb|EDM30424.1| 30S ribosomal protein S18 [Roseovarius sp. TM1035]
          Length = 75

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 46/72 (63%), Positives = 57/72 (79%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK CP SG  AP+IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA+A
Sbjct: 1  MATKPFFRRRKVCPFSGDSAPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|293375552|ref|ZP_06621826.1| ribosomal protein S18 [Turicibacter sanguinis PC909]
 gi|325845115|ref|ZP_08168426.1| ribosomal protein S18 [Turicibacter sp. HGF1]
 gi|292645769|gb|EFF63805.1| ribosomal protein S18 [Turicibacter sanguinis PC909]
 gi|325488857|gb|EGC91255.1| ribosomal protein S18 [Turicibacter sp. HGF1]
          Length = 77

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 42/62 (67%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C  +     +IDYKD+ LL RF+S RGKI+P R++  S K QREL  AIKRAR++ L+
Sbjct: 13 KVCYFTTNKITKIDYKDVDLLKRFVSDRGKILPRRVTGTSAKYQRELTVAIKRARHMALL 72

Query: 79 AY 80
           +
Sbjct: 73 PF 74


>gi|293400277|ref|ZP_06644423.1| ribosomal protein S18 [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306677|gb|EFE47920.1| ribosomal protein S18 [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 76

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 44/73 (60%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++    R+K C  +      IDYKD+ LL RF+S  GKI+P R++    K QR LA AI
Sbjct: 3  FKKQRMGRKKVCYFTKNKIEYIDYKDVELLKRFISANGKIIPRRVTGTRAKYQRMLATAI 62

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ YV+
Sbjct: 63 KRARQMALLPYVS 75


>gi|306820942|ref|ZP_07454562.1| 30S ribosomal protein S18 [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
 gi|304551056|gb|EFM39027.1| 30S ribosomal protein S18 [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
          Length = 83

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 48/81 (59%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA+             R+K  P +G    +IDYKD+ LL +F+S+RGKI+P R++  S K
Sbjct: 1  MADKKQATQNLGFRKRRKKVDPFAGDKINQIDYKDVALLKKFISERGKILPRRVTGTSAK 60

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QR+L  AIKRAR + L+ Y 
Sbjct: 61 AQRKLTNAIKRARIVALLPYT 81


>gi|283798280|ref|ZP_06347433.1| ribosomal protein S18 [Clostridium sp. M62/1]
 gi|291074059|gb|EFE11423.1| ribosomal protein S18 [Clostridium sp. M62/1]
 gi|295090607|emb|CBK76714.1| SSU ribosomal protein S18P [Clostridium cf. saccharolyticum K10]
 gi|295115695|emb|CBL36542.1| SSU ribosomal protein S18P [butyrate-producing bacterium SM4/1]
          Length = 88

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C   G+    IDYKD   L R++S+RGKI+P RI+    K QR L  AIKRAR++ L+ 
Sbjct: 25 VCVFCGEKNGTIDYKDTNKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHIALMP 84

Query: 80 YV 81
          Y 
Sbjct: 85 YT 86


>gi|163790927|ref|ZP_02185350.1| 30S ribosomal protein S18 [Carnobacterium sp. AT7]
 gi|159873769|gb|EDP67850.1| 30S ribosomal protein S18 [Carnobacterium sp. AT7]
          Length = 79

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 46/72 (63%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK    +      +DYKD+ LL RF+S+RG+I+P R++    K QR+L KAIK
Sbjct: 5  RRGGKKRRKVDFFAANHIEHVDYKDVDLLKRFISERGRILPRRVTGTYAKNQRKLTKAIK 64

Query: 71 RARYLGLIAYVN 82
          RAR +GL+ +V 
Sbjct: 65 RARIMGLLPFVT 76


>gi|258405219|ref|YP_003197961.1| 30S ribosomal protein S18 [Desulfohalobium retbaense DSM 5692]
 gi|257797446|gb|ACV68383.1| ribosomal protein S18 [Desulfohalobium retbaense DSM 5692]
          Length = 86

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           RR    R+K C         +DYK+I LL  F++ RGKI+  RI+    K QR+L + I
Sbjct: 3  FRRKFRPRKKVCRFCQDNELNLDYKNIELLQDFVTARGKIIARRITGTCAKHQRQLTREI 62

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ Y  
Sbjct: 63 KRARQMALLYYTT 75


>gi|134095345|ref|YP_001100420.1| 30S ribosomal protein S18 [Herminiimonas arsenicoxydans]
 gi|133739248|emb|CAL62297.1| 30S ribosomal protein S18 [Herminiimonas arsenicoxydans]
          Length = 94

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 47/82 (57%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          +++      +  +  R+K C  +     ++DYKD+  L  F+ + GKI+P+R++      
Sbjct: 10 SKLKEKRKQQNPLFKRKKFCRFTAAHVEQVDYKDVDTLKDFVQENGKIMPARLTGTKAIY 69

Query: 62 QRELAKAIKRARYLGLIAYVNL 83
          QR++  AIKRAR+L L+ Y +L
Sbjct: 70 QRQVDTAIKRARFLALLPYTDL 91


>gi|163842734|ref|YP_001627138.1| 30S ribosomal protein S18 [Brucella suis ATCC 23445]
 gi|189029668|sp|B0CKD8|RS18_BRUSI RecName: Full=30S ribosomal protein S18
 gi|163673457|gb|ABY37568.1| ribosomal protein S18 [Brucella suis ATCC 23445]
          Length = 82

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 64/81 (79%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++   P  RR    R K+CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDINQIPT-RRPFHRRHKTCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
          KQRELAKAIKRAR+LGL+ YV
Sbjct: 60 KQRELAKAIKRARFLGLLPYV 80


>gi|255066238|ref|ZP_05318093.1| ribosomal protein S18 [Neisseria sicca ATCC 29256]
 gi|255049448|gb|EET44912.1| ribosomal protein S18 [Neisseria sicca ATCC 29256]
          Length = 76

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 45/73 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK C  + +    +D+K + LL  F+S+ GKI+P+RI+      QR+LA A+
Sbjct: 1  MARQSFKRRKFCRFTAEKIQEVDHKQVDLLKDFISENGKIIPARITGTKAHYQRQLATAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|153872064|ref|ZP_02001064.1| Ribosomal protein S18 [Beggiatoa sp. PS]
 gi|152071467|gb|EDN68933.1| Ribosomal protein S18 [Beggiatoa sp. PS]
          Length = 75

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              R+K C  + +G   IDYKD+ LL  ++++ GKIVPSRI+    K QR+LA A+K A
Sbjct: 3  RFFRRKKYCRFTAEGIKEIDYKDLNLLKGYVTETGKIVPSRITGTRTKYQRQLATAVKLA 62

Query: 73 RYLGLIAYVN 82
          R+L L+ Y +
Sbjct: 63 RFLALLPYSD 72


>gi|148265697|ref|YP_001232403.1| 30S ribosomal protein S18 [Geobacter uraniireducens Rf4]
 gi|189029678|sp|A5G7R2|RS18_GEOUR RecName: Full=30S ribosomal protein S18
 gi|146399197|gb|ABQ27830.1| SSU ribosomal protein S18P [Geobacter uraniireducens Rf4]
          Length = 91

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 41/70 (58%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++    RRK C         IDYKD R L  F+S+RGKI+P RIS    K QRE+ +AI
Sbjct: 14 RKKRPFQRRKVCRFCADKQVSIDYKDPRTLRYFISERGKIIPRRISGNCAKHQREITEAI 73

Query: 70 KRARYLGLIA 79
          KRAR + L+ 
Sbjct: 74 KRARNIALLP 83


>gi|49474087|ref|YP_032129.1| 30S ribosomal protein S18 [Bartonella quintana str. Toulouse]
 gi|59798702|sp|Q6G061|RS18_BARQU RecName: Full=30S ribosomal protein S18
 gi|49239591|emb|CAF25948.1| 30s ribosomal protein s18 [Bartonella quintana str. Toulouse]
          Length = 82

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKDI+LL R++S+RGKIVPSRI++VS K+QRELA AIK
Sbjct: 10 RRPFHRRRKTCPFSGANAPKIDYKDIKLLQRYISERGKIVPSRITAVSQKRQRELANAIK 69

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 70 RARFLGLLPYV 80


>gi|86749583|ref|YP_486079.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris HaA2]
 gi|115525312|ref|YP_782223.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris BisA53]
 gi|122295614|sp|Q07LE1|RS18_RHOP5 RecName: Full=30S ribosomal protein S18
 gi|123098720|sp|Q2IX92|RS18_RHOP2 RecName: Full=30S ribosomal protein S18
 gi|86572611|gb|ABD07168.1| SSU ribosomal protein S18P [Rhodopseudomonas palustris HaA2]
 gi|115519259|gb|ABJ07243.1| SSU ribosomal protein S18P [Rhodopseudomonas palustris BisA53]
          Length = 79

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 48/71 (67%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 7  RRPFFRRRKTCPFTGPNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|223982851|ref|ZP_03633072.1| hypothetical protein HOLDEFILI_00346 [Holdemania filiformis DSM
          12042]
 gi|223965173|gb|EEF69464.1| hypothetical protein HOLDEFILI_00346 [Holdemania filiformis DSM
          12042]
          Length = 76

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 44/73 (60%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++    R+K C  +      IDYKD+ LL RF+S  GKI+P R++    K QR LA AI
Sbjct: 3  FKKQRMGRKKVCYFTKNNITSIDYKDVELLKRFVSANGKIIPRRVTGTRAKYQRMLATAI 62

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ YVN
Sbjct: 63 KRARQMALLPYVN 75


>gi|146328891|ref|YP_001210004.1| 30S ribosomal protein S18 [Dichelobacter nodosus VCS1703A]
 gi|205557281|sp|A5EXN0|RS18_DICNV RecName: Full=30S ribosomal protein S18
 gi|146232361|gb|ABQ13339.1| 30S ribosomal protein S18 [Dichelobacter nodosus VCS1703A]
          Length = 71

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 47/69 (68%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          ++ R++ C  + +G   IDYKD+  L  ++++ GKIVP+RI+  +   QR+LA A+KRAR
Sbjct: 1  MARRKRICRFTAEGVKEIDYKDLETLKAYITEVGKIVPARITGTNVFYQRQLATAVKRAR 60

Query: 74 YLGLIAYVN 82
          +L L+ Y +
Sbjct: 61 FLALLPYTD 69


>gi|295398127|ref|ZP_06808176.1| 30S ribosomal protein S18 [Aerococcus viridans ATCC 11563]
 gi|294973646|gb|EFG49424.1| 30S ribosomal protein S18 [Aerococcus viridans ATCC 11563]
          Length = 78

 Score = 97.4 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 35/63 (55%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         +DYKD  LL R++S++GKI+P R++    K QR L   IKRAR + LI 
Sbjct: 14 VCFFCANHIDHVDYKDTDLLKRYISEKGKILPRRVTGTCAKHQRTLTAGIKRARIMALIP 73

Query: 80 YVN 82
          +  
Sbjct: 74 FTT 76


>gi|126642217|ref|YP_001085201.1| 30S ribosomal protein S18 [Acinetobacter baumannii ATCC 17978]
 gi|169633237|ref|YP_001706973.1| 30S ribosomal protein S18 [Acinetobacter baumannii SDF]
 gi|169795503|ref|YP_001713296.1| 30S ribosomal protein S18 [Acinetobacter baumannii AYE]
 gi|184158695|ref|YP_001847034.1| 30S ribosomal protein S18 [Acinetobacter baumannii ACICU]
 gi|213158557|ref|YP_002319855.1| ribosomal protein S18 [Acinetobacter baumannii AB0057]
 gi|215482990|ref|YP_002325195.1| ribosomal protein S18 [Acinetobacter baumannii AB307-0294]
 gi|226952676|ref|ZP_03823140.1| 30S ribosomal protein S18 [Acinetobacter sp. ATCC 27244]
 gi|239501437|ref|ZP_04660747.1| 30S ribosomal protein S18 [Acinetobacter baumannii AB900]
 gi|260549409|ref|ZP_05823628.1| ribosomal protein S18 [Acinetobacter sp. RUH2624]
 gi|260554565|ref|ZP_05826786.1| ribosomal protein S18 [Acinetobacter baumannii ATCC 19606]
 gi|262372195|ref|ZP_06065474.1| ribosomal protein S18 [Acinetobacter junii SH205]
 gi|293609461|ref|ZP_06691763.1| 30S ribosomal protein S18 [Acinetobacter sp. SH024]
 gi|294649990|ref|ZP_06727378.1| 30S ribosomal protein S18 [Acinetobacter haemolyticus ATCC 19194]
 gi|301345097|ref|ZP_07225838.1| 30S ribosomal protein S18 [Acinetobacter baumannii AB056]
 gi|301510831|ref|ZP_07236068.1| 30S ribosomal protein S18 [Acinetobacter baumannii AB058]
 gi|301595324|ref|ZP_07240332.1| 30S ribosomal protein S18 [Acinetobacter baumannii AB059]
 gi|332850734|ref|ZP_08432981.1| ribosomal protein S18 [Acinetobacter baumannii 6013150]
 gi|332866955|ref|ZP_08437281.1| ribosomal protein S18 [Acinetobacter baumannii 6013113]
 gi|332873687|ref|ZP_08441630.1| ribosomal protein S18 [Acinetobacter baumannii 6014059]
 gi|166220917|sp|A3M6Q5|RS18_ACIBT RecName: Full=30S ribosomal protein S18
 gi|226735105|sp|B7H0J9|RS18_ACIB3 RecName: Full=30S ribosomal protein S18
 gi|226735106|sp|B7IBC2|RS18_ACIB5 RecName: Full=30S ribosomal protein S18
 gi|229470506|sp|B2HUA3|RS18_ACIBC RecName: Full=30S ribosomal protein S18
 gi|229470507|sp|B0VM09|RS18_ACIBS RecName: Full=30S ribosomal protein S18
 gi|229470508|sp|B0V7G6|RS18_ACIBY RecName: Full=30S ribosomal protein S18
 gi|126388101|gb|ABO12599.1| 30S ribosomal protein S18 [Acinetobacter baumannii ATCC 17978]
 gi|169148430|emb|CAM86296.1| 30S ribosomal protein S18 [Acinetobacter baumannii AYE]
 gi|169152029|emb|CAP00909.1| 30S ribosomal protein S18 [Acinetobacter baumannii]
 gi|183210289|gb|ACC57687.1| putative 30S ribosomal protein S18 [Acinetobacter baumannii
          ACICU]
 gi|213057717|gb|ACJ42619.1| ribosomal protein S18 [Acinetobacter baumannii AB0057]
 gi|213989129|gb|ACJ59428.1| ribosomal protein S18 [Acinetobacter baumannii AB307-0294]
 gi|226836582|gb|EEH68965.1| 30S ribosomal protein S18 [Acinetobacter sp. ATCC 27244]
 gi|260407518|gb|EEX00992.1| ribosomal protein S18 [Acinetobacter sp. RUH2624]
 gi|260411107|gb|EEX04404.1| ribosomal protein S18 [Acinetobacter baumannii ATCC 19606]
 gi|262312220|gb|EEY93305.1| ribosomal protein S18 [Acinetobacter junii SH205]
 gi|292824083|gb|EFF82898.1| 30S ribosomal protein S18 [Acinetobacter haemolyticus ATCC 19194]
 gi|292827913|gb|EFF86276.1| 30S ribosomal protein S18 [Acinetobacter sp. SH024]
 gi|322507495|gb|ADX02949.1| rpsR [Acinetobacter baumannii 1656-2]
 gi|323518609|gb|ADX92990.1| 30S ribosomal protein S18 [Acinetobacter baumannii TCDC-AB0715]
 gi|325122723|gb|ADY82246.1| 30S ribosomal protein S18 [Acinetobacter calcoaceticus PHEA-2]
 gi|332730571|gb|EGJ61887.1| ribosomal protein S18 [Acinetobacter baumannii 6013150]
 gi|332734336|gb|EGJ65463.1| ribosomal protein S18 [Acinetobacter baumannii 6013113]
 gi|332738075|gb|EGJ68959.1| ribosomal protein S18 [Acinetobacter baumannii 6014059]
          Length = 75

 Score = 97.4 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI  L +++++ GKIVPSRI+    + QR+LA AIK+A
Sbjct: 3  RFYRRRKFCRFTAENVAYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQA 62

Query: 73 RYLGLIAYVN 82
          RYL LI Y +
Sbjct: 63 RYLSLIPYTD 72


>gi|323342372|ref|ZP_08082604.1| 30S ribosomal protein S18 [Erysipelothrix rhusiopathiae ATCC
          19414]
 gi|322463484|gb|EFY08678.1| 30S ribosomal protein S18 [Erysipelothrix rhusiopathiae ATCC
          19414]
          Length = 77

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 44/73 (60%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R+    RRK C  +      IDYKD+ LL RF+S  GKI+P R++    K QR LA AI
Sbjct: 3  FRKFRGPRRKVCYFTKNNVKTIDYKDVELLKRFISANGKIIPRRVTGTKAKYQRPLATAI 62

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ YV+
Sbjct: 63 KRARQMALLPYVS 75


>gi|302384674|ref|YP_003820496.1| ribosomal protein S18 [Clostridium saccharolyticum WM1]
 gi|302195302|gb|ADL02873.1| ribosomal protein S18 [Clostridium saccharolyticum WM1]
          Length = 88

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C   G+    IDYKD+  L R++S+RGKI+P RI+    K QR L  AIKRAR++ L+ 
Sbjct: 25 VCVFCGEKNGVIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHIALMP 84

Query: 80 YV 81
          Y 
Sbjct: 85 YT 86


>gi|92117879|ref|YP_577608.1| 30S ribosomal protein S18 [Nitrobacter hamburgensis X14]
 gi|123083638|sp|Q1QKU9|RS18_NITHX RecName: Full=30S ribosomal protein S18
 gi|91800773|gb|ABE63148.1| SSU ribosomal protein S18P [Nitrobacter hamburgensis X14]
          Length = 79

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+A+K
Sbjct: 7  RRPFFRRRKTCPFTGANAPKIDYKDSKLLMRYISERGKIVPSRITAVSAKKQRELARAVK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|320109096|ref|YP_004184686.1| 30S ribosomal protein S18 [Terriglobus saanensis SP1PR4]
 gi|319927617|gb|ADV84692.1| ribosomal protein S18 [Terriglobus saanensis SP1PR4]
          Length = 127

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 44/69 (63%)

Query: 12  RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
           R    R+K C    +   +I Y+D+RLL  F+++RGKIVP R++ V    QR+L+ AIK+
Sbjct: 55  RKFFRRKKVCKFCVEKIDQISYRDVRLLQGFVAERGKIVPRRLTGVCTTHQRQLSLAIKQ 114

Query: 72  ARYLGLIAY 80
           AR + L+ +
Sbjct: 115 ARNIALLPF 123


>gi|118594784|ref|ZP_01552131.1| 30S ribosomal protein S18 [Methylophilales bacterium HTCC2181]
 gi|118440562|gb|EAV47189.1| 30S ribosomal protein S18 [Methylophilales bacterium HTCC2181]
          Length = 75

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 48/73 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R +  RR+ C  S +G   +DYKDI LL  F+++ GK++P+RI+    K QR+L  A+
Sbjct: 1  MAREMYKRRRYCRFSAEGIKEVDYKDIDLLKDFITENGKLIPARITGTKSKYQRQLGTAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|266620038|ref|ZP_06112973.1| ribosomal protein S18 [Clostridium hathewayi DSM 13479]
 gi|288868399|gb|EFD00698.1| ribosomal protein S18 [Clostridium hathewayi DSM 13479]
          Length = 88

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C   G+    IDYKD+  L R++S+RGKI+P RI+    K QR L  AIKRAR++ L+ 
Sbjct: 25 VCVFCGEKNGTIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAIKRARHIALMP 84

Query: 80 YV 81
          Y 
Sbjct: 85 YT 86


>gi|160916101|ref|ZP_02078308.1| hypothetical protein EUBDOL_02128 [Eubacterium dolichum DSM 3991]
 gi|158431825|gb|EDP10114.1| hypothetical protein EUBDOL_02128 [Eubacterium dolichum DSM 3991]
          Length = 76

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 44/73 (60%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++    R+K C  +      IDYKD+ LL RF+S  GKI+P R++    K QR LA AI
Sbjct: 3  FKKQRMGRKKVCYFTKNKIETIDYKDVELLKRFISANGKIIPRRVTGTRAKYQRMLATAI 62

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ YV+
Sbjct: 63 KRARQMALLPYVS 75


>gi|300777789|ref|ZP_07087647.1| 30S ribosomal protein S18 [Chryseobacterium gleum ATCC 35910]
 gi|300503299|gb|EFK34439.1| 30S ribosomal protein S18 [Chryseobacterium gleum ATCC 35910]
          Length = 100

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 43/69 (62%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
          N    +K C     G   +DYKD   L +F++++GKI+P R +  S K QR+++ AIKRA
Sbjct: 27 NTKSEKKYCRFKKYGIKHVDYKDADFLLQFVNEQGKILPRRYTGTSLKYQRKVSAAIKRA 86

Query: 73 RYLGLIAYV 81
          R+L L+ YV
Sbjct: 87 RHLALLPYV 95


>gi|167629778|ref|YP_001680277.1| 30S ribosomal protein s18 [Heliobacterium modesticaldum Ice1]
 gi|205558496|sp|B0TE71|RS18_HELMI RecName: Full=30S ribosomal protein S18
 gi|167592518|gb|ABZ84266.1| 30S ribosomal protein s18 [Heliobacterium modesticaldum Ice1]
          Length = 86

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 38/62 (61%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         +DYK++  L +++++RGKI+P R+S    K QR+L  AIKRAR++ L+ 
Sbjct: 22 ICFFCVDKIETVDYKEVGKLRKYITERGKILPRRVSGCCAKHQRQLTNAIKRARHVALLP 81

Query: 80 YV 81
          + 
Sbjct: 82 FT 83


>gi|304319743|ref|YP_003853386.1| 30S ribosomal protein S18 [Parvularcula bermudensis HTCC2503]
 gi|303298646|gb|ADM08245.1| 30S ribosomal protein S18 [Parvularcula bermudensis HTCC2503]
          Length = 74

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 45/73 (61%), Positives = 59/73 (80%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + +    RRK+CP SG+ AP+IDYKD +LL R++S++GKIVPSRIS+VS KKQRELA+AI
Sbjct: 1  MAKTFFRRRKTCPFSGEKAPKIDYKDPKLLGRYISEKGKIVPSRISAVSAKKQRELARAI 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y  
Sbjct: 61 KRARFLALLPYTT 73


>gi|229917472|ref|YP_002886118.1| ribosomal protein S18 [Exiguobacterium sp. AT1b]
 gi|229468901|gb|ACQ70673.1| ribosomal protein S18 [Exiguobacterium sp. AT1b]
          Length = 76

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 41/63 (65%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C  +      IDYKD+ LL RF+S+RGKI+P R++  S K QR L  AIKR+R + L+
Sbjct: 12 KVCFFTSNNITHIDYKDVELLKRFVSERGKILPRRVTGTSAKYQRPLTVAIKRSRQMALL 71

Query: 79 AYV 81
           YV
Sbjct: 72 PYV 74


>gi|330718016|ref|ZP_08312616.1| 30S ribosomal protein S18 [Leuconostoc fallax KCTC 3537]
          Length = 93

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/64 (43%), Positives = 43/64 (67%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYK++ LL RF+S+RGKI+P R++  S K QR++  A+KRAR +GL+
Sbjct: 28 KVDFIAANHIEYIDYKNVELLERFISERGKILPRRVTGTSAKNQRKVTTAVKRARIMGLL 87

Query: 79 AYVN 82
           +V 
Sbjct: 88 PFVT 91


>gi|22124560|ref|NP_667983.1| 30S ribosomal protein S18 [Yersinia pestis KIM 10]
 gi|45440398|ref|NP_991937.1| 30S ribosomal protein S18 [Yersinia pestis biovar Microtus str.
          91001]
 gi|51594792|ref|YP_068983.1| 30S ribosomal protein S18 [Yersinia pseudotuberculosis IP 32953]
 gi|108806085|ref|YP_650001.1| 30S ribosomal protein S18 [Yersinia pestis Antiqua]
 gi|108813441|ref|YP_649208.1| 30S ribosomal protein S18 [Yersinia pestis Nepal516]
 gi|123440775|ref|YP_001004767.1| 30S ribosomal protein S18 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|145600833|ref|YP_001164909.1| 30S ribosomal protein S18 [Yersinia pestis Pestoides F]
 gi|153949310|ref|YP_001402591.1| 30S ribosomal protein S18 [Yersinia pseudotuberculosis IP 31758]
 gi|153997314|ref|ZP_02022414.1| 30S ribosomal protein S18 [Yersinia pestis CA88-4125]
 gi|157368695|ref|YP_001476684.1| 30S ribosomal protein S18 [Serratia proteamaculans 568]
 gi|162420420|ref|YP_001605262.1| 30S ribosomal protein S18 [Yersinia pestis Angola]
 gi|165928152|ref|ZP_02223984.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165937415|ref|ZP_02225978.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str.
          IP275]
 gi|166011310|ref|ZP_02232208.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166213997|ref|ZP_02240032.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|167401213|ref|ZP_02306713.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167420501|ref|ZP_02312254.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167423736|ref|ZP_02315489.1| ribosomal protein S18 [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|170025997|ref|YP_001722502.1| 30S ribosomal protein S18 [Yersinia pseudotuberculosis YPIII]
 gi|186893801|ref|YP_001870913.1| 30S ribosomal protein S18 [Yersinia pseudotuberculosis PB1/+]
 gi|218930551|ref|YP_002348426.1| 30S ribosomal protein S18 [Yersinia pestis CO92]
 gi|229836651|ref|ZP_04456817.1| 30S ribosomal subunit protein S18 [Yersinia pestis Pestoides A]
 gi|229839191|ref|ZP_04459350.1| 30S ribosomal subunit protein S18 [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229899755|ref|ZP_04514896.1| 30S ribosomal subunit protein S18 [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229903917|ref|ZP_04519030.1| 30S ribosomal subunit protein S18 [Yersinia pestis Nepal516]
 gi|238750086|ref|ZP_04611589.1| 30S ribosomal protein S18 [Yersinia rohdei ATCC 43380]
 gi|238787555|ref|ZP_04631353.1| 30S ribosomal protein S18 [Yersinia frederiksenii ATCC 33641]
 gi|238792979|ref|ZP_04636608.1| 30S ribosomal protein S18 [Yersinia intermedia ATCC 29909]
 gi|261342859|ref|ZP_05970717.1| ribosomal protein S18 [Enterobacter cancerogenus ATCC 35316]
 gi|270265016|ref|ZP_06193279.1| 30S ribosomal protein S18 [Serratia odorifera 4Rx13]
 gi|270489093|ref|ZP_06206167.1| ribosomal protein S18 [Yersinia pestis KIM D27]
 gi|304396940|ref|ZP_07378820.1| ribosomal protein S18 [Pantoea sp. aB]
 gi|308188253|ref|YP_003932384.1| 30S ribosomal protein S18 [Pantoea vagans C9-1]
 gi|311281252|ref|YP_003943483.1| ribosomal protein S18 [Enterobacter cloacae SCF1]
 gi|322831171|ref|YP_004211198.1| ribosomal protein S18 [Rahnella sp. Y9602]
 gi|332160037|ref|YP_004296614.1| 30S ribosomal protein S18 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|20978696|sp|Q8ZB83|RS18_YERPE RecName: Full=30S ribosomal protein S18
 gi|59798666|sp|Q66FA0|RS18_YERPS RecName: Full=30S ribosomal protein S18
 gi|122979828|sp|Q1CBW6|RS18_YERPA RecName: Full=30S ribosomal protein S18
 gi|123246216|sp|Q1CEH2|RS18_YERPN RecName: Full=30S ribosomal protein S18
 gi|166222257|sp|A1JIT0|RS18_YERE8 RecName: Full=30S ribosomal protein S18
 gi|166222258|sp|A4TRM4|RS18_YERPP RecName: Full=30S ribosomal protein S18
 gi|167011194|sp|A8G8W6|RS18_SERP5 RecName: Full=30S ribosomal protein S18
 gi|167011195|sp|A7FMW3|RS18_YERP3 RecName: Full=30S ribosomal protein S18
 gi|229560085|sp|B2K2L5|RS18_YERPB RecName: Full=30S ribosomal protein S18
 gi|229560086|sp|A9QYL4|RS18_YERPG RecName: Full=30S ribosomal protein S18
 gi|229560087|sp|B1JMM2|RS18_YERPY RecName: Full=30S ribosomal protein S18
 gi|21957360|gb|AAM84234.1|AE013667_7 30S ribosomal subunit protein S18 [Yersinia pestis KIM 10]
 gi|45435255|gb|AAS60814.1| 30S ribosomal protein S18 [Yersinia pestis biovar Microtus str.
          91001]
 gi|51588074|emb|CAH19680.1| 30S ribosomal protein S18 [Yersinia pseudotuberculosis IP 32953]
 gi|108777089|gb|ABG19608.1| SSU ribosomal protein S18P [Yersinia pestis Nepal516]
 gi|108777998|gb|ABG12056.1| SSU ribosomal protein S18P [Yersinia pestis Antiqua]
 gi|115349162|emb|CAL22125.1| 30S ribosomal protein S18 [Yersinia pestis CO92]
 gi|122087736|emb|CAL10521.1| 30S ribosomal protein S18 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|145212529|gb|ABP41936.1| 30S ribosomal protein S18 [Yersinia pestis Pestoides F]
 gi|149288951|gb|EDM39031.1| 30S ribosomal protein S18 [Yersinia pestis CA88-4125]
 gi|152960805|gb|ABS48266.1| ribosomal protein S18 [Yersinia pseudotuberculosis IP 31758]
 gi|157320459|gb|ABV39556.1| ribosomal protein S18 [Serratia proteamaculans 568]
 gi|162353235|gb|ABX87183.1| ribosomal protein S18 [Yersinia pestis Angola]
 gi|165914520|gb|EDR33134.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str.
          IP275]
 gi|165919839|gb|EDR37140.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165989694|gb|EDR41995.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166204792|gb|EDR49272.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|166961307|gb|EDR57328.1| ribosomal protein S18 [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167049238|gb|EDR60646.1| ribosomal protein S18 [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167057906|gb|EDR67652.1| ribosomal protein S18 [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|169752531|gb|ACA70049.1| ribosomal protein S18 [Yersinia pseudotuberculosis YPIII]
 gi|186696827|gb|ACC87456.1| ribosomal protein S18 [Yersinia pseudotuberculosis PB1/+]
 gi|229679687|gb|EEO75790.1| 30S ribosomal subunit protein S18 [Yersinia pestis Nepal516]
 gi|229687247|gb|EEO79322.1| 30S ribosomal subunit protein S18 [Yersinia pestis biovar
          Orientalis str. India 195]
 gi|229695557|gb|EEO85604.1| 30S ribosomal subunit protein S18 [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229706335|gb|EEO92343.1| 30S ribosomal subunit protein S18 [Yersinia pestis Pestoides A]
 gi|238711630|gb|EEQ03845.1| 30S ribosomal protein S18 [Yersinia rohdei ATCC 43380]
 gi|238724342|gb|EEQ15984.1| 30S ribosomal protein S18 [Yersinia frederiksenii ATCC 33641]
 gi|238727579|gb|EEQ19104.1| 30S ribosomal protein S18 [Yersinia intermedia ATCC 29909]
 gi|270040950|gb|EFA14051.1| 30S ribosomal protein S18 [Serratia odorifera 4Rx13]
 gi|270337597|gb|EFA48374.1| ribosomal protein S18 [Yersinia pestis KIM D27]
 gi|288314902|gb|EFC53840.1| ribosomal protein S18 [Enterobacter cancerogenus ATCC 35316]
 gi|304355736|gb|EFM20103.1| ribosomal protein S18 [Pantoea sp. aB]
 gi|308058763|gb|ADO10935.1| 30S ribosomal protein S18 [Pantoea vagans C9-1]
 gi|308750447|gb|ADO50199.1| ribosomal protein S18 [Enterobacter cloacae SCF1]
 gi|318607403|emb|CBY28901.1| SSU ribosomal protein S18p [Yersinia enterocolitica subsp.
          palearctica Y11]
 gi|320013741|gb|ADV97312.1| 30S ribosomal subunit protein S18 [Yersinia pestis biovar
          Medievalis str. Harbin 35]
 gi|321166372|gb|ADW72071.1| ribosomal protein S18 [Rahnella sp. Y9602]
 gi|325664267|gb|ADZ40911.1| 30S ribosomal protein S18 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|330862079|emb|CBX72245.1| 30S ribosomal protein S18 [Yersinia enterocolitica W22703]
          Length = 75

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+ IKRA
Sbjct: 3  RYFRRRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARCIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|217967743|ref|YP_002353249.1| ribosomal protein S18 [Dictyoglomus turgidum DSM 6724]
 gi|254765428|sp|B8E0J0|RS18_DICTD RecName: Full=30S ribosomal protein S18
 gi|217336842|gb|ACK42635.1| ribosomal protein S18 [Dictyoglomus turgidum DSM 6724]
          Length = 84

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 45/71 (63%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +     ++K C    +    IDYK++  L RF++++GKI+P RIS    + QR+L+ AIK
Sbjct: 12 KFAYPSKKKYCIFCSEKIDYIDYKNVERLKRFMTEKGKIIPRRISGNCARHQRQLSTAIK 71

Query: 71 RARYLGLIAYV 81
          RARY+ L+ YV
Sbjct: 72 RARYMALLPYV 82


>gi|320120636|gb|EFE27984.2| 30S ribosomal protein S18 [Filifactor alocis ATCC 35896]
          Length = 77

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 47/73 (64%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
            + NV  R+K  P +G     IDYKD+ LL +++S+RGKI+P R++  S K QR+L  A
Sbjct: 3  FQKGNVRKRKKVDPFAGDKINTIDYKDVALLKKYISERGKILPRRVTGTSAKAQRKLTLA 62

Query: 69 IKRARYLGLIAYV 81
          IKRAR + L+ Y 
Sbjct: 63 IKRARNIALLPYT 75


>gi|114704793|ref|ZP_01437701.1| 30S ribosomal protein S18 [Fulvimarina pelagi HTCC2506]
 gi|114539578|gb|EAU42698.1| 30S ribosomal protein S18 [Fulvimarina pelagi HTCC2506]
          Length = 82

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 62/81 (76%), Gaps = 1/81 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++A  P  RR    RRKS P SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS K
Sbjct: 1  MVDIAQLPT-RRPFHRRRKSDPFSGNDAPKIDYKDVRLLQRYISERGKIVPSRITAVSQK 59

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QR LAKAIKRAR LGL+ YV
Sbjct: 60 NQRALAKAIKRARILGLLPYV 80


>gi|323141489|ref|ZP_08076378.1| ribosomal protein S18 [Phascolarctobacterium sp. YIT 12067]
 gi|322414069|gb|EFY04899.1| ribosomal protein S18 [Phascolarctobacterium sp. YIT 12067]
          Length = 76

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 37/63 (58%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD   L R++++RGKI+P RIS    K QR+L  AIKRAR + L+
Sbjct: 12 KVCSFCVDKVEEIDYKDANKLKRYITERGKILPRRISGTCAKHQRQLTVAIKRARCVALL 71

Query: 79 AYV 81
           + 
Sbjct: 72 PFT 74


>gi|291520307|emb|CBK75528.1| SSU ribosomal protein S18P [Butyrivibrio fibrisolvens 16/4]
          Length = 84

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
            RR +  R+K C   G     IDYKD   L +++S+RGKI+P RI+    K QR L  A
Sbjct: 11 QRRRPMHRRKKVCVFCG-KDNVIDYKDTAKLKKYISERGKILPRRITGTCAKHQRALTVA 69

Query: 69 IKRARYLGLIAYV 81
          IKRAR++ L+ YV
Sbjct: 70 IKRARHVALMPYV 82


>gi|304318114|ref|YP_003853259.1| ribosomal protein S18 [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
 gi|302779616|gb|ADL70175.1| ribosomal protein S18 [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
          Length = 88

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 36/62 (58%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYK++  L +++++RGKI+P RI+      QR+L  AIKRAR + L+ 
Sbjct: 25 VCAFCADKIDYIDYKEVGKLRKYITERGKILPRRITGNCAIHQRQLTVAIKRARQIALLP 84

Query: 80 YV 81
          Y 
Sbjct: 85 YT 86


>gi|197119136|ref|YP_002139563.1| 30S ribosomal protein S18 [Geobacter bemidjiensis Bem]
 gi|253700102|ref|YP_003021291.1| 30S ribosomal protein S18 [Geobacter sp. M21]
 gi|226735120|sp|B5EHW8|RS18_GEOBB RecName: Full=30S ribosomal protein S18
 gi|259494810|sp|C6E504|RS18_GEOSM RecName: Full=30S ribosomal protein S18
 gi|197088496|gb|ACH39767.1| ribosomal protein S18 [Geobacter bemidjiensis Bem]
 gi|251774952|gb|ACT17533.1| ribosomal protein S18 [Geobacter sp. M21]
          Length = 92

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 41/70 (58%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++    RRK C         IDYKD R L  F+S+RGKI+P RIS    K QRE+ +AI
Sbjct: 15 RKKRPFQRRKVCRFCADKQVTIDYKDPRTLRYFVSERGKIIPRRISGNCSKHQREITEAI 74

Query: 70 KRARYLGLIA 79
          KRAR + L+ 
Sbjct: 75 KRARNIALLP 84


>gi|332529061|ref|ZP_08405026.1| 30S ribosomal protein S18 [Hylemonella gracilis ATCC 19624]
 gi|332041505|gb|EGI77866.1| 30S ribosomal protein S18 [Hylemonella gracilis ATCC 19624]
          Length = 93

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 46/80 (57%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R++ C  +  G   IDYKDI  L  F+++ GKI+P+R++      Q
Sbjct: 10 DKRPKRNTQSLLFKRKRFCRFTVAGVEEIDYKDIDTLRDFIAENGKIIPARLTGTRAIYQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 70 RQLNTAIKRARFLALLPYTD 89


>gi|332283720|ref|YP_004415631.1| 30S ribosomal protein S18 [Pusillimonas sp. T7-7]
 gi|330427673|gb|AEC19007.1| 30S ribosomal protein S18 [Pusillimonas sp. T7-7]
          Length = 90

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 44/81 (54%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          ++       +  +  RRK C  +      IDYKD+  L  F+ + GKI+P+R++      
Sbjct: 7  SKEKRKFTQQNPLFKRRKFCRFTAANVDEIDYKDLDTLRDFIQENGKIIPARLTGTKAHY 66

Query: 62 QRELAKAIKRARYLGLIAYVN 82
          QR+L  AIKRAR+L L+ Y +
Sbjct: 67 QRQLDTAIKRARFLALLPYTD 87


>gi|115378659|ref|ZP_01465809.1| ribosomal protein S18 [Stigmatella aurantiaca DW4/3-1]
 gi|310823079|ref|YP_003955437.1| 30S ribosomal protein S18 [Stigmatella aurantiaca DW4/3-1]
 gi|115364325|gb|EAU63410.1| ribosomal protein S18 [Stigmatella aurantiaca DW4/3-1]
 gi|309396151|gb|ADO73610.1| 30S ribosomal protein S18 [Stigmatella aurantiaca DW4/3-1]
          Length = 146

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 42/71 (59%)

Query: 13  NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
               R+K C    +   ++D+KD   L  F+++RGKI+P RIS    K QRE+A AIKRA
Sbjct: 74  RGFGRKKVCRFCAEKNAKVDFKDQATLKYFVTERGKIIPRRISGNCAKHQREVAIAIKRA 133

Query: 73  RYLGLIAYVNL 83
           R L L+ Y  +
Sbjct: 134 RGLALLPYNAM 144


>gi|75675884|ref|YP_318305.1| 30S ribosomal protein S18 [Nitrobacter winogradskyi Nb-255]
 gi|123773250|sp|Q3SRY8|RS18_NITWN RecName: Full=30S ribosomal protein S18
 gi|74420754|gb|ABA04953.1| SSU ribosomal protein S18P [Nitrobacter winogradskyi Nb-255]
          Length = 79

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+A+K
Sbjct: 7  RRPFFRRRKTCPFTGANAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAVK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|85716345|ref|ZP_01047318.1| 30S ribosomal protein S18 [Nitrobacter sp. Nb-311A]
 gi|85696861|gb|EAQ34746.1| 30S ribosomal protein S18 [Nitrobacter sp. Nb-311A]
          Length = 79

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+A+K
Sbjct: 7  RRPFFRRRKTCPFTGSNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAVK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|320161644|ref|YP_004174869.1| 30S ribosomal protein S18 [Anaerolinea thermophila UNI-1]
 gi|319995498|dbj|BAJ64269.1| 30S ribosomal protein S18 [Anaerolinea thermophila UNI-1]
          Length = 90

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P +RR    R K C        +IDYK + LL R++++ GKI P R +    K QRELA 
Sbjct: 12 PQMRR-YVARPKICQFCVDKNIKIDYKAVDLLRRYVTEEGKIRPRRQTGTCAKHQRELAT 70

Query: 68 AIKRARYLGLIAYV 81
          AIKRAR+L  + +V
Sbjct: 71 AIKRARHLAFLPFV 84


>gi|198284526|ref|YP_002220847.1| 30S ribosomal protein S18 [Acidithiobacillus ferrooxidans ATCC
          53993]
 gi|218666634|ref|YP_002427193.1| ribosomal protein S18 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198249047|gb|ACH84640.1| ribosomal protein S18 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218518847|gb|ACK79433.1| ribosomal protein S18 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 92

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 46/70 (65%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
           N + RRK C    +G   IDYKD++ L  ++ + GKIVPSRI+  S+  QR+L  AIKR
Sbjct: 21 SNFTRRRKFCRFRAEGVKEIDYKDLKTLQAYVGETGKIVPSRITGTSNLYQRQLTTAIKR 80

Query: 72 ARYLGLIAYV 81
          AR+L L+ YV
Sbjct: 81 ARFLALLPYV 90


>gi|153956490|ref|YP_001397255.1| 30S ribosomal protein S18 [Clostridium kluyveri DSM 555]
 gi|219856793|ref|YP_002473915.1| hypothetical protein CKR_3450 [Clostridium kluyveri NBRC 12016]
 gi|189029673|sp|A5N438|RS18_CLOK5 RecName: Full=30S ribosomal protein S18
 gi|254765422|sp|B9DXQ8|RS18_CLOK1 RecName: Full=30S ribosomal protein S18
 gi|146349348|gb|EDK35884.1| RpsR [Clostridium kluyveri DSM 555]
 gi|219570517|dbj|BAH08501.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 84

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 43/71 (60%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          +    +RK C      +  IDYKDI  L +++++RGKI+P RIS    K QREL +AIKR
Sbjct: 13 KLRRAKRKVCAFCMDKSEFIDYKDINKLRKYVTERGKILPRRISGNCAKHQRELTRAIKR 72

Query: 72 ARYLGLIAYVN 82
          AR + L+ +  
Sbjct: 73 ARNIALLPFTT 83


>gi|329913487|ref|ZP_08275956.1| SSU ribosomal protein S18p [Oxalobacteraceae bacterium IMCC9480]
 gi|327545345|gb|EGF30580.1| SSU ribosomal protein S18p [Oxalobacteraceae bacterium IMCC9480]
          Length = 96

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 46/81 (56%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          ++      +  +  R+K C  +     ++DYKD+  L  F+ + GKI+P+R++      Q
Sbjct: 13 KLKEKRKQQNPLFKRKKFCRFTAAHVEQVDYKDVDTLKDFVQENGKIMPARLTGTRAHYQ 72

Query: 63 RELAKAIKRARYLGLIAYVNL 83
          R++  AIKRAR+L L+ Y +L
Sbjct: 73 RQVDTAIKRARFLALLPYTDL 93


>gi|20809108|ref|NP_624279.1| 30S ribosomal protein S18 [Thermoanaerobacter tengcongensis MB4]
 gi|23822145|sp|Q8R6M3|RS18_THETN RecName: Full=30S ribosomal protein S18
 gi|20517786|gb|AAM25883.1| Ribosomal protein S18 [Thermoanaerobacter tengcongensis MB4]
          Length = 89

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/62 (43%), Positives = 39/62 (62%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C        RIDYKD+  L +++++RGKI+P RI+    + QR+L KAIKRAR + L+ 
Sbjct: 26 VCAFCADNIDRIDYKDVARLRKYITERGKILPRRITGNCARHQRQLTKAIKRARQIALLP 85

Query: 80 YV 81
          Y 
Sbjct: 86 YT 87


>gi|253996552|ref|YP_003048616.1| 30S ribosomal protein S18 [Methylotenera mobilis JLW8]
 gi|253983231|gb|ACT48089.1| ribosomal protein S18 [Methylotenera mobilis JLW8]
          Length = 77

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/73 (39%), Positives = 48/73 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R++  RR+ C  S +G   +DYKD+ LL  F+S+  KI+P+R++    + QR+L  A+
Sbjct: 1  MARDMYKRRRYCRFSAEGIKEVDYKDVDLLKDFISENAKIIPARMTGTKARYQRQLTSAV 60

Query: 70 KRARYLGLIAYVN 82
          KRAR+L L+ Y +
Sbjct: 61 KRARFLALLPYTD 73


>gi|269792266|ref|YP_003317170.1| 30S ribosomal protein S18 [Thermanaerovibrio acidaminovorans DSM
          6589]
 gi|269099901|gb|ACZ18888.1| ribosomal protein S18 [Thermanaerovibrio acidaminovorans DSM
          6589]
          Length = 81

 Score = 97.0 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 37/62 (59%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         +DYK+   L +++++RGKI+P R++    K QR+L +AIKRAR L L+ 
Sbjct: 18 VCHFCVDKVEAVDYKEFDKLRKYVTERGKIIPRRVTGTCAKHQRQLTRAIKRARILALLP 77

Query: 80 YV 81
          + 
Sbjct: 78 FT 79


>gi|238757533|ref|ZP_04618718.1| 30S ribosomal protein S18 [Yersinia aldovae ATCC 35236]
 gi|238764708|ref|ZP_04625652.1| 30S ribosomal protein S18 [Yersinia kristensenii ATCC 33638]
 gi|300715053|ref|YP_003739856.1| 30S ribosomal protein S18 [Erwinia billingiae Eb661]
 gi|238697104|gb|EEP89877.1| 30S ribosomal protein S18 [Yersinia kristensenii ATCC 33638]
 gi|238704295|gb|EEP96827.1| 30S ribosomal protein S18 [Yersinia aldovae ATCC 35236]
 gi|299060889|emb|CAX57996.1| 30S ribosomal protein S18 [Erwinia billingiae Eb661]
          Length = 75

 Score = 97.0 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+ IKRA
Sbjct: 3  RYFRRRKFCRFTAEGVVEIDYKDIATLKNYVTESGKIVPSRITGTRAKYQRQLARCIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|167773044|ref|ZP_02445097.1| hypothetical protein ANACOL_04433 [Anaerotruncus colihominis DSM
          17241]
 gi|167664977|gb|EDS09107.1| hypothetical protein ANACOL_04433 [Anaerotruncus colihominis DSM
          17241]
          Length = 86

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 45/72 (62%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          R N   R+K C         IDYKD+  L R+LS+R KIVP R++    + QR+L  AIK
Sbjct: 14 RGNRKGRKKVCAFCVDKLGPIDYKDVPRLRRYLSERAKIVPRRVTGTCARHQRQLTLAIK 73

Query: 71 RARYLGLIAYVN 82
          RAR++GL+ Y++
Sbjct: 74 RARHIGLLPYIS 85


>gi|303257677|ref|ZP_07343689.1| ribosomal protein S18 [Burkholderiales bacterium 1_1_47]
 gi|331000769|ref|ZP_08324418.1| ribosomal protein S18 [Parasutterella excrementihominis YIT
          11859]
 gi|302859647|gb|EFL82726.1| ribosomal protein S18 [Burkholderiales bacterium 1_1_47]
 gi|329570501|gb|EGG52226.1| ribosomal protein S18 [Parasutterella excrementihominis YIT
          11859]
          Length = 90

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 45/77 (58%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
            P  +  +  R+K C  +     +IDYKDI  L  F+ + GKI+P+R++      QR+L
Sbjct: 12 RNPNQQNALFKRKKFCRFTVDHVDQIDYKDIDTLRDFIQENGKIMPARLTGTKAHYQRQL 71

Query: 66 AKAIKRARYLGLIAYVN 82
            AIKRAR+L L+AY +
Sbjct: 72 DTAIKRARFLALLAYTD 88


>gi|139439449|ref|ZP_01772890.1| Hypothetical protein COLAER_01910 [Collinsella aerofaciens ATCC
          25986]
 gi|133775228|gb|EBA39048.1| Hypothetical protein COLAER_01910 [Collinsella aerofaciens ATCC
          25986]
          Length = 88

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 40/68 (58%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             RRK C    +    IDYKD +LL ++++ RGKI P R++    + Q ++A AIKRAR
Sbjct: 8  RQPRRKYCQFCKENTEFIDYKDTQLLRKYMTDRGKIKPRRVTGACTQHQHDIANAIKRAR 67

Query: 74 YLGLIAYV 81
           + L+ Y 
Sbjct: 68 EMALLPYT 75


>gi|194396735|ref|YP_002038171.1| 30S ribosomal protein S18 [Streptococcus pneumoniae G54]
 gi|229560070|sp|B5E6A4|RS18_STRP4 RecName: Full=30S ribosomal protein S18
 gi|194356402|gb|ACF54850.1| ribosomal protein S18 [Streptococcus pneumoniae G54]
          Length = 79

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 46/74 (62%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
            R     R+K   ++      +DYKD  LL+RF+S+RGKI+P R++  S K QR++  A
Sbjct: 4  QRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTXA 63

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ +VN
Sbjct: 64 IKRARVMALMPFVN 77


>gi|189485365|ref|YP_001956306.1| 30S ribosomal protein S18 [uncultured Termite group 1 bacterium
          phylotype Rs-D17]
 gi|205618780|sp|B1H013|RS18_UNCTG RecName: Full=30S ribosomal protein S18
 gi|170287324|dbj|BAG13845.1| 30S ribosomal protein S18 [uncultured Termite group 1 bacterium
          phylotype Rs-D17]
          Length = 100

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P    RRN   R+K C         IDYK++ LL+ F++++GKI+  R++    K QREL
Sbjct: 24 PAGKFRRNGPIRKKVCRFCADKVE-IDYKNLSLLHTFVTEKGKILSGRMTGTCAKHQREL 82

Query: 66 AKAIKRARYLGLIAYV 81
            AIKRAR + L+ + 
Sbjct: 83 DTAIKRARMIALLPFT 98


>gi|209559923|ref|YP_002286395.1| 30S ribosomal protein S18 [Streptococcus pyogenes NZ131]
 gi|238058158|sp|B5XI38|RS18_STRPZ RecName: Full=30S ribosomal protein S18
 gi|209541124|gb|ACI61700.1| SSU ribosomal protein S18p [Streptococcus pyogenes NZ131]
          Length = 79

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 45/74 (60%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
            R     R+K   ++      +DYKD  LL+RF+S+RGKI+P R+   S K QR++  A
Sbjct: 4  QRRGGFKRRKKVDFIAANKIEYVDYKDTELLSRFVSERGKILPRRVPGTSAKNQRKVTTA 63

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ YVN
Sbjct: 64 IKRARVMALMPYVN 77


>gi|309776775|ref|ZP_07671749.1| ribosomal protein S18 [Erysipelotrichaceae bacterium 3_1_53]
 gi|308915523|gb|EFP61289.1| ribosomal protein S18 [Erysipelotrichaceae bacterium 3_1_53]
          Length = 76

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 44/73 (60%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++    R+K C  +      IDYKD+ LL RF+S  GKI+P R++    K QR LA AI
Sbjct: 3  FKKQRMGRKKVCYFTKNKIESIDYKDVELLKRFISANGKIIPRRVTGTRAKYQRMLATAI 62

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ YV+
Sbjct: 63 KRARQMALLPYVS 75


>gi|260437868|ref|ZP_05791684.1| ribosomal protein S18 [Butyrivibrio crossotus DSM 2876]
 gi|292809894|gb|EFF69099.1| ribosomal protein S18 [Butyrivibrio crossotus DSM 2876]
          Length = 88

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 42/75 (56%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
           P+ +R    R+K C         IDYKD   L RF+S+RGKI+P RI+    K QR L 
Sbjct: 12 APMKKRINRRRKKVCVFCADSTNVIDYKDANKLKRFVSERGKILPRRITGTCAKHQRALT 71

Query: 67 KAIKRARYLGLIAYV 81
           A+KRAR + ++ Y 
Sbjct: 72 VAVKRARQIAILPYT 86


>gi|326389001|ref|ZP_08210583.1| 30S ribosomal protein S18 [Novosphingobium nitrogenifigens DSM
          19370]
 gi|326206601|gb|EGD57436.1| 30S ribosomal protein S18 [Novosphingobium nitrogenifigens DSM
          19370]
          Length = 74

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 61/72 (84%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP SGK AP+IDYKD+RLL  F+S+RGKIVPSRI++VS KKQREL++AI
Sbjct: 1  MARPFFRRRKSCPFSGKNAPKIDYKDVRLLQGFMSERGKIVPSRITAVSAKKQRELSQAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR+LGL+ Y+
Sbjct: 61 KRARHLGLLPYI 72


>gi|160892971|ref|ZP_02073759.1| hypothetical protein CLOL250_00508 [Clostridium sp. L2-50]
 gi|156865054|gb|EDO58485.1| hypothetical protein CLOL250_00508 [Clostridium sp. L2-50]
          Length = 87

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/80 (42%), Positives = 47/80 (58%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
           + A  P+ RRN+  R+K C         IDYKD   L R++S+RGKI+P RI+    K 
Sbjct: 6  TDRADAPMKRRNIRRRKKVCVFCADKTAVIDYKDANKLKRYISERGKILPRRITGNCAKH 65

Query: 62 QRELAKAIKRARYLGLIAYV 81
          QR L  A+KRAR + ++ YV
Sbjct: 66 QRALTVAVKRARQIAILPYV 85


>gi|149184753|ref|ZP_01863071.1| 30S ribosomal protein S18 [Erythrobacter sp. SD-21]
 gi|148832073|gb|EDL50506.1| 30S ribosomal protein S18 [Erythrobacter sp. SD-21]
          Length = 74

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 48/72 (66%), Positives = 59/72 (81%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK+CP S K AP IDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELAKAI
Sbjct: 1  MARPFFRRRKTCPFSAKNAPAIDYKDVRLLQGFMSERGKIVPSRITAVSAKKQRELAKAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ Y+
Sbjct: 61 KRARHIGLLPYI 72


>gi|293604275|ref|ZP_06686682.1| 30S ribosomal protein S18 [Achromobacter piechaudii ATCC 43553]
 gi|311105035|ref|YP_003977888.1| 30S ribosomal protein S18 [Achromobacter xylosoxidans A8]
 gi|292817152|gb|EFF76226.1| 30S ribosomal protein S18 [Achromobacter piechaudii ATCC 43553]
 gi|310759724|gb|ADP15173.1| ribosomal protein S18 [Achromobacter xylosoxidans A8]
 gi|317402865|gb|EFV83407.1| 30S ribosomal protein S18 [Achromobacter xylosoxidans C54]
          Length = 90

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 43/72 (59%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +  +  RRK C  +  G   IDYKD+  L  F+ + GKI+P+R++      QR+L  AIK
Sbjct: 16 QNPLFKRRKFCRFTAAGVEEIDYKDLDTLRDFVQENGKIIPARLTGTKAIYQRQLDTAIK 75

Query: 71 RARYLGLIAYVN 82
          RAR+L L+ Y +
Sbjct: 76 RARFLALLPYTD 87


>gi|295108217|emb|CBL22170.1| SSU ribosomal protein S18P [Ruminococcus obeum A2-162]
          Length = 87

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 49/79 (62%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          E   +P+ RR    R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K Q
Sbjct: 7  ERPDSPMKRRGGRRRKKVCVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQ 66

Query: 63 RELAKAIKRARYLGLIAYV 81
          R L  A+KRAR+L L+ YV
Sbjct: 67 RALTVAVKRARHLSLMPYV 85


>gi|241895860|ref|ZP_04783156.1| 30S ribosomal protein S18 [Weissella paramesenteroides ATCC
          33313]
 gi|241870903|gb|EER74654.1| 30S ribosomal protein S18 [Weissella paramesenteroides ATCC
          33313]
          Length = 80

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 42/63 (66%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      +DYKD  LL RF+S+RGKI+P R++  S K QR++  AIKRAR +GL+
Sbjct: 15 KVDFIAANHIEYVDYKDTELLERFISERGKILPRRVTGTSAKNQRKVTTAIKRARIMGLL 74

Query: 79 AYV 81
           +V
Sbjct: 75 PFV 77


>gi|156741510|ref|YP_001431639.1| 30S ribosomal protein S18 [Roseiflexus castenholzii DSM 13941]
 gi|205556478|sp|A7NJF1|RS181_ROSCS RecName: Full=30S ribosomal protein S18 1
 gi|156232838|gb|ABU57621.1| ribosomal protein S18 [Roseiflexus castenholzii DSM 13941]
          Length = 90

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/68 (42%), Positives = 41/68 (60%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             RRK C         +DYKD++ L R +S+RGKI+P R + V  + QR L  AIKRAR
Sbjct: 17 FGARRKVCAFCADKIRVVDYKDVKRLQRCMSERGKILPRRRTGVCARHQRSLTVAIKRAR 76

Query: 74 YLGLIAYV 81
          ++ L+ +V
Sbjct: 77 HMALLPFV 84


>gi|328956391|ref|YP_004373777.1| 30S ribosomal protein S18 [Carnobacterium sp. 17-4]
 gi|328672715|gb|AEB28761.1| 30S ribosomal protein S18 [Carnobacterium sp. 17-4]
          Length = 79

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 46/72 (63%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK    +      +DYKDI LL RF+S+RG+I+P R++    K QR+L KAIK
Sbjct: 5  RRGGKKRRKVDFFAANHIEHVDYKDIDLLKRFISERGRILPRRVTGTYAKNQRKLTKAIK 64

Query: 71 RARYLGLIAYVN 82
          RAR +GL+ +V 
Sbjct: 65 RARIMGLLPFVT 76


>gi|167760811|ref|ZP_02432938.1| hypothetical protein CLOSCI_03196 [Clostridium scindens ATCC
          35704]
 gi|167661698|gb|EDS05828.1| hypothetical protein CLOSCI_03196 [Clostridium scindens ATCC
          35704]
          Length = 88

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 40/62 (64%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AIKRAR++ L+ 
Sbjct: 25 VCVFCGKENNEIDYKDVAKLRKYISERGKILPRRITGNCAKHQRALTVAIKRARHVALMP 84

Query: 80 YV 81
          YV
Sbjct: 85 YV 86


>gi|212550375|ref|YP_002308692.1| 30S ribosomal protein S18 [Candidatus Azobacteroides
          pseudotrichonymphae genomovar. CFP2]
 gi|212548613|dbj|BAG83281.1| 30S ribosomal protein S18 [Candidatus Azobacteroides
          pseudotrichonymphae genomovar. CFP2]
          Length = 92

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 44/68 (64%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
           +R+K C     G   IDYKD   L +FL+++GKI+P RI+  S K Q  +A+A+KRAR+
Sbjct: 21 KNRKKYCRFKKNGIKFIDYKDPEFLKKFLNEQGKILPRRITGTSAKFQHRVAQAVKRARH 80

Query: 75 LGLIAYVN 82
          L L+ YV 
Sbjct: 81 LALLPYVT 88


>gi|313674400|ref|YP_004052396.1| SSU ribosomal protein s18p [Marivirga tractuosa DSM 4126]
 gi|312941098|gb|ADR20288.1| SSU ribosomal protein S18P [Marivirga tractuosa DSM 4126]
          Length = 85

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/75 (38%), Positives = 51/75 (68%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P+ ++   +++K C     G   IDYKD   L +F++++GK++PSRI+  S K Q+++A+
Sbjct: 7  PINQKKQDNQKKYCRFKRYGIKYIDYKDPNFLLKFVNEQGKLLPSRITGTSAKYQKKVAQ 66

Query: 68 AIKRARYLGLIAYVN 82
          A+KRAR++ L+ YV 
Sbjct: 67 AVKRARHIALLPYVT 81


>gi|218291071|ref|ZP_03495094.1| ribosomal protein S18 [Alicyclobacillus acidocaldarius LAA1]
 gi|218238956|gb|EED06163.1| ribosomal protein S18 [Alicyclobacillus acidocaldarius LAA1]
          Length = 136

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C          DYKD+  L++FL++RGKI+P RI+    + QR++  AIKRAR + L+ 
Sbjct: 13 VCQYCVDKIDYADYKDVARLSKFLTERGKILPRRITGNCARHQRQVTVAIKRARQVALLP 72

Query: 80 YV 81
          Y 
Sbjct: 73 YT 74


>gi|163868014|ref|YP_001609218.1| 30S ribosomal protein S18 [Bartonella tribocorum CIP 105476]
 gi|189029667|sp|A9IRU1|RS18_BART1 RecName: Full=30S ribosomal protein S18
 gi|161017665|emb|CAK01223.1| 30S ribosomal protein S18 [Bartonella tribocorum CIP 105476]
          Length = 82

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKDI+LL R++S+RGKIVPSRI++VS KKQRELA AIK
Sbjct: 10 RRPFHRRRKTCPFSGATAPKIDYKDIKLLQRYISERGKIVPSRITAVSQKKQRELANAIK 69

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 70 RARFLGLLPYV 80


>gi|332639079|ref|ZP_08417942.1| 30S ribosomal protein S18 [Weissella cibaria KACC 11862]
          Length = 80

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 42/63 (66%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      +DYKD  LL RF+S+RGKI+P R++  S K QR++  AIKRAR +GL+
Sbjct: 15 KVDFIAANHIEYVDYKDTELLERFISERGKILPRRVTGTSAKNQRKVTTAIKRARVMGLL 74

Query: 79 AYV 81
           +V
Sbjct: 75 PFV 77


>gi|294011582|ref|YP_003545042.1| ribosomal protein S18 [Sphingobium japonicum UT26S]
 gi|307294384|ref|ZP_07574228.1| ribosomal protein S18 [Sphingobium chlorophenolicum L-1]
 gi|292674912|dbj|BAI96430.1| ribosomal protein S18 [Sphingobium japonicum UT26S]
 gi|306880535|gb|EFN11752.1| ribosomal protein S18 [Sphingobium chlorophenolicum L-1]
          Length = 74

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 48/72 (66%), Positives = 60/72 (83%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP + K AP+IDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELA+AI
Sbjct: 1  MARPFFRRRKSCPFAAKDAPKIDYKDVRLLQGFVSERGKIVPSRITAVSAKKQRELAQAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR+LGL+ Y+
Sbjct: 61 KRARHLGLLPYI 72


>gi|42518093|ref|NP_964023.1| 30S ribosomal protein S18 [Lactobacillus johnsonii NCC 533]
 gi|227889149|ref|ZP_04006954.1| 30S ribosomal protein S18 [Lactobacillus johnsonii ATCC 33200]
 gi|238853347|ref|ZP_04643727.1| ribosomal protein S18 [Lactobacillus gasseri 202-4]
 gi|268318570|ref|YP_003292226.1| ribosomal protein S18 [Lactobacillus johnsonii FI9785]
 gi|282852324|ref|ZP_06261666.1| ribosomal protein S18 [Lactobacillus gasseri 224-1]
 gi|300362670|ref|ZP_07058846.1| 30S ribosomal protein S18 [Lactobacillus gasseri JV-V03]
 gi|59798807|sp|Q74M26|RS18_LACJO RecName: Full=30S ribosomal protein S18
 gi|41582377|gb|AAS07989.1| 30S ribosomal protein S19 [Lactobacillus johnsonii NCC 533]
 gi|227850378|gb|EEJ60464.1| 30S ribosomal protein S18 [Lactobacillus johnsonii ATCC 33200]
 gi|238834035|gb|EEQ26292.1| ribosomal protein S18 [Lactobacillus gasseri 202-4]
 gi|262396945|emb|CAX65959.1| ribosomal protein S18 [Lactobacillus johnsonii FI9785]
 gi|282556066|gb|EFB61686.1| ribosomal protein S18 [Lactobacillus gasseri 224-1]
 gi|300353661|gb|EFJ69533.1| 30S ribosomal protein S18 [Lactobacillus gasseri JV-V03]
 gi|329666400|gb|AEB92348.1| 30S ribosomal protein S19 [Lactobacillus johnsonii DPC 6026]
          Length = 78

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 43/63 (68%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+
Sbjct: 13 KVDFIAANHIDYIDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKLTVAIKRARVMGLL 72

Query: 79 AYV 81
           +V
Sbjct: 73 PFV 75


>gi|238783557|ref|ZP_04627579.1| 30S ribosomal protein S18 [Yersinia bercovieri ATCC 43970]
 gi|238715612|gb|EEQ07602.1| 30S ribosomal protein S18 [Yersinia bercovieri ATCC 43970]
          Length = 75

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+ IKRA
Sbjct: 3  RYFRRRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRITGTRAKFQRQLARCIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|116628692|ref|YP_813864.1| ribosomal protein S18 [Lactobacillus gasseri ATCC 33323]
 gi|311111569|ref|ZP_07712966.1| ribosomal protein S18 [Lactobacillus gasseri MV-22]
 gi|122274310|sp|Q047E6|RS18_LACGA RecName: Full=30S ribosomal protein S18
 gi|116094274|gb|ABJ59426.1| SSU ribosomal protein S18P [Lactobacillus gasseri ATCC 33323]
 gi|311066723|gb|EFQ47063.1| ribosomal protein S18 [Lactobacillus gasseri MV-22]
          Length = 77

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 43/63 (68%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+
Sbjct: 12 KVDFIAANHIDYIDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKLTVAIKRARVMGLL 71

Query: 79 AYV 81
           +V
Sbjct: 72 PFV 74


>gi|225574408|ref|ZP_03783018.1| hypothetical protein RUMHYD_02477 [Blautia hydrogenotrophica DSM
          10507]
 gi|225038376|gb|EEG48622.1| hypothetical protein RUMHYD_02477 [Blautia hydrogenotrophica DSM
          10507]
          Length = 87

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/79 (45%), Positives = 49/79 (62%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          E   +P+ RR    R+K C   GK    IDYKD+  L R++S+RGKI+P RI+    K Q
Sbjct: 7  ERPDSPMKRRGGRRRKKVCVFCGKENNEIDYKDVAKLKRYVSERGKILPRRITGNCAKHQ 66

Query: 63 RELAKAIKRARYLGLIAYV 81
          R L  AIKRAR++ ++ YV
Sbjct: 67 RALTVAIKRARHMAMMPYV 85


>gi|91783365|ref|YP_558571.1| 30S ribosomal protein S18 [Burkholderia xenovorans LB400]
 gi|296157726|ref|ZP_06840560.1| ribosomal protein S18 [Burkholderia sp. Ch1-1]
 gi|123168536|sp|Q13ZH0|RS18_BURXL RecName: Full=30S ribosomal protein S18
 gi|91687319|gb|ABE30519.1| SSU ribosomal protein S18P [Burkholderia xenovorans LB400]
 gi|295891972|gb|EFG71756.1| ribosomal protein S18 [Burkholderia sp. Ch1-1]
          Length = 91

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +       +  +  R+K C  +  G   IDYKD+  L  F+ + GKI P+R++      Q
Sbjct: 8  KFDKRRQQQNPLFKRKKFCRFTAAGVDHIDYKDLETLKDFIGENGKITPARLTGTKSHYQ 67

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 68 RQLDTAIKRARFLALVPYTD 87


>gi|320528729|ref|ZP_08029881.1| ribosomal protein S18 [Solobacterium moorei F0204]
 gi|320130939|gb|EFW23517.1| ribosomal protein S18 [Solobacterium moorei F0204]
          Length = 76

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/72 (45%), Positives = 42/72 (58%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R+    RRK C  +      IDYKD+ LL +F+S  GKI P R++    K QR LA AI
Sbjct: 3  FRKQRMGRRKVCYFTKNNITYIDYKDVELLKKFVSANGKITPRRVTGTRAKYQRMLAIAI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 63 KRARQMALLPYV 74


>gi|311070629|ref|YP_003975552.1| 30S ribosomal protein S18 [Bacillus atrophaeus 1942]
 gi|310871146|gb|ADP34621.1| 30S ribosomal protein S18 [Bacillus atrophaeus 1942]
          Length = 79

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 41/63 (65%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +  G   IDYKD+ LL +F+S+RGKI+P R++  + K QR+L  AIK +R + L+ 
Sbjct: 15 VCYFTSNGITHIDYKDVDLLRKFVSERGKILPRRVTGTNAKYQRKLTAAIKLSRQMALLP 74

Query: 80 YVN 82
          YV 
Sbjct: 75 YVT 77


>gi|159901475|ref|YP_001547722.1| 30S ribosomal protein S18 [Herpetosiphon aurantiacus ATCC 23779]
 gi|205558504|sp|A9B461|RS18_HERA2 RecName: Full=30S ribosomal protein S18
 gi|159894514|gb|ABX07594.1| ribosomal protein S18 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 86

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/82 (42%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M++       RR  + RRK C  + +G    DYKDI+ L R +S RGKI+P R +    K
Sbjct: 1  MSDQRRKSAGRRKYTPRRKVCVFTAEGIVP-DYKDIKRLQRMVSDRGKILPRRRTGTCAK 59

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
           QR+L  AIKRAR+L L+ +V+
Sbjct: 60 YQRKLNVAIKRARHLALLPFVS 81


>gi|329116032|ref|ZP_08244749.1| ribosomal protein S18 [Streptococcus parauberis NCFD 2020]
 gi|326906437|gb|EGE53351.1| ribosomal protein S18 [Streptococcus parauberis NCFD 2020]
          Length = 79

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 45/74 (60%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
            R     R+K   ++      +DYKD  LL RF+S+RGKI+P R++  S K QR++  A
Sbjct: 4  QRRGGFKRRKKVDFIAANKIEYVDYKDTELLGRFVSERGKILPRRVTGTSAKNQRKVTAA 63

Query: 69 IKRARYLGLIAYVN 82
          IKRAR + L+ YVN
Sbjct: 64 IKRARVMALMPYVN 77


>gi|296134460|ref|YP_003641707.1| ribosomal protein S18 [Thermincola sp. JR]
 gi|296033038|gb|ADG83806.1| ribosomal protein S18 [Thermincola potens JR]
          Length = 76

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/62 (41%), Positives = 37/62 (59%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYKD   L +++++RGKI+P RIS    K QR+L  AIKRAR++ L+ 
Sbjct: 13 VCSFCVDKVEAIDYKDSAKLRKYITERGKILPRRISGNCAKHQRQLTTAIKRARHMALLP 72

Query: 80 YV 81
          + 
Sbjct: 73 FT 74


>gi|29654192|ref|NP_819884.1| 30S ribosomal protein S18 [Coxiella burnetii RSA 493]
 gi|153209209|ref|ZP_01947275.1| ribosomal protein S18 [Coxiella burnetii 'MSU Goat Q177']
 gi|154705894|ref|YP_001424310.1| 30S ribosomal protein S18 [Coxiella burnetii Dugway 5J108-111]
 gi|161829761|ref|YP_001596842.1| 30S ribosomal protein S18 [Coxiella burnetii RSA 331]
 gi|165918540|ref|ZP_02218626.1| ribosomal protein S18 [Coxiella burnetii RSA 334]
 gi|212212682|ref|YP_002303618.1| 30S ribosomal protein S18 [Coxiella burnetii CbuG_Q212]
 gi|212218345|ref|YP_002305132.1| 30S ribosomal protein S18 [Coxiella burnetii CbuK_Q154]
 gi|59798886|sp|Q83D75|RS18_COXBU RecName: Full=30S ribosomal protein S18
 gi|189029674|sp|A9KFL6|RS18_COXBN RecName: Full=30S ribosomal protein S18
 gi|189029675|sp|A9ND52|RS18_COXBR RecName: Full=30S ribosomal protein S18
 gi|29541458|gb|AAO90398.1| SSU ribosomal protein S18P [Coxiella burnetii RSA 493]
 gi|120575464|gb|EAX32088.1| ribosomal protein S18 [Coxiella burnetii 'MSU Goat Q177']
 gi|154355180|gb|ABS76642.1| SSU ribosomal protein S18P [Coxiella burnetii Dugway 5J108-111]
 gi|161761628|gb|ABX77270.1| ribosomal protein S18 [Coxiella burnetii RSA 331]
 gi|165917786|gb|EDR36390.1| ribosomal protein S18 [Coxiella burnetii RSA 334]
 gi|212011092|gb|ACJ18473.1| SSU ribosomal protein S18P [Coxiella burnetii CbuG_Q212]
 gi|212012607|gb|ACJ19987.1| SSU ribosomal protein S18P [Coxiella burnetii CbuK_Q154]
          Length = 73

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 42/68 (61%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            R+K C    K    IDYKD+  L  ++ + G++VPSRI+    K QR++++AIK ARY
Sbjct: 3  FRRKKFCAFDAKNLQEIDYKDVNTLKDYIMESGRVVPSRITGTCAKHQRQISRAIKLARY 62

Query: 75 LGLIAYVN 82
          L L+ Y +
Sbjct: 63 LALLPYCD 70


>gi|291521978|emb|CBK80271.1| SSU ribosomal protein S18P [Coprococcus catus GD/7]
          Length = 87

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 38/63 (60%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYKD   L R++S+RGKI+P RI+    K QR+L  AIKRAR++ L+ 
Sbjct: 24 VCVYCVDKNAVIDYKDTNKLKRYISERGKILPRRITGNCAKHQRKLTTAIKRARHIALMP 83

Query: 80 YVN 82
          Y+ 
Sbjct: 84 YIT 86


>gi|257783834|ref|YP_003179051.1| 30S ribosomal protein S18 [Atopobium parvulum DSM 20469]
 gi|257472341|gb|ACV50460.1| ribosomal protein S18 [Atopobium parvulum DSM 20469]
          Length = 90

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 40/68 (58%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             RRK C    +    IDYKD +LL ++++ RGKI P R++    + Q ++A AIKRAR
Sbjct: 10 RQPRRKYCQFCKEETEFIDYKDTQLLRKYMTDRGKIKPRRVTGTCTQHQHDIALAIKRAR 69

Query: 74 YLGLIAYV 81
           + L+ Y 
Sbjct: 70 EMALLPYT 77


>gi|49475325|ref|YP_033366.1| 30S ribosomal protein S18 [Bartonella henselae str. Houston-1]
 gi|59798706|sp|Q6G447|RS18_BARHE RecName: Full=30S ribosomal protein S18
 gi|49238131|emb|CAF27339.1| 30S ribosomal protein s18 [Bartonella henselae str. Houston-1]
          Length = 82

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKDI+LL R++S+RGKIVPSRI+++S KKQRELA AIK
Sbjct: 10 RRPFHRRRKTCPFSGTNAPKIDYKDIKLLQRYISERGKIVPSRITAISQKKQRELANAIK 69

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 70 RARFLGLLPYV 80


>gi|238020010|ref|ZP_04600436.1| hypothetical protein VEIDISOL_01886 [Veillonella dispar ATCC
          17748]
 gi|269797402|ref|YP_003311302.1| ribosomal protein S18 [Veillonella parvula DSM 2008]
 gi|282849200|ref|ZP_06258585.1| ribosomal protein S18 [Veillonella parvula ATCC 17745]
 gi|294793012|ref|ZP_06758158.1| ribosomal protein S18 [Veillonella sp. 6_1_27]
 gi|294794948|ref|ZP_06760083.1| ribosomal protein S18 [Veillonella sp. 3_1_44]
 gi|303228727|ref|ZP_07315547.1| ribosomal protein S18 [Veillonella atypica ACS-134-V-Col7a]
 gi|303231551|ref|ZP_07318280.1| ribosomal protein S18 [Veillonella atypica ACS-049-V-Sch6]
 gi|313893864|ref|ZP_07827430.1| ribosomal protein S18 [Veillonella sp. oral taxon 158 str. F0412]
 gi|237863534|gb|EEP64824.1| hypothetical protein VEIDISOL_01886 [Veillonella dispar ATCC
          17748]
 gi|269094031|gb|ACZ24022.1| ribosomal protein S18 [Veillonella parvula DSM 2008]
 gi|282580904|gb|EFB86302.1| ribosomal protein S18 [Veillonella parvula ATCC 17745]
 gi|294454310|gb|EFG22684.1| ribosomal protein S18 [Veillonella sp. 3_1_44]
 gi|294455957|gb|EFG24321.1| ribosomal protein S18 [Veillonella sp. 6_1_27]
 gi|302513797|gb|EFL55810.1| ribosomal protein S18 [Veillonella atypica ACS-049-V-Sch6]
 gi|302516601|gb|EFL58523.1| ribosomal protein S18 [Veillonella atypica ACS-134-V-Col7a]
 gi|313441428|gb|EFR59854.1| ribosomal protein S18 [Veillonella sp. oral taxon 158 str. F0412]
          Length = 76

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 38/63 (60%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C        +IDYKD+  L RF ++RGKI+P RIS    K QR+L  +IKRAR + L+
Sbjct: 12 KVCVFCADHIDQIDYKDVAKLRRFTTERGKILPRRISGTCAKHQRKLTTSIKRARAIALL 71

Query: 79 AYV 81
           + 
Sbjct: 72 PFT 74


>gi|161899036|ref|YP_077144.2| 30S ribosomal protein S18 [Symbiobacterium thermophilum IAM
          14863]
 gi|205620330|sp|Q67J50|RS18_SYMTH RecName: Full=30S ribosomal protein S18
          Length = 76

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 36/62 (58%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         +DYKD   L R++++RGKI+P RIS    + QR+L  AIKRAR + L+ 
Sbjct: 13 VCSFCVDKIEHVDYKDAARLKRYITERGKILPRRISGNCARHQRQLTVAIKRARIMALLP 72

Query: 80 YV 81
          + 
Sbjct: 73 FT 74


>gi|325955201|ref|YP_004238861.1| 30S ribosomal protein S18 [Weeksella virosa DSM 16922]
 gi|323437819|gb|ADX68283.1| 30S ribosomal protein S18 [Weeksella virosa DSM 16922]
          Length = 100

 Score = 96.2 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 43/64 (67%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C     G   +DYKD   L +F++++GKI+P R +  S K QR++++AIKRAR+L L
Sbjct: 32 KKYCRFRKYGIKYVDYKDADFLLQFVNEQGKILPRRYTGTSLKYQRKVSRAIKRARHLAL 91

Query: 78 IAYV 81
          + +V
Sbjct: 92 LPFV 95


>gi|220927516|ref|YP_002504425.1| 30S ribosomal protein S18 [Clostridium cellulolyticum H10]
 gi|326202835|ref|ZP_08192702.1| ribosomal protein S18 [Clostridium papyrosolvens DSM 2782]
 gi|219997844|gb|ACL74445.1| ribosomal protein S18 [Clostridium cellulolyticum H10]
 gi|325986912|gb|EGD47741.1| ribosomal protein S18 [Clostridium papyrosolvens DSM 2782]
          Length = 97

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 43/70 (61%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    ++K C      A  IDYKD+  + +++S+RGKI+P RIS    K QR+L  A+KR
Sbjct: 26 RMRRVKKKVCSFCVDKATDIDYKDVAKIRKYVSERGKILPRRISGNCAKHQRQLTVAVKR 85

Query: 72 ARYLGLIAYV 81
          AR++ L+ Y 
Sbjct: 86 ARHIALLPYT 95


>gi|282600706|ref|ZP_05979550.2| 30S ribosomal protein S18 [Subdoligranulum variabile DSM 15176]
 gi|282571488|gb|EFB77023.1| 30S ribosomal protein S18 [Subdoligranulum variabile DSM 15176]
          Length = 100

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 4/81 (4%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
           + +  P+ R     R+K C         IDYKD+  L +++S+R KI+P R++      
Sbjct: 23 MDRSSRPMHRG----RKKVCSFCVDRVEHIDYKDLPRLRKYVSERAKIIPRRVTGTCAFH 78

Query: 62 QRELAKAIKRARYLGLIAYVN 82
          QREL  AIKRARY+ L+ YV+
Sbjct: 79 QRELTVAIKRARYMALMPYVS 99


>gi|138897054|ref|YP_001127507.1| 30S ribosomal protein S18 [Geobacillus thermodenitrificans
          NG80-2]
 gi|134268567|gb|ABO68762.1| Ribosomal protein S18 [Geobacillus thermodenitrificans NG80-2]
          Length = 91

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIKRAR + L+ 
Sbjct: 27 VCYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTVAIKRARQMALLP 86

Query: 80 YV 81
          YV
Sbjct: 87 YV 88


>gi|311746134|ref|ZP_07719919.1| ribosomal protein S18 [Algoriphagus sp. PR1]
 gi|126576355|gb|EAZ80633.1| ribosomal protein S18 [Algoriphagus sp. PR1]
          Length = 83

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 45/71 (63%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
              +R+K C     G   IDYKD   L +F++++GKI+P R++  S K Q+++A AIK+
Sbjct: 9  NRGENRKKYCRFKKHGIKYIDYKDPNFLLKFVNEQGKILPRRLTGNSAKYQKKVANAIKK 68

Query: 72 ARYLGLIAYVN 82
          AR+L L+ +V 
Sbjct: 69 ARHLALLPFVT 79


>gi|158425931|ref|YP_001527223.1| 30S ribosomal protein S18 [Azorhizobium caulinodans ORS 571]
 gi|205556908|sp|A8HVE8|RS18_AZOC5 RecName: Full=30S ribosomal protein S18
 gi|158332820|dbj|BAF90305.1| ribosomal protein S18 [Azorhizobium caulinodans ORS 571]
          Length = 85

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/69 (66%), Positives = 58/69 (84%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS KKQREL+ AIKRA
Sbjct: 15 PFFRRRKTCPFSGPNAPKIDYKDVRLLQRYISERGKIVPSRITAVSAKKQRELSAAIKRA 74

Query: 73 RYLGLIAYV 81
          R+LGL+ +V
Sbjct: 75 RFLGLLPFV 83


>gi|332983146|ref|YP_004464587.1| 30S ribosomal protein S18P [Mahella australiensis 50-1 BON]
 gi|332700824|gb|AEE97765.1| SSU ribosomal protein S18P [Mahella australiensis 50-1 BON]
          Length = 85

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 41/65 (63%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C      A +IDYKDI  L +++++RGKI+P RI+    K QR+L  AIKRAR + L
Sbjct: 20 KKVCAFCADKAYQIDYKDINRLKKYVTERGKIIPRRITGNCAKHQRQLTIAIKRARAIAL 79

Query: 78 IAYVN 82
          + Y  
Sbjct: 80 LPYTT 84


>gi|90960999|ref|YP_534915.1| 30S ribosomal protein S18 [Lactobacillus salivarius UCC118]
 gi|227891677|ref|ZP_04009482.1| 30S ribosomal protein S18 [Lactobacillus salivarius ATCC 11741]
 gi|301300480|ref|ZP_07206679.1| ribosomal protein S18 [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|123270037|sp|Q1WVN7|RS18_LACS1 RecName: Full=30S ribosomal protein S18
 gi|90820193|gb|ABD98832.1| SSU ribosomal protein S18P [Lactobacillus salivarius UCC118]
 gi|227866480|gb|EEJ73901.1| 30S ribosomal protein S18 [Lactobacillus salivarius ATCC 11741]
 gi|300851927|gb|EFK79612.1| ribosomal protein S18 [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 78

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 42/63 (66%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYKD  LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+
Sbjct: 13 KVDYIAANHIEYIDYKDTDLLRRFISERGKILPRRVTGTSAKNQRKLTVAIKRARIMGLL 72

Query: 79 AYV 81
           +V
Sbjct: 73 PFV 75


>gi|116493585|ref|YP_805319.1| 30S ribosomal protein S18 [Lactobacillus casei ATCC 334]
 gi|191636835|ref|YP_001986001.1| 30S ribosomal protein S18 [Lactobacillus casei BL23]
 gi|199598219|ref|ZP_03211640.1| Ribosomal protein S18 [Lactobacillus rhamnosus HN001]
 gi|227533495|ref|ZP_03963544.1| ribosomal protein S18 [Lactobacillus paracasei subsp. paracasei
          ATCC 25302]
 gi|229551090|ref|ZP_04439815.1| ribosomal protein S18 [Lactobacillus rhamnosus LMS2-1]
 gi|239630816|ref|ZP_04673847.1| SSU ribosomal protein S18P [Lactobacillus paracasei subsp.
          paracasei 8700:2]
 gi|258507008|ref|YP_003169759.1| 30S ribosomal protein S18 [Lactobacillus rhamnosus GG]
 gi|258538205|ref|YP_003172704.1| 30S ribosomal protein S18 [Lactobacillus rhamnosus Lc 705]
 gi|301065139|ref|YP_003787162.1| 30S ribosomal protein L18 [Lactobacillus casei str. Zhang]
 gi|122264952|sp|Q03D45|RS18_LACC3 RecName: Full=30S ribosomal protein S18
 gi|229560041|sp|B3W6R6|RS18_LACCB RecName: Full=30S ribosomal protein S18
 gi|116103735|gb|ABJ68877.1| SSU ribosomal protein S18P [Lactobacillus casei ATCC 334]
 gi|190711137|emb|CAQ65143.1| 30S ribosomal protein S18 [Lactobacillus casei BL23]
 gi|199590822|gb|EDY98907.1| Ribosomal protein S18 [Lactobacillus rhamnosus HN001]
 gi|227188824|gb|EEI68891.1| ribosomal protein S18 [Lactobacillus paracasei subsp. paracasei
          ATCC 25302]
 gi|229315551|gb|EEN81524.1| ribosomal protein S18 [Lactobacillus rhamnosus LMS2-1]
 gi|239527099|gb|EEQ66100.1| SSU ribosomal protein S18P [Lactobacillus paracasei subsp.
          paracasei 8700:2]
 gi|257146935|emb|CAR85908.1| SSU/30S ribosomal protein S18P [Lactobacillus rhamnosus GG]
 gi|257149881|emb|CAR88853.1| SSU/30S ribosomal protein S18P [Lactobacillus rhamnosus Lc 705]
 gi|259648377|dbj|BAI40539.1| 30S ribosomal protein S18 [Lactobacillus rhamnosus GG]
 gi|300437546|gb|ADK17312.1| Ribosomal protein S18 [Lactobacillus casei str. Zhang]
 gi|327380874|gb|AEA52350.1| 30S ribosomal protein S18 [Lactobacillus casei LC2W]
 gi|327384038|gb|AEA55512.1| 30S ribosomal protein S18 [Lactobacillus casei BD-II]
 gi|328463730|gb|EGF35304.1| 30S ribosomal protein S18 [Lactobacillus rhamnosus MTCC 5462]
          Length = 78

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 44/64 (68%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYKD  LL+RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+
Sbjct: 13 KVDFIAANHIEYIDYKDTNLLDRFISERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLL 72

Query: 79 AYVN 82
           +V+
Sbjct: 73 PFVS 76


>gi|312879778|ref|ZP_07739578.1| SSU ribosomal protein S18P [Aminomonas paucivorans DSM 12260]
 gi|310783069|gb|EFQ23467.1| SSU ribosomal protein S18P [Aminomonas paucivorans DSM 12260]
          Length = 80

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 39/64 (60%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
           K C        R+DYK+   L +++++RGKIVP R++    K QR+L +AIKRAR L L
Sbjct: 15 PKVCHFCVDKVQRVDYKEFEKLRKYVTERGKIVPRRVTGTCAKHQRQLTRAIKRARILAL 74

Query: 78 IAYV 81
          + + 
Sbjct: 75 LPFT 78


>gi|125974670|ref|YP_001038580.1| 30S ribosomal protein S18 [Clostridium thermocellum ATCC 27405]
 gi|256004131|ref|ZP_05429115.1| ribosomal protein S18 [Clostridium thermocellum DSM 2360]
 gi|281418858|ref|ZP_06249877.1| ribosomal protein S18 [Clostridium thermocellum JW20]
 gi|166220948|sp|A3DHF8|RS18_CLOTH RecName: Full=30S ribosomal protein S18
 gi|125714895|gb|ABN53387.1| SSU ribosomal protein S18P [Clostridium thermocellum ATCC 27405]
 gi|255991879|gb|EEU01977.1| ribosomal protein S18 [Clostridium thermocellum DSM 2360]
 gi|281407942|gb|EFB38201.1| ribosomal protein S18 [Clostridium thermocellum JW20]
 gi|316941795|gb|ADU75829.1| ribosomal protein S18 [Clostridium thermocellum DSM 1313]
          Length = 94

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 43/70 (61%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          +    ++K C        RIDYKD+  L +++S+RGKI+P RIS    K QR+L  AIKR
Sbjct: 23 KVRRAKKKICAFCVDKVERIDYKDVAKLKKYISERGKILPRRISGNCAKHQRQLTVAIKR 82

Query: 72 ARYLGLIAYV 81
          AR++ L+ Y 
Sbjct: 83 ARHIALLPYT 92


>gi|229825620|ref|ZP_04451689.1| hypothetical protein GCWU000182_00982 [Abiotrophia defectiva ATCC
          49176]
 gi|229790183|gb|EEP26297.1| hypothetical protein GCWU000182_00982 [Abiotrophia defectiva ATCC
          49176]
          Length = 92

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/72 (48%), Positives = 47/72 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           RR +  R+K C L+ +    +DYKD   L +F+S+RGKI+P RI+  S + QR L  AI
Sbjct: 19 RRRPMHRRKKVCALTPEELDNLDYKDAAKLKKFISERGKILPRRITGTSARHQRILTTAI 78

Query: 70 KRARYLGLIAYV 81
          KRAR+L LI YV
Sbjct: 79 KRARHLALIPYV 90


>gi|118579197|ref|YP_900447.1| 30S ribosomal protein S18 [Pelobacter propionicus DSM 2379]
 gi|166220968|sp|A1AM19|RS18_PELPD RecName: Full=30S ribosomal protein S18
 gi|118501907|gb|ABK98389.1| SSU ribosomal protein S18P [Pelobacter propionicus DSM 2379]
          Length = 94

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/86 (41%), Positives = 45/86 (52%), Gaps = 7/86 (8%)

Query: 1  MAEVAPTPL-------LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSR 53
          MA   PT          +R    RRK C    +    IDYK+ R L  F+++RGKIVP R
Sbjct: 1  MANERPTSQQRPAGGPRKRRPFQRRKVCRFCAEKNLTIDYKEPRTLRYFITERGKIVPRR 60

Query: 54 ISSVSHKKQRELAKAIKRARYLGLIA 79
          IS      QRE+ +AIKRAR L L+ 
Sbjct: 61 ISGNCSAHQREITEAIKRARNLALLP 86


>gi|153855507|ref|ZP_01996626.1| hypothetical protein DORLON_02640 [Dorea longicatena DSM 13814]
 gi|149752029|gb|EDM61960.1| hypothetical protein DORLON_02640 [Dorea longicatena DSM 13814]
          Length = 88

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 39/62 (62%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C   GK    IDYKD   L +++S+RGKI+P RI+    K QR L  AIKRAR++ L+ 
Sbjct: 25 VCVFCGKENNEIDYKDTAKLRKYISERGKILPRRITGNCAKHQRALTVAIKRARHIALMP 84

Query: 80 YV 81
          YV
Sbjct: 85 YV 86


>gi|46447225|ref|YP_008590.1| ribosomal protein S18 [Candidatus Protochlamydia amoebophila
          UWE25]
 gi|59798733|sp|Q6MAT4|RS18_PARUW RecName: Full=30S ribosomal protein S18
 gi|46400866|emb|CAF24315.1| probable ribosomal protein S18 [Candidatus Protochlamydia
          amoebophila UWE25]
          Length = 86

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/68 (48%), Positives = 47/68 (69%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
           S +RK CP +  G   IDYKDI  L +F+++RGKI+P RI+ VS   Q++L  AIKRAR
Sbjct: 16 RSKKRKRCPFTAAGIREIDYKDIDTLTKFITERGKILPRRITGVSAYHQKKLTAAIKRAR 75

Query: 74 YLGLIAYV 81
          ++ L+ +V
Sbjct: 76 HVALLPFV 83


>gi|313900367|ref|ZP_07833861.1| ribosomal protein S18 [Clostridium sp. HGF2]
 gi|312954916|gb|EFR36590.1| ribosomal protein S18 [Clostridium sp. HGF2]
          Length = 76

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 44/73 (60%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++    R+K C  +      IDYKDI LL RF+S  GKI+P R++    K QR LA AI
Sbjct: 3  FKKQRMGRKKVCYFTKNKIESIDYKDIELLKRFISANGKIIPRRVTGTRAKYQRMLATAI 62

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ YV+
Sbjct: 63 KRARQMALLPYVS 75


>gi|114768974|ref|ZP_01446600.1| 30S ribosomal protein S18 [alpha proteobacterium HTCC2255]
 gi|114549891|gb|EAU52772.1| 30S ribosomal protein S18 [alpha proteobacterium HTCC2255]
          Length = 75

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/72 (63%), Positives = 57/72 (79%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRKSCP  G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELAKA
Sbjct: 1  MANKPFFRRRKSCPFLGDNAPKIDYKDTKLLQRYVSERGKIVPSRITAVSAKKQRELAKA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|154247048|ref|YP_001418006.1| 30S ribosomal protein S18 [Xanthobacter autotrophicus Py2]
 gi|205618870|sp|A7IK06|RS18_XANP2 RecName: Full=30S ribosomal protein S18
 gi|154161133|gb|ABS68349.1| ribosomal protein S18 [Xanthobacter autotrophicus Py2]
          Length = 88

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP SG  AP+IDYKD+RLL R++S+RGKIVPSRI++VS KKQREL+ AIK
Sbjct: 16 RRPFFRRRKTCPFSGPNAPKIDYKDVRLLQRYISERGKIVPSRITAVSAKKQRELSAAIK 75

Query: 71 RARYLGLIAYV 81
          R+R+LGL+ +V
Sbjct: 76 RSRFLGLLPFV 86


>gi|302334831|ref|YP_003800038.1| SSU ribosomal protein S18P [Olsenella uli DSM 7084]
 gi|301318671|gb|ADK67158.1| SSU ribosomal protein S18P [Olsenella uli DSM 7084]
          Length = 90

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 40/68 (58%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             RRK C    +    IDYKD +LL ++++ RGKI P R++    + Q ++A AIKRAR
Sbjct: 10 RQPRRKYCQFCKEDVEFIDYKDTQLLRKYMTDRGKIKPRRVTGACTQHQHDIAVAIKRAR 69

Query: 74 YLGLIAYV 81
           + L+ Y 
Sbjct: 70 EMALLPYT 77


>gi|94497409|ref|ZP_01303979.1| 30S ribosomal protein S18 [Sphingomonas sp. SKA58]
 gi|94423040|gb|EAT08071.1| 30S ribosomal protein S18 [Sphingomonas sp. SKA58]
          Length = 74

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 48/72 (66%), Positives = 59/72 (81%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP + K AP+IDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELA AI
Sbjct: 1  MARPFFRRRKSCPFAAKDAPKIDYKDVRLLQGFVSERGKIVPSRITAVSAKKQRELASAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR+LGL+ Y+
Sbjct: 61 KRARHLGLLPYI 72


>gi|254520716|ref|ZP_05132772.1| ribosomal protein S18 [Clostridium sp. 7_2_43FAA]
 gi|226914465|gb|EEH99666.1| ribosomal protein S18 [Clostridium sp. 7_2_43FAA]
          Length = 80

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 49/82 (59%), Gaps = 3/82 (3%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M ++  +  +RR    +RK C    + A  IDYKDI  L +F+++RGKI+P RIS    K
Sbjct: 1  MKDMKRSGKMRR---SKRKVCAFCVEKAEAIDYKDITKLRKFVTERGKILPRRISGTCAK 57

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
           QREL  AIKR+R + L+ +  
Sbjct: 58 HQRELTTAIKRSRNIALLPFTT 79


>gi|325474233|gb|EGC77421.1| 30S ribosomal protein S18 [Treponema denticola F0402]
          Length = 99

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +    +R+K C    +    IDYK+   L RF+++RGKI+P RI+    K QR+LA  I
Sbjct: 26 RKGRSFYRKKVCRFCAQKVK-IDYKEPDALRRFITERGKILPRRITGTCAKHQRKLAVEI 84

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ +V
Sbjct: 85 KRARAVALLPFV 96


>gi|87199436|ref|YP_496693.1| 30S ribosomal protein S18 [Novosphingobium aromaticivorans DSM
          12444]
 gi|123763556|sp|Q2G8G4|RS18_NOVAD RecName: Full=30S ribosomal protein S18
 gi|87135117|gb|ABD25859.1| SSU ribosomal protein S18P [Novosphingobium aromaticivorans DSM
          12444]
          Length = 74

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 48/72 (66%), Positives = 61/72 (84%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP SGK AP+IDYKD+RLL  F+S+RGKIVPSRI++VS KKQREL++AI
Sbjct: 1  MARPFFRRRKSCPFSGKNAPKIDYKDVRLLQGFMSERGKIVPSRITAVSAKKQRELSQAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ Y+
Sbjct: 61 KRARHIGLLPYI 72


>gi|317133426|ref|YP_004092740.1| ribosomal protein S18 [Ethanoligenens harbinense YUAN-3]
 gi|315471405|gb|ADU28009.1| ribosomal protein S18 [Ethanoligenens harbinense YUAN-3]
          Length = 84

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 38/63 (60%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYKDI  L ++LS+R KI+P R++      QREL  AIKRAR+L L+ 
Sbjct: 21 VCSFCVDKVESIDYKDIAKLRKYLSERAKILPRRVTGTCAHHQRELTIAIKRARHLALLP 80

Query: 80 YVN 82
          YV+
Sbjct: 81 YVS 83


>gi|187923778|ref|YP_001895420.1| 30S ribosomal protein S18 [Burkholderia phytofirmans PsJN]
 gi|229559973|sp|B2T3N5|RS18_BURPP RecName: Full=30S ribosomal protein S18
 gi|187714972|gb|ACD16196.1| ribosomal protein S18 [Burkholderia phytofirmans PsJN]
          Length = 91

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 42/80 (52%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +       +  +  R+K C  +      IDYKD+  L  F+ + GKI P+R++      Q
Sbjct: 8  KFDKRRQQQNPLFKRKKFCRFTAANVDHIDYKDLETLKDFIGENGKITPARLTGTKSHYQ 67

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 68 RQLDTAIKRARFLALVPYTD 87


>gi|116619041|ref|YP_819412.1| SSU ribosomal protein S18P [Leuconostoc mesenteroides subsp.
          mesenteroides ATCC 8293]
 gi|122270759|sp|Q03UT3|RS18_LEUMM RecName: Full=30S ribosomal protein S18
 gi|116097888|gb|ABJ63039.1| SSU ribosomal protein S18P [Leuconostoc mesenteroides subsp.
          mesenteroides ATCC 8293]
          Length = 94

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/64 (43%), Positives = 41/64 (64%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYK+  LL RF+S+RGKI+P R++  S K QR++  AIKRAR + L+
Sbjct: 29 KVDFIAANHIEYIDYKNTELLERFISERGKILPRRVTGTSAKNQRKVTTAIKRARIMALL 88

Query: 79 AYVN 82
           +V 
Sbjct: 89 PFVT 92


>gi|332800523|ref|YP_004462022.1| 30S ribosomal protein S18 [Tepidanaerobacter sp. Re1]
 gi|332698258|gb|AEE92715.1| 30S ribosomal protein S18 [Tepidanaerobacter sp. Re1]
          Length = 74

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 41/72 (56%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++     ++K C         IDYK+   L +++++RGKI+P RI+    K QR+L  AI
Sbjct: 1  MKPRRIKKKKVCSFCVDKVDHIDYKEYARLRKYITERGKILPRRITGNCAKHQRQLTIAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR L L+ + 
Sbjct: 61 KRARNLALLPFT 72


>gi|261410090|ref|YP_003246331.1| 30S ribosomal protein S18 [Paenibacillus sp. Y412MC10]
 gi|315644249|ref|ZP_07897419.1| ribosomal protein S18 [Paenibacillus vortex V453]
 gi|329925101|ref|ZP_08280045.1| ribosomal protein S18 [Paenibacillus sp. HGF5]
 gi|261286553|gb|ACX68524.1| ribosomal protein S18 [Paenibacillus sp. Y412MC10]
 gi|315280624|gb|EFU43913.1| ribosomal protein S18 [Paenibacillus vortex V453]
 gi|328940220|gb|EGG36552.1| ribosomal protein S18 [Paenibacillus sp. HGF5]
          Length = 90

 Score = 95.8 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 45/80 (56%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +    P  R   + RRK C  +      IDYKD  LL +F+S+RGKI+P R++  S K Q
Sbjct: 10 DNDKRPARRGGRNKRRKVCFFTVNKITHIDYKDTDLLKKFISERGKILPRRVTGTSAKYQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R L  AIKR+R + L+ Y  
Sbjct: 70 RALTIAIKRSRQIALLPYTT 89


>gi|295100600|emb|CBK98145.1| SSU ribosomal protein S18P [Faecalibacterium prausnitzii L2-6]
          Length = 85

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P   +RR    R+K C         IDYKD+  L +++S+R KI+P R++      QR L
Sbjct: 11 PARPMRRG---RKKVCSFCVDRIDTIDYKDVPRLRKYVSERAKIIPRRVTGTCAFHQRAL 67

Query: 66 AKAIKRARYLGLIAYVN 82
            AIKRAR++ L+ YV+
Sbjct: 68 TVAIKRARHVALMPYVS 84


>gi|121595517|ref|YP_987413.1| 30S ribosomal protein S18 [Acidovorax sp. JS42]
 gi|222111738|ref|YP_002554002.1| 30S ribosomal protein s18 [Acidovorax ebreus TPSY]
 gi|166220919|sp|A1WAR2|RS18_ACISJ RecName: Full=30S ribosomal protein S18
 gi|254765424|sp|B9MDJ3|RS18_DIAST RecName: Full=30S ribosomal protein S18
 gi|120607597|gb|ABM43337.1| SSU ribosomal protein S18P [Acidovorax sp. JS42]
 gi|221731182|gb|ACM34002.1| ribosomal protein S18 [Acidovorax ebreus TPSY]
          Length = 93

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (57%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R++ C  +  G   IDYKD+  L  F+++ GKI+P+R++      Q
Sbjct: 10 DKRPKRNTQSLLFKRKRFCRFTVAGVEEIDYKDVDTLRDFIAENGKIIPARLTGTRAIYQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 70 RQLNTAIKRARFLALLPYSD 89


>gi|15639055|ref|NP_218501.1| 30S ribosomal protein S18 [Treponema pallidum subsp. pallidum
          str. Nichols]
 gi|189025295|ref|YP_001933067.1| 30S ribosomal protein S18 [Treponema pallidum subsp. pallidum
          SS14]
 gi|6094164|sp|O83100|RS18_TREPA RecName: Full=30S ribosomal protein S18
 gi|229560078|sp|B2S209|RS18_TREPS RecName: Full=30S ribosomal protein S18
 gi|3322319|gb|AAC65056.1| ribosomal protein S18 (rpsR) [Treponema pallidum subsp. pallidum
          str. Nichols]
 gi|189017870|gb|ACD70488.1| ribosomal protein S18 [Treponema pallidum subsp. pallidum SS14]
 gi|291059477|gb|ADD72212.1| 30S ribosomal protein S18 [Treponema pallidum subsp. pallidum
          str. Chicago]
          Length = 99

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +    +R+K C    +     DYKD   L RF+++RGKI+P RI+    K QR +A  +
Sbjct: 26 KKNRQFYRKKVCRFCTQKLLA-DYKDPDTLRRFITERGKILPRRITGTCAKHQRRVALEV 84

Query: 70 KRARYLGLIAYV 81
          KR+R + L+ +V
Sbjct: 85 KRSRAVALLPFV 96


>gi|227540353|ref|ZP_03970402.1| ribosomal protein S18 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300771167|ref|ZP_07081043.1| 30S ribosomal protein S18 [Sphingobacterium spiritivorum ATCC
          33861]
 gi|227239677|gb|EEI89692.1| ribosomal protein S18 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300761837|gb|EFK58657.1| 30S ribosomal protein S18 [Sphingobacterium spiritivorum ATCC
          33861]
          Length = 87

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 46/67 (68%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R+K C     G   IDYKD   L +F++ +GKI+P R++  S K QR++A+A+KRAR++
Sbjct: 17 NRKKYCRFKKNGIKYIDYKDANFLLKFVNDQGKILPRRLTGTSLKFQRKVAQAVKRARHI 76

Query: 76 GLIAYVN 82
          GL+ YV 
Sbjct: 77 GLLPYVT 83


>gi|169335534|ref|ZP_02862727.1| hypothetical protein ANASTE_01948 [Anaerofustis stercorihominis
          DSM 17244]
 gi|169258272|gb|EDS72238.1| hypothetical protein ANASTE_01948 [Anaerofustis stercorihominis
          DSM 17244]
          Length = 81

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 37/69 (53%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             R+K C         IDYKD +LL +++S+R KI+P R++    K QR + +A+  AR
Sbjct: 12 FRRRKKVCYFCENKIEHIDYKDTKLLKKYVSERYKILPRRVTGTCAKHQRGVTQAVNIAR 71

Query: 74 YLGLIAYVN 82
             L+ Y  
Sbjct: 72 NAALLPYTT 80


>gi|187478663|ref|YP_786687.1| 30S ribosomal protein S18 [Bordetella avium 197N]
 gi|123725072|sp|Q2KZ21|RS18_BORA1 RecName: Full=30S ribosomal protein S18
 gi|115423249|emb|CAJ49782.1| 30S ribosomal protein S18 [Bordetella avium 197N]
          Length = 90

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 43/72 (59%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +  +  RRK C  +  G   IDYKD+  L  F+ + GKI+P+R++      QR+L  AIK
Sbjct: 16 QNPLFKRRKFCRFTAAGVEEIDYKDLDTLRDFVQENGKIIPARLTGTRAIYQRQLDSAIK 75

Query: 71 RARYLGLIAYVN 82
          RAR+L L+ Y +
Sbjct: 76 RARFLALLPYTD 87


>gi|332685544|ref|YP_004455318.1| 30S ribosomal protein S18p [Melissococcus plutonius ATCC 35311]
 gi|332369553|dbj|BAK20509.1| SSU ribosomal protein S18p [Melissococcus plutonius ATCC 35311]
          Length = 79

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 43/63 (68%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
             ++      IDYKDI LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+ 
Sbjct: 14 VDYIAANHIEYIDYKDIELLKRFISERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLLP 73

Query: 80 YVN 82
          +V+
Sbjct: 74 FVS 76


>gi|323341109|ref|ZP_08081357.1| 30S ribosomal protein S18 [Lactobacillus ruminis ATCC 25644]
 gi|323091530|gb|EFZ34154.1| 30S ribosomal protein S18 [Lactobacillus ruminis ATCC 25644]
          Length = 78

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 42/63 (66%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYKD  LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+
Sbjct: 13 KVDFIAANHIEYIDYKDTDLLKRFISERGKILPRRVTGTSAKNQRKLTVAIKRARIMGLL 72

Query: 79 AYV 81
           +V
Sbjct: 73 PFV 75


>gi|33593750|ref|NP_881394.1| 30S ribosomal protein S18 [Bordetella pertussis Tohama I]
 gi|33597056|ref|NP_884699.1| 30S ribosomal protein S18 [Bordetella parapertussis 12822]
 gi|33600901|ref|NP_888461.1| 30S ribosomal protein S18 [Bordetella bronchiseptica RB50]
 gi|59798865|sp|Q7VV91|RS18_BORPE RecName: Full=30S ribosomal protein S18
 gi|59798870|sp|Q7W7P6|RS18_BORPA RecName: Full=30S ribosomal protein S18
 gi|59798872|sp|Q7WL33|RS18_BORBR RecName: Full=30S ribosomal protein S18
 gi|33563823|emb|CAE43067.1| 30s ribosomal protein s18 [Bordetella pertussis Tohama I]
 gi|33566507|emb|CAE37763.1| 30s ribosomal protein s18 [Bordetella parapertussis]
 gi|33568501|emb|CAE32413.1| 30s ribosomal protein s18 [Bordetella bronchiseptica RB50]
 gi|332383152|gb|AEE67999.1| 30S ribosomal protein S18 [Bordetella pertussis CS]
          Length = 90

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 43/72 (59%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +  +  RRK C  +  G   IDYKD+  L  F+ + GKI+P+R++      QR+L  AIK
Sbjct: 16 QNPLFKRRKFCRFTAAGVEEIDYKDLDTLRDFVQENGKIIPARLTGTRAIYQRQLDTAIK 75

Query: 71 RARYLGLIAYVN 82
          RAR+L L+ Y +
Sbjct: 76 RARFLALLPYTD 87


>gi|313122784|ref|YP_004033043.1| 30S ribosomal protein s18 [Lactobacillus delbrueckii subsp.
          bulgaricus ND02]
 gi|312279347|gb|ADQ60066.1| 30S ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus ND02]
 gi|325685098|gb|EGD27229.1| 30S ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          lactis DSM 20072]
          Length = 78

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 44/63 (69%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      +DYKD+ LL  F+S+RGKI+P R++  S K QR++AKAIKRAR +GL+
Sbjct: 13 KVDFIAANHIDYVDYKDVDLLKHFISERGKILPRRVTGTSAKNQRKVAKAIKRARIMGLL 72

Query: 79 AYV 81
           +V
Sbjct: 73 PFV 75


>gi|152983164|ref|YP_001352993.1| 30S ribosomal protein S18 [Janthinobacterium sp. Marseille]
 gi|151283241|gb|ABR91651.1| small subunit ribosomal protein S18 [Janthinobacterium sp.
          Marseille]
          Length = 94

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          ++      +  +  R+K C  +     ++DYKD+  L  F+ + GKI+P+R++      Q
Sbjct: 11 KLKEKRKQQNPLFKRKKFCRFTAAHVEQVDYKDVDTLKDFVQENGKIMPARLTGTKAIYQ 70

Query: 63 RELAKAIKRARYLGLIAYVNL 83
          R++  AIKRARYL L+ Y +L
Sbjct: 71 RQVDTAIKRARYLALLPYTDL 91


>gi|308071625|ref|YP_003873230.1| 30S ribosomal protein S18 [Paenibacillus polymyxa E681]
 gi|310644855|ref|YP_003949614.1| 30S ribosomal protein s18 [Paenibacillus polymyxa SC2]
 gi|305860904|gb|ADM72692.1| 30S ribosomal protein S18 [Paenibacillus polymyxa E681]
 gi|309249806|gb|ADO59373.1| 30S ribosomal protein S18 [Paenibacillus polymyxa SC2]
          Length = 90

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 45/80 (56%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +    P  R   + RRK C  +      IDYKD  LL +F+S+RGKI+P R++  S K Q
Sbjct: 10 DDNKRPARRGGRNKRRKVCFFTVNKITHIDYKDTDLLKKFISERGKILPRRVTGTSAKYQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R L  A+KR+R + L+ Y  
Sbjct: 70 RMLTIAVKRSRQIALLPYTT 89


>gi|303242466|ref|ZP_07328947.1| ribosomal protein S18 [Acetivibrio cellulolyticus CD2]
 gi|302589990|gb|EFL59757.1| ribosomal protein S18 [Acetivibrio cellulolyticus CD2]
          Length = 95

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 43/71 (60%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    ++K C         IDYKD+  L +++S+RGKI+P RIS    K QR++  A+KR
Sbjct: 24 RMRRAKKKICAFCVDKVTDIDYKDVSKLKKYVSERGKILPRRISGNCAKHQRQMTVAVKR 83

Query: 72 ARYLGLIAYVN 82
          AR++ L+ Y +
Sbjct: 84 ARHIALLPYTS 94


>gi|169830183|ref|YP_001700341.1| 30S ribosomal protein S18 [Lysinibacillus sphaericus C3-41]
 gi|168994671|gb|ACA42211.1| 30S ribosomal protein S18 [Lysinibacillus sphaericus C3-41]
          Length = 78

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 41/62 (66%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIK +R +GL+ 
Sbjct: 13 VCYFTANNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTSAIKVSRIMGLLP 72

Query: 80 YV 81
          +V
Sbjct: 73 FV 74


>gi|210624078|ref|ZP_03294178.1| hypothetical protein CLOHIR_02130 [Clostridium hiranonis DSM
          13275]
 gi|210153211|gb|EEA84217.1| hypothetical protein CLOHIR_02130 [Clostridium hiranonis DSM
          13275]
          Length = 74

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 39/62 (62%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C        +IDYKD + L R++++RGKI+P RIS    K QREL KAIKRAR + L+ 
Sbjct: 11 VCQFCADKNAKIDYKDTQRLQRYVTERGKILPRRISGTCAKHQRELTKAIKRARNIALLP 70

Query: 80 YV 81
          Y 
Sbjct: 71 YT 72


>gi|194289921|ref|YP_002005828.1| 30S ribosomal protein s18 [Cupriavidus taiwanensis LMG 19424]
 gi|229559981|sp|B3R2P5|RS18_CUPTR RecName: Full=30S ribosomal protein S18
 gi|193223756|emb|CAQ69763.1| 30S ribosomal protein S18 [Cupriavidus taiwanensis LMG 19424]
          Length = 92

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 43/73 (58%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +  +  R++ C  +  G  +IDYKD+  L  F+   GKI P+R++      QR+L  AIK
Sbjct: 17 QNPLFKRKRFCRFTVAGVEQIDYKDLDTLKDFIGDNGKITPARLTGTKAHYQRQLDTAIK 76

Query: 71 RARYLGLIAYVNL 83
          RAR+L L+ Y +L
Sbjct: 77 RARFLALLPYTDL 89


>gi|269129130|ref|YP_003302500.1| 30S ribosomal protein S18 [Thermomonospora curvata DSM 43183]
 gi|268314088|gb|ACZ00463.1| ribosomal protein S18 [Thermomonospora curvata DSM 43183]
          Length = 78

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 36/63 (57%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C    +    +DYKD  LL +F+S RGKI   R++    + QR++A AIK AR + L+ 
Sbjct: 13 VCVFCQEKISYVDYKDTGLLRKFISDRGKIRARRVTGNCTQHQRDVATAIKNAREMALLP 72

Query: 80 YVN 82
          Y +
Sbjct: 73 YTS 75


>gi|229829467|ref|ZP_04455536.1| hypothetical protein GCWU000342_01557 [Shuttleworthia satelles
          DSM 14600]
 gi|229791898|gb|EEP28012.1| hypothetical protein GCWU000342_01557 [Shuttleworthia satelles
          DSM 14600]
          Length = 76

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK C   G     IDYKD   L +++S+RGKI+P RI+    + QR L  AIK
Sbjct: 5  RRPAHRRRKVCVFCGSEV-AIDYKDANQLRKYVSERGKILPRRITGTCARHQRALTSAIK 63

Query: 71 RARYLGLIAYV 81
          RAR+L ++ YV
Sbjct: 64 RARHLAIMPYV 74


>gi|58336363|ref|YP_192948.1| 30S ribosomal protein S18 [Lactobacillus acidophilus NCFM]
 gi|227877549|ref|ZP_03995609.1| 30S ribosomal protein S18 [Lactobacillus crispatus JV-V01]
 gi|227893830|ref|ZP_04011635.1| 30S ribosomal protein S18 [Lactobacillus ultunensis DSM 16047]
 gi|227902586|ref|ZP_04020391.1| 30S ribosomal protein S18 [Lactobacillus acidophilus ATCC 4796]
 gi|256843823|ref|ZP_05549310.1| 30S ribosomal protein S18 [Lactobacillus crispatus 125-2-CHN]
 gi|256849622|ref|ZP_05555054.1| 30S ribosomal protein S18 [Lactobacillus crispatus MV-1A-US]
 gi|262046290|ref|ZP_06019253.1| 30S ribosomal protein S18 [Lactobacillus crispatus MV-3A-US]
 gi|293380899|ref|ZP_06626935.1| 30S ribosomal protein S18 [Lactobacillus crispatus 214-1]
 gi|295691871|ref|YP_003600481.1| 30S ribosomal protein s18 [Lactobacillus crispatus ST1]
 gi|312977110|ref|ZP_07788859.1| ribosomal protein S18 [Lactobacillus crispatus CTV-05]
 gi|315037239|ref|YP_004030807.1| 30S ribosomal protein S18 [Lactobacillus amylovorus GRL 1112]
 gi|325955730|ref|YP_004286340.1| 30S ribosomal protein S18 [Lactobacillus acidophilus 30SC]
 gi|75507681|sp|Q5FN07|RS18_LACAC RecName: Full=30S ribosomal protein S18
 gi|58253680|gb|AAV41917.1| 30S Ribosomal protein S18 [Lactobacillus acidophilus NCFM]
 gi|227862848|gb|EEJ70307.1| 30S ribosomal protein S18 [Lactobacillus crispatus JV-V01]
 gi|227864319|gb|EEJ71740.1| 30S ribosomal protein S18 [Lactobacillus ultunensis DSM 16047]
 gi|227869675|gb|EEJ77096.1| 30S ribosomal protein S18 [Lactobacillus acidophilus ATCC 4796]
 gi|256613728|gb|EEU18930.1| 30S ribosomal protein S18 [Lactobacillus crispatus 125-2-CHN]
 gi|256713738|gb|EEU28727.1| 30S ribosomal protein S18 [Lactobacillus crispatus MV-1A-US]
 gi|260573620|gb|EEX30177.1| 30S ribosomal protein S18 [Lactobacillus crispatus MV-3A-US]
 gi|290922572|gb|EFD99538.1| 30S ribosomal protein S18 [Lactobacillus crispatus 214-1]
 gi|295029977|emb|CBL49456.1| 30S ribosomal protein S18 [Lactobacillus crispatus ST1]
 gi|310896438|gb|EFQ45503.1| ribosomal protein S18 [Lactobacillus crispatus CTV-05]
 gi|312275372|gb|ADQ58012.1| 30S ribosomal protein S18 [Lactobacillus amylovorus GRL 1112]
 gi|323465566|gb|ADX69253.1| 30S ribosomal protein S18 [Lactobacillus helveticus H10]
 gi|325332295|gb|ADZ06203.1| 30S ribosomal protein S18 [Lactobacillus acidophilus 30SC]
 gi|327182558|gb|AEA31005.1| 30S ribosomal protein S18 [Lactobacillus amylovorus GRL 1118]
          Length = 78

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 44/63 (69%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      +DYKD+ LL RF+S+RGKI+P R++  S K QR++A AIKRAR +GL+
Sbjct: 13 KVDYIAANHIDYVDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKVANAIKRARIMGLL 72

Query: 79 AYV 81
           +V
Sbjct: 73 PFV 75


>gi|16767639|ref|NP_463254.1| 30S ribosomal protein S18 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|20978699|sp|Q8ZK81|RS18_SALTY RecName: Full=30S ribosomal protein S18
 gi|16422955|gb|AAL23213.1| 30S ribosomal subunit protein S18 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. LT2]
          Length = 75

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 45/70 (64%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+L +AIKRA
Sbjct: 3  RYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLRRAIKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|212697312|ref|ZP_03305440.1| hypothetical protein ANHYDRO_01880 [Anaerococcus hydrogenalis DSM
          7454]
 gi|325848774|ref|ZP_08170284.1| ribosomal protein S18 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|212675761|gb|EEB35368.1| hypothetical protein ANHYDRO_01880 [Anaerococcus hydrogenalis DSM
          7454]
 gi|325480418|gb|EGC83480.1| ribosomal protein S18 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 74

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 48/73 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          +RRN   R+K  P     +  IDYKDI  L RF+S RGKI+P R++ ++ K QRE+ +AI
Sbjct: 1  MRRNFRPRKKVDPFVKDPSKVIDYKDIDTLKRFISDRGKILPRRVTGLNAKHQREITRAI 60

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ Y +
Sbjct: 61 KRARQVALLPYED 73


>gi|161506643|ref|YP_001576591.1| 30S ribosomal protein S18 [Lactobacillus helveticus DPC 4571]
 gi|172048334|sp|A8YW49|RS18_LACH4 RecName: Full=30S ribosomal protein S18
 gi|160347632|gb|ABX26306.1| 30S ribosomal protein S18 [Lactobacillus helveticus DPC 4571]
 gi|328468768|gb|EGF39739.1| 30S ribosomal protein S18 [Lactobacillus helveticus MTCC 5463]
          Length = 77

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 44/63 (69%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      +DYKD+ LL RF+S+RGKI+P R++  S K QR++A AIKRAR +GL+
Sbjct: 12 KVDYIAANHIDYVDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKVANAIKRARIMGLL 71

Query: 79 AYV 81
           +V
Sbjct: 72 PFV 74


>gi|299135703|ref|ZP_07028887.1| ribosomal protein S18 [Acidobacterium sp. MP5ACTX8]
 gi|298601827|gb|EFI57981.1| ribosomal protein S18 [Acidobacterium sp. MP5ACTX8]
          Length = 124

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/68 (42%), Positives = 43/68 (63%)

Query: 13  NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
               R+K C  + +    I Y+D+RLL +F+S RGKI+P R++  S   QR+L KAIK+A
Sbjct: 53  KFFRRKKVCKFTVEKIDTISYRDVRLLQQFVSDRGKIIPRRLTGTSAPFQRKLTKAIKQA 112

Query: 73  RYLGLIAY 80
           R + L+ Y
Sbjct: 113 RAIALLPY 120


>gi|225873662|ref|YP_002755121.1| ribosomal protein S18 [Acidobacterium capsulatum ATCC 51196]
 gi|254765401|sp|C1F903|RS18_ACIC5 RecName: Full=30S ribosomal protein S18
 gi|225791607|gb|ACO31697.1| ribosomal protein S18 [Acidobacterium capsulatum ATCC 51196]
          Length = 105

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query: 13  NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
               R+K C    +    I Y+D+RLL +F+++RGKIVP R++ V    QR L +AIK+A
Sbjct: 34  KFFRRKKVCKFCTEKIDAIPYRDVRLLQQFVAERGKIVPRRLTGVCTTHQRRLTRAIKQA 93

Query: 73  RYLGLIAY 80
           R + L+ +
Sbjct: 94  RNIALLPF 101


>gi|221195118|ref|ZP_03568174.1| ribosomal protein S18 [Atopobium rimae ATCC 49626]
 gi|221185021|gb|EEE17412.1| ribosomal protein S18 [Atopobium rimae ATCC 49626]
          Length = 90

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 40/68 (58%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             RRK C    +    IDYKD +LL ++++ RGKI P R++    + Q ++A AIKRAR
Sbjct: 10 RQPRRKYCQFCKENTEYIDYKDTQLLRKYMTDRGKIKPRRVTGACTQHQHDIALAIKRAR 69

Query: 74 YLGLIAYV 81
           + L+ Y 
Sbjct: 70 EMALLPYT 77


>gi|260893966|ref|YP_003240063.1| ribosomal protein S18 [Ammonifex degensii KC4]
 gi|260866107|gb|ACX53213.1| ribosomal protein S18 [Ammonifex degensii KC4]
          Length = 76

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 39/63 (61%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C    +   ++DYKD+  L +F+S RGKI+P RI+    + QR L  AIKRAR + L+ 
Sbjct: 13 ICSFCVEKIDKVDYKDVNRLKKFISDRGKILPRRITGNCARHQRMLTVAIKRARIMALLP 72

Query: 80 YVN 82
          +V+
Sbjct: 73 FVS 75


>gi|121535339|ref|ZP_01667151.1| ribosomal protein S18 [Thermosinus carboxydivorans Nor1]
 gi|121306031|gb|EAX46961.1| ribosomal protein S18 [Thermosinus carboxydivorans Nor1]
          Length = 76

 Score = 95.4 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 42/72 (58%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
            R    ++K C        R+DYKD+  L RF+++RGKI+P RIS    + QR+L  AI
Sbjct: 3  RERGRKPKKKVCSFCVDKIERVDYKDVPRLRRFITERGKILPRRISGNCARHQRQLTLAI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ + 
Sbjct: 63 KRARNMALLPFT 74


>gi|295105039|emb|CBL02583.1| SSU ribosomal protein S18P [Faecalibacterium prausnitzii SL3/3]
          Length = 85

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P   +RR    R+K C         IDYKD+  L +++S+R KI+P R++      QR L
Sbjct: 11 PARPMRRG---RKKVCSFCVDRIDTIDYKDVPRLRKYVSERAKIIPRRVTGTCAYHQRAL 67

Query: 66 AKAIKRARYLGLIAYVN 82
            AIKRAR++ L+ YV+
Sbjct: 68 TIAIKRARHVALMPYVS 84


>gi|238855514|ref|ZP_04645819.1| ribosomal protein S18 [Lactobacillus jensenii 269-3]
 gi|256851682|ref|ZP_05557070.1| ribosomal protein S18 [Lactobacillus jensenii 27-2-CHN]
 gi|260661601|ref|ZP_05862513.1| ribosomal protein S18 [Lactobacillus jensenii 115-3-CHN]
 gi|260665218|ref|ZP_05866067.1| ribosomal protein S18 [Lactobacillus jensenii SJ-7A-US]
 gi|282931540|ref|ZP_06337039.1| ribosomal protein S18 [Lactobacillus jensenii 208-1]
 gi|282934234|ref|ZP_06339511.1| ribosomal protein S18 [Lactobacillus jensenii 208-1]
 gi|297205291|ref|ZP_06922687.1| 30S ribosomal protein S18 [Lactobacillus jensenii JV-V16]
 gi|313472771|ref|ZP_07813259.1| ribosomal protein S18 [Lactobacillus jensenii 1153]
 gi|238831880|gb|EEQ24212.1| ribosomal protein S18 [Lactobacillus jensenii 269-3]
 gi|239529058|gb|EEQ68059.1| ribosomal protein S18 [Lactobacillus jensenii 1153]
 gi|256615640|gb|EEU20829.1| ribosomal protein S18 [Lactobacillus jensenii 27-2-CHN]
 gi|260547658|gb|EEX23636.1| ribosomal protein S18 [Lactobacillus jensenii 115-3-CHN]
 gi|260560955|gb|EEX26930.1| ribosomal protein S18 [Lactobacillus jensenii SJ-7A-US]
 gi|281301708|gb|EFA93975.1| ribosomal protein S18 [Lactobacillus jensenii 208-1]
 gi|281304347|gb|EFA96450.1| ribosomal protein S18 [Lactobacillus jensenii 208-1]
 gi|297149869|gb|EFH30166.1| 30S ribosomal protein S18 [Lactobacillus jensenii JV-V16]
          Length = 78

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/63 (47%), Positives = 43/63 (68%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      +DYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+
Sbjct: 13 KVDFIAANHIDYVDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLL 72

Query: 79 AYV 81
           +V
Sbjct: 73 PFV 75


>gi|312135777|ref|YP_004003115.1| 30S ribosomal protein S18 [Caldicellulosiruptor owensensis OL]
 gi|311775828|gb|ADQ05315.1| ribosomal protein S18 [Caldicellulosiruptor owensensis OL]
          Length = 92

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 42/70 (60%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKR
Sbjct: 21 SRQKKKKRVCSFCVERIYEIDYKDVNRLKKFLTERGKILPRRTTGNCARHQRQLTRAIKR 80

Query: 72 ARYLGLIAYV 81
          AR L L+ ++
Sbjct: 81 ARILALLPFI 90


>gi|257065460|ref|YP_003145132.1| SSU ribosomal protein S18P [Slackia heliotrinireducens DSM 20476]
 gi|256793113|gb|ACV23783.1| SSU ribosomal protein S18P [Slackia heliotrinireducens DSM 20476]
          Length = 86

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 8/81 (9%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MAE +  P        RRK C         +DYKD  LL ++++ RGKI P R++    +
Sbjct: 1  MAEYSKQP--------RRKYCQFCKDDTEYVDYKDTALLRKYMTDRGKIKPRRVTGACVQ 52

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QR++A AIK AR +GL+ Y 
Sbjct: 53 HQRDVANAIKNAREMGLMPYT 73


>gi|170016529|ref|YP_001727448.1| ribosomal protein S18 [Leuconostoc citreum KM20]
 gi|326693086|ref|ZP_08230091.1| 30S ribosomal protein S18 [Leuconostoc argentinum KCTC 3773]
 gi|229560045|sp|B1MWV2|RS18_LEUCK RecName: Full=30S ribosomal protein S18
 gi|169803386|gb|ACA82004.1| Ribosomal protein S18 [Leuconostoc citreum KM20]
          Length = 94

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/64 (43%), Positives = 41/64 (64%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYK+  LL RF+S+RGKI+P R++  S K QR++  AIKRAR + L+
Sbjct: 29 KVDYIAANHIEFIDYKNTELLERFISERGKILPRRVTGTSAKNQRKVTTAIKRARIMALL 88

Query: 79 AYVN 82
           +V 
Sbjct: 89 PFVT 92


>gi|323705824|ref|ZP_08117396.1| ribosomal protein S18 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534820|gb|EGB24599.1| ribosomal protein S18 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 88

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 36/62 (58%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYK++  L +++++RGKI+P RI+      QR+L  AIKRAR + L+ 
Sbjct: 25 VCAFCADRIDYIDYKEVGKLRKYITERGKILPRRITGNCAIHQRQLTVAIKRARQIALLP 84

Query: 80 YV 81
          Y 
Sbjct: 85 YT 86


>gi|257871397|ref|ZP_05651050.1| ribosomal protein S18 [Enterococcus gallinarum EG2]
 gi|257805561|gb|EEV34383.1| ribosomal protein S18 [Enterococcus gallinarum EG2]
          Length = 78

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 40/62 (64%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
             ++      IDYKD  LL RF+S+RGKI+P R++    K QR+L  AIKRAR +GL+ 
Sbjct: 14 VDYIAANHIEHIDYKDTELLKRFISERGKILPRRVTGTGAKNQRKLTVAIKRARIMGLLP 73

Query: 80 YV 81
          +V
Sbjct: 74 FV 75


>gi|206889919|ref|YP_002248636.1| ribosomal protein S18 [Thermodesulfovibrio yellowstonii DSM
          11347]
 gi|206741857|gb|ACI20914.1| ribosomal protein S18 [Thermodesulfovibrio yellowstonii DSM
          11347]
          Length = 77

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 44/71 (61%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              R+K C    +    IDYK+++LL  F+++RGKI+  +++    K QREL KAIKRA
Sbjct: 7  RRFFRKKYCRFCAEKIDFIDYKNVKLLRGFMTERGKILSRKLTGTCSKHQRELTKAIKRA 66

Query: 73 RYLGLIAYVNL 83
          R + L+ Y+ +
Sbjct: 67 RAVALLPYIEI 77


>gi|332520811|ref|ZP_08397271.1| ribosomal protein S18 [Lacinutrix algicola 5H-3-7-4]
 gi|332043341|gb|EGI79537.1| ribosomal protein S18 [Lacinutrix algicola 5H-3-7-4]
          Length = 98

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 44/68 (64%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S ++K C     G   +DYKD   L  F++++GKI+P R++  S K QR+++ A+KRAR+
Sbjct: 27 SKQKKYCRFKKSGIKYVDYKDADWLLGFVNEQGKILPRRLTGTSLKYQRKVSVAVKRARH 86

Query: 75 LGLIAYVN 82
          L L+ YV 
Sbjct: 87 LALLPYVT 94


>gi|297538624|ref|YP_003674393.1| 30S ribosomal protein S18 [Methylotenera sp. 301]
 gi|297257971|gb|ADI29816.1| ribosomal protein S18 [Methylotenera sp. 301]
          Length = 76

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 46/73 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R +  RR+ C  S +G   +DYKD+ LL  F+S+  KI+P+R++    + QR+L  A+
Sbjct: 1  MAREMYKRRRYCRFSAEGIKEVDYKDVDLLKDFISENAKIIPARMTGTKARYQRQLTTAV 60

Query: 70 KRARYLGLIAYVN 82
          K AR+L L+ Y +
Sbjct: 61 KLARFLALLPYTD 73


>gi|110746771|gb|ABG89277.1| ribosomal protein S18 [Paenibacillus larvae]
          Length = 75

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 38/63 (60%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +      IDYKDI  L +F+S+RGKI+P R++  S K QR L  AIKRAR + L+ 
Sbjct: 12 VCYFTANKIKHIDYKDIDTLKKFISERGKILPRRVTGTSAKYQRMLTIAIKRARQVALLP 71

Query: 80 YVN 82
          Y  
Sbjct: 72 YTT 74


>gi|332704307|ref|ZP_08424395.1| 30S ribosomal protein S18 [Desulfovibrio africanus str. Walvis
          Bay]
 gi|332554456|gb|EGJ51500.1| 30S ribosomal protein S18 [Desulfovibrio africanus str. Walvis
          Bay]
          Length = 86

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 39/73 (53%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +R  + R+K C         IDYK+  LL  F++ RGKI+  RI+    K QR L  AI
Sbjct: 3  FKRRFAPRKKYCRFCADKNVAIDYKNADLLRDFITDRGKIIARRITGTCAKHQRRLTTAI 62

Query: 70 KRARYLGLIAYVN 82
          KR+R + L+ Y  
Sbjct: 63 KRSRQMALLFYTT 75


>gi|90423798|ref|YP_532168.1| 30S ribosomal protein S18 [Rhodopseudomonas palustris BisB18]
 gi|122995501|sp|Q215T7|RS18_RHOPB RecName: Full=30S ribosomal protein S18
 gi|90105812|gb|ABD87849.1| SSU ribosomal protein S18P [Rhodopseudomonas palustris BisB18]
          Length = 79

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+AIK
Sbjct: 7  RRPFFRRRKTCPFTGPNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          R+R+LGL+ YV
Sbjct: 67 RSRFLGLLPYV 77


>gi|297618489|ref|YP_003703648.1| ribosomal protein S18 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146326|gb|ADI03083.1| ribosomal protein S18 [Syntrophothermus lipocalidus DSM 12680]
          Length = 74

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 36/61 (59%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C    +    IDYKD   L R++++RGKI+P RI+    K QR L  AIKRAR + L+ +
Sbjct: 12 CNFCAEKIENIDYKDAARLRRYITERGKILPRRITGNCAKHQRRLTTAIKRAREMALLPF 71

Query: 81 V 81
           
Sbjct: 72 T 72


>gi|256545548|ref|ZP_05472908.1| 30S ribosomal protein S18 [Anaerococcus vaginalis ATCC 51170]
 gi|256398759|gb|EEU12376.1| 30S ribosomal protein S18 [Anaerococcus vaginalis ATCC 51170]
          Length = 74

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/73 (46%), Positives = 48/73 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          +RRN   R+K  P     +  IDYKDI  L RF+S RGKI+P R++ ++ K QRE+ +AI
Sbjct: 1  MRRNFRPRKKVDPFVKDPSKVIDYKDIDTLKRFVSDRGKILPRRVTGLNAKHQREITRAI 60

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ Y +
Sbjct: 61 KRARQVALLPYED 73


>gi|256827566|ref|YP_003151525.1| 30S ribosomal protein S18P [Cryptobacterium curtum DSM 15641]
 gi|256583709|gb|ACU94843.1| SSU ribosomal protein S18P [Cryptobacterium curtum DSM 15641]
          Length = 87

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 42/67 (62%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             RRK C    +G   IDYKD ++L ++++ RGKI P R++    + QR++A A+KRAR
Sbjct: 6  KQPRRKYCQFCKEGTEYIDYKDTQMLRKYVTDRGKIKPRRVTGACTQHQRDIANAVKRAR 65

Query: 74 YLGLIAY 80
           + L+ Y
Sbjct: 66 EMALMPY 72


>gi|160900659|ref|YP_001566241.1| 30S ribosomal protein S18 [Delftia acidovorans SPH-1]
 gi|229559982|sp|A9BNG1|RS18_DELAS RecName: Full=30S ribosomal protein S18
 gi|160366243|gb|ABX37856.1| ribosomal protein S18 [Delftia acidovorans SPH-1]
          Length = 93

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 45/80 (56%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R++ C  +  G   IDYKD+  L  F+ + GKIVP+R++      Q
Sbjct: 10 DKRPKRNTQSLLFKRKRFCRFTVAGVEEIDYKDVDTLRDFIGENGKIVPARLTGTRAIYQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 70 RQLNTAIKRARFLALVPYSD 89


>gi|81427625|ref|YP_394622.1| 30S ribosomal protein S18 [Lactobacillus sakei subsp. sakei 23K]
 gi|123742279|sp|Q38ZR6|RS18_LACSS RecName: Full=30S ribosomal protein S18
 gi|78609264|emb|CAI54311.1| 30S Ribosomal protein S18 [Lactobacillus sakei subsp. sakei 23K]
          Length = 79

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 41/64 (64%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYKD  LL RF+S+RGKI+P R+S  S K QR L  AIKRAR +GL+
Sbjct: 14 KVDFIAANHIEYIDYKDTDLLKRFISERGKILPRRVSGTSAKNQRRLTIAIKRARIMGLL 73

Query: 79 AYVN 82
           +V 
Sbjct: 74 PFVT 77


>gi|220927534|ref|YP_002504443.1| 30S ribosomal protein S18 [Clostridium cellulolyticum H10]
 gi|219997862|gb|ACL74463.1| ribosomal protein S18 [Clostridium cellulolyticum H10]
          Length = 96

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 43/70 (61%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    ++K C      A  IDYKDI  + +++S+RGKI+P RIS    K QR+L  A+KR
Sbjct: 25 RMRRVKKKVCSFCVDKATDIDYKDIAKIRKYVSERGKILPRRISGNCAKHQRQLTVAVKR 84

Query: 72 ARYLGLIAYV 81
          AR++ L+ Y 
Sbjct: 85 ARHIALLPYT 94


>gi|39995772|ref|NP_951723.1| 30S ribosomal protein S18 [Geobacter sulfurreducens PCA]
 gi|59798802|sp|Q74FE3|RS18_GEOSL RecName: Full=30S ribosomal protein S18
 gi|39982536|gb|AAR33996.1| ribosomal protein S18 [Geobacter sulfurreducens PCA]
 gi|307634729|gb|ADI83505.2| ribosomal protein S18 [Geobacter sulfurreducens KN400]
          Length = 103

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 41/70 (58%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +R    RRK C         IDYKD R+L  F+++RGKIVP RIS      QRE+ +AI
Sbjct: 26 RKRRPFQRRKVCRFCADKTLVIDYKDPRVLRSFITERGKIVPRRISGNCSAHQREITEAI 85

Query: 70 KRARYLGLIA 79
          KRAR + LI 
Sbjct: 86 KRARNIALIP 95


>gi|85374300|ref|YP_458362.1| 30S ribosomal protein S18 [Erythrobacter litoralis HTCC2594]
 gi|123099521|sp|Q2N9S6|RS18_ERYLH RecName: Full=30S ribosomal protein S18
 gi|84787383|gb|ABC63565.1| ribosomal protein S18 [Erythrobacter litoralis HTCC2594]
          Length = 74

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 48/72 (66%), Positives = 59/72 (81%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK+CP S K AP+IDYKD RLL  F+S+RGKIVPSRI++VS KKQRELAKAI
Sbjct: 1  MARPFFRRRKTCPFSAKNAPKIDYKDTRLLQGFMSERGKIVPSRITAVSAKKQRELAKAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ Y+
Sbjct: 61 KRARHIGLLPYI 72


>gi|148543252|ref|YP_001270622.1| 30S ribosomal protein S18 [Lactobacillus reuteri DSM 20016]
 gi|184152664|ref|YP_001841005.1| 30S ribosomal protein S18 [Lactobacillus reuteri JCM 1112]
 gi|194467411|ref|ZP_03073398.1| ribosomal protein S18 [Lactobacillus reuteri 100-23]
 gi|227364315|ref|ZP_03848408.1| 30S ribosomal protein S18 [Lactobacillus reuteri MM2-3]
 gi|227543727|ref|ZP_03973776.1| 30S ribosomal protein S18 [Lactobacillus reuteri CF48-3A]
 gi|259502122|ref|ZP_05745024.1| 30S ribosomal protein S18 [Lactobacillus antri DSM 16041]
 gi|300908792|ref|ZP_07126255.1| 30S ribosomal protein S18 [Lactobacillus reuteri SD2112]
 gi|312869248|ref|ZP_07729420.1| ribosomal protein S18 [Lactobacillus oris PB013-T2-3]
 gi|325683514|ref|ZP_08163030.1| 30S ribosomal protein S18 [Lactobacillus reuteri MM4-1A]
 gi|167011191|sp|A5VHG1|RS18_LACRD RecName: Full=30S ribosomal protein S18
 gi|229560043|sp|B2G4Z3|RS18_LACRJ RecName: Full=30S ribosomal protein S18
 gi|148530286|gb|ABQ82285.1| SSU ribosomal protein S18P [Lactobacillus reuteri DSM 20016]
 gi|183224008|dbj|BAG24525.1| 30S ribosomal protein S18 [Lactobacillus reuteri JCM 1112]
 gi|194454447|gb|EDX43344.1| ribosomal protein S18 [Lactobacillus reuteri 100-23]
 gi|227070628|gb|EEI08958.1| 30S ribosomal protein S18 [Lactobacillus reuteri MM2-3]
 gi|227186295|gb|EEI66366.1| 30S ribosomal protein S18 [Lactobacillus reuteri CF48-3A]
 gi|259169935|gb|EEW54430.1| 30S ribosomal protein S18 [Lactobacillus antri DSM 16041]
 gi|300894199|gb|EFK87557.1| 30S ribosomal protein S18 [Lactobacillus reuteri SD2112]
 gi|311095269|gb|EFQ53541.1| ribosomal protein S18 [Lactobacillus oris PB013-T2-3]
 gi|324977864|gb|EGC14815.1| 30S ribosomal protein S18 [Lactobacillus reuteri MM4-1A]
          Length = 78

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 42/63 (66%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYKD  LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+
Sbjct: 13 KVDFIAANHIEYIDYKDTDLLRRFISERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLL 72

Query: 79 AYV 81
           +V
Sbjct: 73 PFV 75


>gi|300812002|ref|ZP_07092458.1| ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus PB2003/044-T3-4]
 gi|300497028|gb|EFK32094.1| ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus PB2003/044-T3-4]
          Length = 78

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 49/74 (66%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P  RR    RRK   ++      +DYKD+ LL RF+S+RGKI+P R++  S K QR++A 
Sbjct: 2  PQQRRGGRRRRKVDFIAANHIDYVDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKVAN 61

Query: 68 AIKRARYLGLIAYV 81
          AIKRAR +GL+ +V
Sbjct: 62 AIKRARIMGLLPFV 75


>gi|227529854|ref|ZP_03959903.1| 30S ribosomal protein S18 [Lactobacillus vaginalis ATCC 49540]
 gi|227350223|gb|EEJ40514.1| 30S ribosomal protein S18 [Lactobacillus vaginalis ATCC 49540]
          Length = 78

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 42/63 (66%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYKD  LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+
Sbjct: 13 KVDFIAANHIDYIDYKDTDLLRRFISERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLL 72

Query: 79 AYV 81
           +V
Sbjct: 73 PFV 75


>gi|289422550|ref|ZP_06424393.1| ribosomal protein S18 [Peptostreptococcus anaerobius 653-L]
 gi|289157122|gb|EFD05744.1| ribosomal protein S18 [Peptostreptococcus anaerobius 653-L]
          Length = 75

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/62 (43%), Positives = 38/62 (61%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C        +IDYK+ + L +F+++RGKI+P RI+    K QREL KAIK AR + L+ 
Sbjct: 12 VCQFCADKNTKIDYKNYQKLEKFVTERGKILPRRITGTCAKHQRELTKAIKMARNIALLP 71

Query: 80 YV 81
          Y 
Sbjct: 72 YT 73


>gi|317152940|ref|YP_004120988.1| 30S ribosomal protein S18 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943191|gb|ADU62242.1| ribosomal protein S18 [Desulfovibrio aespoeensis Aspo-2]
          Length = 87

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 39/74 (52%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R+  + R+K C         +DYK   +L  F+++RGKI+  RI+    K QR L   I
Sbjct: 3  FRKKFTPRKKFCRFCADQELPLDYKRTDILRDFVTERGKIIARRITGTCAKHQRRLTNEI 62

Query: 70 KRARYLGLIAYVNL 83
          KRAR + L+ Y  +
Sbjct: 63 KRARQMALLFYTTV 76


>gi|258512886|ref|YP_003186320.1| 30S ribosomal protein S18 [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
 gi|257479612|gb|ACV59931.1| ribosomal protein S18 [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
          Length = 76

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C          DYKD+  L++FL++RGKI+P RI+    + QR++  AIKRAR + L+ 
Sbjct: 13 VCQYCVDKIDYADYKDVARLSKFLTERGKILPRRITGNCARHQRQVTVAIKRARQVALLP 72

Query: 80 YVN 82
          Y  
Sbjct: 73 YTT 75


>gi|103487385|ref|YP_616946.1| 30S ribosomal protein S18 [Sphingopyxis alaskensis RB2256]
 gi|123253124|sp|Q1GRV9|RS18_SPHAL RecName: Full=30S ribosomal protein S18
 gi|98977462|gb|ABF53613.1| SSU ribosomal protein S18P [Sphingopyxis alaskensis RB2256]
          Length = 74

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 48/72 (66%), Positives = 59/72 (81%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK+CP S K AP IDYKD+RLL  +LS+RGKIVPSRI++VS KKQRELAKAI
Sbjct: 1  MARPFFRRRKTCPFSAKDAPVIDYKDVRLLQGYLSERGKIVPSRITAVSTKKQRELAKAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ Y+
Sbjct: 61 KRARHIGLLPYI 72


>gi|94310915|ref|YP_584125.1| 30S ribosomal protein S18 [Cupriavidus metallidurans CH34]
 gi|113868253|ref|YP_726742.1| 30S ribosomal protein S18 [Ralstonia eutropha H16]
 gi|122946776|sp|Q0K9E7|RS18_RALEH RecName: Full=30S ribosomal protein S18
 gi|122987924|sp|Q1LLX0|RS18_RALME RecName: Full=30S ribosomal protein S18
 gi|93354767|gb|ABF08856.1| SSU ribosomal protein S18 [Cupriavidus metallidurans CH34]
 gi|113527029|emb|CAJ93374.1| SSU ribosomal protein S18 [Ralstonia eutropha H16]
          Length = 92

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 43/73 (58%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +  +  R++ C  +  G  +IDYKD+  L  F+   GKI P+R++      QR+L  AIK
Sbjct: 17 QNPLFKRKRFCRFTVAGVEQIDYKDLDTLKDFIGDNGKITPARLTGTKAHYQRQLDTAIK 76

Query: 71 RARYLGLIAYVNL 83
          RAR+L L+ Y +L
Sbjct: 77 RARFLALMPYTDL 89


>gi|255527666|ref|ZP_05394525.1| ribosomal protein S18 [Clostridium carboxidivorans P7]
 gi|296186805|ref|ZP_06855206.1| ribosomal protein S18 [Clostridium carboxidivorans P7]
 gi|255508646|gb|EET85027.1| ribosomal protein S18 [Clostridium carboxidivorans P7]
 gi|296048519|gb|EFG87952.1| ribosomal protein S18 [Clostridium carboxidivorans P7]
          Length = 85

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 42/71 (59%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          +    +RK C      A  IDYKDI  L +++++RGKI+P RIS    K QR+L  AIKR
Sbjct: 14 KMRRAKRKICSFCMDKAESIDYKDINKLRKYVTERGKILPRRISGNCAKHQRQLTDAIKR 73

Query: 72 ARYLGLIAYVN 82
          AR + L+ +  
Sbjct: 74 ARNIALLPFTT 84


>gi|78043292|ref|YP_358909.1| 30S ribosomal protein S18 [Carboxydothermus hydrogenoformans
          Z-2901]
 gi|123729631|sp|Q3AG25|RS18_CARHZ RecName: Full=30S ribosomal protein S18
 gi|77995407|gb|ABB14306.1| ribosomal protein S18 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 76

 Score = 94.7 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 40/72 (55%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
            +    +++ C         +DYKD+  L +++++RGKI+P RIS    + QR L  AI
Sbjct: 3  KEKGSRRKKRVCAFCVDKIVDVDYKDVNRLKKYITERGKILPRRISGNCARHQRRLTTAI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ + 
Sbjct: 63 KRARIMALLPFT 74


>gi|290968075|ref|ZP_06559624.1| ribosomal protein S18 [Megasphaera genomosp. type_1 str. 28L]
 gi|290781981|gb|EFD94560.1| ribosomal protein S18 [Megasphaera genomosp. type_1 str. 28L]
          Length = 76

 Score = 94.7 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 41/70 (58%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R+   RRK C         IDYKD   L RF ++RGKI+P RIS V  K QR+L  AIKR
Sbjct: 5  RSRKPRRKVCNFCVDHVDLIDYKDTAKLRRFTTERGKILPRRISGVCAKHQRKLTIAIKR 64

Query: 72 ARYLGLIAYV 81
          AR + L+ Y 
Sbjct: 65 ARAIALLPYT 74


>gi|262197682|ref|YP_003268891.1| ribosomal protein S18 [Haliangium ochraceum DSM 14365]
 gi|262081029|gb|ACY16998.1| ribosomal protein S18 [Haliangium ochraceum DSM 14365]
          Length = 105

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 1   MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
           M   +P   +      RRK C         +DYK+ +LL  F++ RGKI P RIS    K
Sbjct: 26  MLGKSPARSM-----SRRKVCRFCLDNTVTLDYKNAQLLKNFITDRGKITPRRISGNCAK 80

Query: 61  KQRELAKAIKRARYLGLIAY 80
            QR LA AI+RAR + L+ +
Sbjct: 81  HQRALALAIRRARMIALLPF 100


>gi|126651975|ref|ZP_01724167.1| ribosomal protein S18 [Bacillus sp. B14905]
 gi|299541785|ref|ZP_07052108.1| 30S ribosomal protein S18 [Lysinibacillus fusiformis ZC1]
 gi|126591244|gb|EAZ85353.1| ribosomal protein S18 [Bacillus sp. B14905]
 gi|298725523|gb|EFI66164.1| 30S ribosomal protein S18 [Lysinibacillus fusiformis ZC1]
          Length = 78

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 41/62 (66%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +      IDYKD+ LL +F+S+RGKI+P R++  S K QR+L  AIK +R +GL+ 
Sbjct: 13 VCYFTSNNITHIDYKDVDLLKKFISERGKILPRRVTGTSAKYQRKLTSAIKVSRIMGLLP 72

Query: 80 YV 81
          +V
Sbjct: 73 FV 74


>gi|296111019|ref|YP_003621400.1| 30S ribosomal protein S18 [Leuconostoc kimchii IMSNU 11154]
 gi|295832550|gb|ADG40431.1| 30S ribosomal protein S18 [Leuconostoc kimchii IMSNU 11154]
          Length = 94

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 41/64 (64%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYK+  LL RF+S+RGKI+P R++  S K QR++  A+KRAR + L+
Sbjct: 29 KVDFIAANHIEYIDYKNTELLERFISERGKILPRRVTGTSAKNQRKVTTAVKRARIMALL 88

Query: 79 AYVN 82
           +V 
Sbjct: 89 PFVT 92


>gi|85708888|ref|ZP_01039954.1| 30S ribosomal protein S18 [Erythrobacter sp. NAP1]
 gi|85690422|gb|EAQ30425.1| 30S ribosomal protein S18 [Erythrobacter sp. NAP1]
          Length = 74

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 61/72 (84%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP SGK AP+IDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELAKAI
Sbjct: 1  MARPFFRRRKSCPFSGKDAPKIDYKDVRLLQGFMSERGKIVPSRITAVSAKKQRELAKAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ Y+
Sbjct: 61 KRARHIGLLPYI 72


>gi|164686462|ref|ZP_02210490.1| hypothetical protein CLOBAR_00027 [Clostridium bartlettii DSM
          16795]
 gi|164604473|gb|EDQ97938.1| hypothetical protein CLOBAR_00027 [Clostridium bartlettii DSM
          16795]
          Length = 75

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C        RIDYK+ + L +++++RGKI+P RIS    K QREL  AIKRAR L L+ 
Sbjct: 12 VCQFCASKDARIDYKNTQRLQKYITERGKILPRRISGTCAKHQRELTVAIKRARNLALLP 71

Query: 80 YV 81
          Y 
Sbjct: 72 YT 73


>gi|29374670|ref|NP_813822.1| 30S ribosomal protein S18 [Enterococcus faecalis V583]
 gi|227518100|ref|ZP_03948149.1| 30S ribosomal protein S18 [Enterococcus faecalis TX0104]
 gi|227555693|ref|ZP_03985740.1| 30S ribosomal protein S18 [Enterococcus faecalis HH22]
 gi|229547121|ref|ZP_04435846.1| 30S ribosomal protein S18 [Enterococcus faecalis TX1322]
 gi|229550691|ref|ZP_04439416.1| 30S ribosomal protein S18 [Enterococcus faecalis ATCC 29200]
 gi|255971557|ref|ZP_05422143.1| ribosomal protein S18 [Enterococcus faecalis T1]
 gi|255974530|ref|ZP_05425116.1| ribosomal protein S18 [Enterococcus faecalis T2]
 gi|256761862|ref|ZP_05502442.1| ribosomal protein S18 [Enterococcus faecalis T3]
 gi|256854989|ref|ZP_05560350.1| ribosomal protein S18 [Enterococcus faecalis T8]
 gi|256957007|ref|ZP_05561178.1| ribosomal protein S18 [Enterococcus faecalis DS5]
 gi|256960816|ref|ZP_05564987.1| 30S ribosomal protein S18 [Enterococcus faecalis Merz96]
 gi|256963991|ref|ZP_05568162.1| 30S ribosomal protein S18 [Enterococcus faecalis HIP11704]
 gi|257078684|ref|ZP_05573045.1| 30S ribosomal protein S18 [Enterococcus faecalis JH1]
 gi|257081355|ref|ZP_05575716.1| 30S ribosomal protein S18 [Enterococcus faecalis E1Sol]
 gi|257084012|ref|ZP_05578373.1| 30S ribosomal protein S18 [Enterococcus faecalis Fly1]
 gi|257087842|ref|ZP_05582203.1| ribosomal protein S18 [Enterococcus faecalis D6]
 gi|257088494|ref|ZP_05582855.1| 30S ribosomal protein S18 [Enterococcus faecalis CH188]
 gi|257417434|ref|ZP_05594428.1| ribosomal protein S18 [Enterococcus faecalis AR01/DG]
 gi|257418834|ref|ZP_05595828.1| 30S ribosomal protein S18 [Enterococcus faecalis T11]
 gi|257421351|ref|ZP_05598341.1| 30S ribosomal protein S18 [Enterococcus faecalis X98]
 gi|293382654|ref|ZP_06628582.1| ribosomal protein S18 [Enterococcus faecalis R712]
 gi|293387934|ref|ZP_06632470.1| ribosomal protein S18 [Enterococcus faecalis S613]
 gi|294780772|ref|ZP_06746130.1| ribosomal protein S18 [Enterococcus faecalis PC1.1]
 gi|300861749|ref|ZP_07107829.1| ribosomal protein S18 [Enterococcus faecalis TUSoD Ef11]
 gi|307268925|ref|ZP_07550289.1| ribosomal protein S18 [Enterococcus faecalis TX4248]
 gi|307274020|ref|ZP_07555230.1| ribosomal protein S18 [Enterococcus faecalis TX0855]
 gi|307276491|ref|ZP_07557611.1| ribosomal protein S18 [Enterococcus faecalis TX2134]
 gi|307284067|ref|ZP_07564237.1| ribosomal protein S18 [Enterococcus faecalis TX0860]
 gi|307287173|ref|ZP_07567244.1| ribosomal protein S18 [Enterococcus faecalis TX0109]
 gi|307296598|ref|ZP_07576418.1| ribosomal protein S18 [Enterococcus faecalis TX0411]
 gi|312901288|ref|ZP_07760571.1| ribosomal protein S18 [Enterococcus faecalis TX0470]
 gi|312903115|ref|ZP_07762296.1| ribosomal protein S18 [Enterococcus faecalis TX0635]
 gi|312908806|ref|ZP_07767745.1| ribosomal protein S18 [Enterococcus faecalis DAPTO 512]
 gi|312951712|ref|ZP_07770606.1| ribosomal protein S18 [Enterococcus faecalis TX0102]
 gi|312979552|ref|ZP_07791234.1| ribosomal protein S18 [Enterococcus faecalis DAPTO 516]
 gi|59798885|sp|Q839Y8|RS18_ENTFA RecName: Full=30S ribosomal protein S18
 gi|29342128|gb|AAO79894.1| ribosomal protein S18 [Enterococcus faecalis V583]
 gi|227074448|gb|EEI12411.1| 30S ribosomal protein S18 [Enterococcus faecalis TX0104]
 gi|227175151|gb|EEI56123.1| 30S ribosomal protein S18 [Enterococcus faecalis HH22]
 gi|229304192|gb|EEN70188.1| 30S ribosomal protein S18 [Enterococcus faecalis ATCC 29200]
 gi|229307777|gb|EEN73764.1| 30S ribosomal protein S18 [Enterococcus faecalis TX1322]
 gi|255962575|gb|EET95051.1| ribosomal protein S18 [Enterococcus faecalis T1]
 gi|255967402|gb|EET98024.1| ribosomal protein S18 [Enterococcus faecalis T2]
 gi|256683113|gb|EEU22808.1| ribosomal protein S18 [Enterococcus faecalis T3]
 gi|256709502|gb|EEU24549.1| ribosomal protein S18 [Enterococcus faecalis T8]
 gi|256947503|gb|EEU64135.1| ribosomal protein S18 [Enterococcus faecalis DS5]
 gi|256951312|gb|EEU67944.1| 30S ribosomal protein S18 [Enterococcus faecalis Merz96]
 gi|256954487|gb|EEU71119.1| 30S ribosomal protein S18 [Enterococcus faecalis HIP11704]
 gi|256986714|gb|EEU74016.1| 30S ribosomal protein S18 [Enterococcus faecalis JH1]
 gi|256989385|gb|EEU76687.1| 30S ribosomal protein S18 [Enterococcus faecalis E1Sol]
 gi|256992042|gb|EEU79344.1| 30S ribosomal protein S18 [Enterococcus faecalis Fly1]
 gi|256995872|gb|EEU83174.1| ribosomal protein S18 [Enterococcus faecalis D6]
 gi|256997306|gb|EEU83826.1| 30S ribosomal protein S18 [Enterococcus faecalis CH188]
 gi|257159262|gb|EEU89222.1| ribosomal protein S18 [Enterococcus faecalis ARO1/DG]
 gi|257160662|gb|EEU90622.1| 30S ribosomal protein S18 [Enterococcus faecalis T11]
 gi|257163175|gb|EEU93135.1| 30S ribosomal protein S18 [Enterococcus faecalis X98]
 gi|291079960|gb|EFE17324.1| ribosomal protein S18 [Enterococcus faecalis R712]
 gi|291082671|gb|EFE19634.1| ribosomal protein S18 [Enterococcus faecalis S613]
 gi|294452134|gb|EFG20578.1| ribosomal protein S18 [Enterococcus faecalis PC1.1]
 gi|295112348|emb|CBL30985.1| SSU ribosomal protein S18P [Enterococcus sp. 7L76]
 gi|300848274|gb|EFK76031.1| ribosomal protein S18 [Enterococcus faecalis TUSoD Ef11]
 gi|306495934|gb|EFM65522.1| ribosomal protein S18 [Enterococcus faecalis TX0411]
 gi|306501771|gb|EFM71062.1| ribosomal protein S18 [Enterococcus faecalis TX0109]
 gi|306503438|gb|EFM72687.1| ribosomal protein S18 [Enterococcus faecalis TX0860]
 gi|306506818|gb|EFM75968.1| ribosomal protein S18 [Enterococcus faecalis TX2134]
 gi|306509328|gb|EFM78388.1| ribosomal protein S18 [Enterococcus faecalis TX0855]
 gi|306514733|gb|EFM83284.1| ribosomal protein S18 [Enterococcus faecalis TX4248]
 gi|310625244|gb|EFQ08527.1| ribosomal protein S18 [Enterococcus faecalis DAPTO 512]
 gi|310630285|gb|EFQ13568.1| ribosomal protein S18 [Enterococcus faecalis TX0102]
 gi|310633506|gb|EFQ16789.1| ribosomal protein S18 [Enterococcus faecalis TX0635]
 gi|311287734|gb|EFQ66290.1| ribosomal protein S18 [Enterococcus faecalis DAPTO 516]
 gi|311291665|gb|EFQ70221.1| ribosomal protein S18 [Enterococcus faecalis TX0470]
 gi|315026669|gb|EFT38601.1| ribosomal protein S18 [Enterococcus faecalis TX2137]
 gi|315030114|gb|EFT42046.1| ribosomal protein S18 [Enterococcus faecalis TX4000]
 gi|315033548|gb|EFT45480.1| ribosomal protein S18 [Enterococcus faecalis TX0017]
 gi|315036371|gb|EFT48303.1| ribosomal protein S18 [Enterococcus faecalis TX0027]
 gi|315143587|gb|EFT87603.1| ribosomal protein S18 [Enterococcus faecalis TX2141]
 gi|315148275|gb|EFT92291.1| ribosomal protein S18 [Enterococcus faecalis TX4244]
 gi|315151299|gb|EFT95315.1| ribosomal protein S18 [Enterococcus faecalis TX0012]
 gi|315153725|gb|EFT97741.1| ribosomal protein S18 [Enterococcus faecalis TX0031]
 gi|315155115|gb|EFT99131.1| ribosomal protein S18 [Enterococcus faecalis TX0043]
 gi|315158755|gb|EFU02772.1| ribosomal protein S18 [Enterococcus faecalis TX0312]
 gi|315163339|gb|EFU07356.1| ribosomal protein S18 [Enterococcus faecalis TX0645]
 gi|315165719|gb|EFU09736.1| ribosomal protein S18 [Enterococcus faecalis TX1302]
 gi|315168228|gb|EFU12245.1| ribosomal protein S18 [Enterococcus faecalis TX1341]
 gi|315170504|gb|EFU14521.1| ribosomal protein S18 [Enterococcus faecalis TX1342]
 gi|315174174|gb|EFU18191.1| ribosomal protein S18 [Enterococcus faecalis TX1346]
 gi|315573983|gb|EFU86174.1| ribosomal protein S18 [Enterococcus faecalis TX0309B]
 gi|315578847|gb|EFU91038.1| ribosomal protein S18 [Enterococcus faecalis TX0630]
 gi|315581934|gb|EFU94125.1| ribosomal protein S18 [Enterococcus faecalis TX0309A]
 gi|323479248|gb|ADX78687.1| ribosomal protein S18 [Enterococcus faecalis 62]
 gi|327533862|gb|AEA92696.1| 30S ribosomal protein S18 [Enterococcus faecalis OG1RF]
 gi|329576169|gb|EGG57687.1| ribosomal protein S18 [Enterococcus faecalis TX1467]
          Length = 79

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 41/63 (65%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
             ++      IDYKD  LL RF+S+RGKI+P R++    K QR+L  AIKRAR +GL+ 
Sbjct: 14 VDYIAANHIEYIDYKDTELLKRFISERGKILPRRVTGTGAKNQRKLTIAIKRARIMGLLP 73

Query: 80 YVN 82
          +V+
Sbjct: 74 FVS 76


>gi|116513237|ref|YP_812143.1| 30S ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus ATCC BAA-365]
 gi|122275992|sp|Q04CW7|RS18_LACDB RecName: Full=30S ribosomal protein S18
 gi|116092552|gb|ABJ57705.1| SSU ribosomal protein S18P [Lactobacillus delbrueckii subsp.
          bulgaricus ATCC BAA-365]
 gi|325124864|gb|ADY84194.1| 30S Ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus 2038]
          Length = 78

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 42/62 (67%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
             ++      +DYKD+ LL  F+S+RGKI+P R++  S K QR++A AIKRAR +GL+ 
Sbjct: 14 VDLIAANHIDYVDYKDVDLLKHFISERGKILPRRVTGTSAKNQRKVANAIKRARIMGLLP 73

Query: 80 YV 81
          +V
Sbjct: 74 FV 75


>gi|51858142|dbj|BAD42300.1| 30S ribosomal protein S18 [Symbiobacterium thermophilum IAM
          14863]
          Length = 64

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 36/61 (59%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         +DYKD   L R++++RGKI+P RIS    + QR+L  AIKRAR + L+ +
Sbjct: 2  CSFCVDKIEHVDYKDAARLKRYITERGKILPRRISGNCARHQRQLTVAIKRARIMALLPF 61

Query: 81 V 81
           
Sbjct: 62 T 62


>gi|325291432|ref|YP_004267613.1| SSU ribosomal protein S18P [Syntrophobotulus glycolicus DSM 8271]
 gi|324966833|gb|ADY57612.1| SSU ribosomal protein S18P [Syntrophobotulus glycolicus DSM 8271]
          Length = 81

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 4  VAPTPLLR-RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +A  P+ + R    R++ C         IDYKD+  L +++++RGKI+P RIS    K Q
Sbjct: 1  MANAPVKKERTRRPRKRVCSFCVDKVTEIDYKDLPKLRKYVTERGKILPRRISGNCAKHQ 60

Query: 63 RELAKAIKRARYLGLIAYV 81
          RE+  AIKRAR + L+ YV
Sbjct: 61 REVTIAIKRARSIALLPYV 79


>gi|313894855|ref|ZP_07828415.1| ribosomal protein S18 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320530237|ref|ZP_08031307.1| ribosomal protein S18 [Selenomonas artemidis F0399]
 gi|312976536|gb|EFR41991.1| ribosomal protein S18 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320137670|gb|EFW29582.1| ribosomal protein S18 [Selenomonas artemidis F0399]
          Length = 77

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 36/63 (57%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD   L RF ++RGKI+P RIS    K QR++  AIKRAR + L+
Sbjct: 13 KVCSFCVDKVDHIDYKDAAKLRRFTTERGKILPRRISGNCAKHQRQVTLAIKRARNIALL 72

Query: 79 AYV 81
           + 
Sbjct: 73 PFT 75


>gi|56552122|ref|YP_162961.1| 30S ribosomal protein S18 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241762068|ref|ZP_04760152.1| ribosomal protein S18 [Zymomonas mobilis subsp. mobilis ATCC
          10988]
 gi|260752353|ref|YP_003225246.1| 30S ribosomal protein S18 [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
 gi|81677185|sp|Q5NN60|RS18_ZYMMO RecName: Full=30S ribosomal protein S18
 gi|56543696|gb|AAV89850.1| ribosomal protein S18 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373534|gb|EER63121.1| ribosomal protein S18 [Zymomonas mobilis subsp. mobilis ATCC
          10988]
 gi|258551716|gb|ACV74662.1| ribosomal protein S18 [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
          Length = 74

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 46/72 (63%), Positives = 60/72 (83%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP + K AP+IDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELA+AI
Sbjct: 1  MARPFFRRRKSCPFAAKDAPKIDYKDVRLLQGFVSERGKIVPSRITAVSAKKQRELARAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ ++
Sbjct: 61 KRARHIGLLPFI 72


>gi|225571308|ref|ZP_03780304.1| hypothetical protein CLOHYLEM_07406 [Clostridium hylemonae DSM
          15053]
 gi|225159784|gb|EEG72403.1| hypothetical protein CLOHYLEM_07406 [Clostridium hylemonae DSM
          15053]
          Length = 88

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 40/62 (64%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C   GK    IDYKD+  L +++S+RGKI+P RI+    K QR L  AIKRAR++ ++ 
Sbjct: 25 VCVFCGKENNEIDYKDVAKLRKYISERGKILPRRITGNCAKHQRALTVAIKRARHIAIMP 84

Query: 80 YV 81
          YV
Sbjct: 85 YV 86


>gi|218282110|ref|ZP_03488409.1| hypothetical protein EUBIFOR_00984 [Eubacterium biforme DSM 3989]
 gi|218216903|gb|EEC90441.1| hypothetical protein EUBIFOR_00984 [Eubacterium biforme DSM 3989]
          Length = 76

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 43/72 (59%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++    R+K C  +      IDYKD+ LL RF++  GKI+P R++    K QR LA AI
Sbjct: 3  FKKQRMGRKKVCYFTKNKIKEIDYKDVELLKRFINANGKIIPRRVTGTRAKYQRMLATAI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 63 KRARQMALLPYV 74


>gi|148553013|ref|YP_001260595.1| 30S ribosomal protein S18 [Sphingomonas wittichii RW1]
 gi|205617566|sp|A5V2E1|RS18_SPHWW RecName: Full=30S ribosomal protein S18
 gi|148498203|gb|ABQ66457.1| SSU ribosomal protein S18P [Sphingomonas wittichii RW1]
          Length = 74

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 49/72 (68%), Positives = 60/72 (83%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRKSCP S K APRIDYKD+RLL  F+S+RGKIVPSRI++VS KKQRELA+AI
Sbjct: 1  MARAFFRRRKSCPFSAKDAPRIDYKDVRLLQGFVSERGKIVPSRITAVSAKKQRELAQAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR++GL+ Y+
Sbjct: 61 KRARHIGLLPYI 72


>gi|253573878|ref|ZP_04851220.1| ribosomal protein S18 [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251846355|gb|EES74361.1| ribosomal protein S18 [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 89

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/77 (42%), Positives = 44/77 (57%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
            P  R   + RRK C  +      IDYKD  LL +F+S+RGKI+P R++  S K QR L
Sbjct: 12 KRPARRGGRNKRRKVCYFTVNKITHIDYKDTELLKKFISERGKILPRRVTGTSAKYQRLL 71

Query: 66 AKAIKRARYLGLIAYVN 82
            AIKR+R + L+ Y  
Sbjct: 72 TIAIKRSRQIALLPYTT 88


>gi|238926740|ref|ZP_04658500.1| ribosomal protein S18 [Selenomonas flueggei ATCC 43531]
 gi|292670198|ref|ZP_06603624.1| 30S ribosomal protein S18 [Selenomonas noxia ATCC 43541]
 gi|304436795|ref|ZP_07396763.1| 30S ribosomal protein S18 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
 gi|238885272|gb|EEQ48910.1| ribosomal protein S18 [Selenomonas flueggei ATCC 43531]
 gi|292648150|gb|EFF66122.1| 30S ribosomal protein S18 [Selenomonas noxia ATCC 43541]
 gi|304370275|gb|EFM23932.1| 30S ribosomal protein S18 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
          Length = 77

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 2/75 (2%)

Query: 9  LLRRNVSH--RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
          +++R+     RRK C         IDYKD   L RF ++RGKI+P RIS    K QR++ 
Sbjct: 1  MMKRDRGRKPRRKVCSFCVDKVDHIDYKDAAKLRRFTTERGKILPRRISGNCAKHQRQVT 60

Query: 67 KAIKRARYLGLIAYV 81
           AIKRAR + L+ + 
Sbjct: 61 LAIKRARNIALLPFT 75


>gi|163797515|ref|ZP_02191466.1| Ribosomal protein S18 [alpha proteobacterium BAL199]
 gi|159177264|gb|EDP61823.1| Ribosomal protein S18 [alpha proteobacterium BAL199]
          Length = 84

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 49/71 (69%), Positives = 60/71 (84%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRKSCP SG GAP IDYKD +LL+RF+S+RGKIVPSRI++VS KKQRE+A+AIK
Sbjct: 12 RRPFMRRRKSCPFSGTGAPIIDYKDTKLLSRFISERGKIVPSRITAVSAKKQREMARAIK 71

Query: 71 RARYLGLIAYV 81
          R+R+L L+ YV
Sbjct: 72 RSRFLALLPYV 82


>gi|78356456|ref|YP_387905.1| 30S ribosomal protein S18 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. G20]
 gi|123741297|sp|Q312D6|RS18_DESDG RecName: Full=30S ribosomal protein S18
 gi|78218861|gb|ABB38210.1| SSU ribosomal protein S18P [Desulfovibrio desulfuricans subsp.
          desulfuricans str. G20]
          Length = 87

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 38/73 (52%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++  + RRK C         I+YK   +L  F+++RGKI+  RI+      QR L   I
Sbjct: 3  FKKRFTPRRKFCRFCADKDLPINYKRPDILRDFVTERGKIIARRITGTCAHHQRLLTTEI 62

Query: 70 KRARYLGLIAYVN 82
          KRAR + L+ Y +
Sbjct: 63 KRARQMALLFYTS 75


>gi|284047425|ref|YP_003397764.1| ribosomal protein S18 [Acidaminococcus fermentans DSM 20731]
 gi|283951646|gb|ADB46449.1| ribosomal protein S18 [Acidaminococcus fermentans DSM 20731]
          Length = 78

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 37/63 (58%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD   L +F+++RGKI+P RIS    K QR+L  AIKRAR + L+
Sbjct: 14 KVCSFCVDKVQEIDYKDAAKLRKFITERGKILPRRISGTCAKHQRQLTIAIKRARNVALL 73

Query: 79 AYV 81
           + 
Sbjct: 74 PFT 76


>gi|160931686|ref|ZP_02079080.1| hypothetical protein CLOLEP_00517 [Clostridium leptum DSM 753]
 gi|156869331|gb|EDO62703.1| hypothetical protein CLOLEP_00517 [Clostridium leptum DSM 753]
          Length = 86

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 38/63 (60%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYKD+  L R++S+R KI+P R++    + QREL  AIKRAR+L L+ 
Sbjct: 23 VCGFCVDKVESIDYKDVARLRRYISERAKILPRRVTGTCARHQRELTVAIKRARHLALLP 82

Query: 80 YVN 82
          + +
Sbjct: 83 FSS 85


>gi|69246714|ref|ZP_00604082.1| Ribosomal protein S18 [Enterococcus faecium DO]
 gi|227550648|ref|ZP_03980697.1| ribosomal protein S18 [Enterococcus faecium TX1330]
 gi|257878654|ref|ZP_05658307.1| ribosomal protein S18 [Enterococcus faecium 1,230,933]
 gi|257881320|ref|ZP_05660973.1| ribosomal protein S18 [Enterococcus faecium 1,231,502]
 gi|257885595|ref|ZP_05665248.1| ribosomal protein S18 [Enterococcus faecium 1,231,501]
 gi|257888087|ref|ZP_05667740.1| ribosomal protein S18 [Enterococcus faecium 1,141,733]
 gi|257890537|ref|ZP_05670190.1| ribosomal protein S18 [Enterococcus faecium 1,231,410]
 gi|257893112|ref|ZP_05672765.1| ribosomal protein S18 [Enterococcus faecium 1,231,408]
 gi|257896295|ref|ZP_05675948.1| ribosomal protein S18 [Enterococcus faecium Com12]
 gi|257899279|ref|ZP_05678932.1| ribosomal protein S18 [Enterococcus faecium Com15]
 gi|258615262|ref|ZP_05713032.1| 30S ribosomal protein S18 [Enterococcus faecium DO]
 gi|260558235|ref|ZP_05830431.1| ribosomal protein S18 [Enterococcus faecium C68]
 gi|261206925|ref|ZP_05921614.1| ribosomal protein S18 [Enterococcus faecium TC 6]
 gi|289566498|ref|ZP_06446922.1| 30S ribosomal protein S18 [Enterococcus faecium D344SRF]
 gi|293379376|ref|ZP_06625520.1| ribosomal protein S18 [Enterococcus faecium PC4.1]
 gi|293557087|ref|ZP_06675645.1| ribosomal protein S18 [Enterococcus faecium E1039]
 gi|293563259|ref|ZP_06677711.1| ribosomal protein S18 [Enterococcus faecium E1162]
 gi|293569151|ref|ZP_06680457.1| ribosomal protein S18 [Enterococcus faecium E1071]
 gi|293572726|ref|ZP_06683690.1| ribosomal protein S18 [Enterococcus faecium E980]
 gi|294616651|ref|ZP_06696422.1| ribosomal protein S18 [Enterococcus faecium E1636]
 gi|294619753|ref|ZP_06699158.1| ribosomal protein S18 [Enterococcus faecium E1679]
 gi|294623767|ref|ZP_06702595.1| ribosomal protein S18 [Enterococcus faecium U0317]
 gi|314940123|ref|ZP_07847303.1| ribosomal protein S18 [Enterococcus faecium TX0133a04]
 gi|314943046|ref|ZP_07849850.1| ribosomal protein S18 [Enterococcus faecium TX0133C]
 gi|314948164|ref|ZP_07851560.1| ribosomal protein S18 [Enterococcus faecium TX0082]
 gi|314953422|ref|ZP_07856340.1| ribosomal protein S18 [Enterococcus faecium TX0133A]
 gi|314993839|ref|ZP_07859175.1| ribosomal protein S18 [Enterococcus faecium TX0133B]
 gi|314998136|ref|ZP_07863018.1| ribosomal protein S18 [Enterococcus faecium TX0133a01]
 gi|68195128|gb|EAN09587.1| Ribosomal protein S18 [Enterococcus faecium DO]
 gi|227180214|gb|EEI61186.1| ribosomal protein S18 [Enterococcus faecium TX1330]
 gi|257812882|gb|EEV41640.1| ribosomal protein S18 [Enterococcus faecium 1,230,933]
 gi|257816978|gb|EEV44306.1| ribosomal protein S18 [Enterococcus faecium 1,231,502]
 gi|257821451|gb|EEV48581.1| ribosomal protein S18 [Enterococcus faecium 1,231,501]
 gi|257824141|gb|EEV51073.1| ribosomal protein S18 [Enterococcus faecium 1,141,733]
 gi|257826897|gb|EEV53523.1| ribosomal protein S18 [Enterococcus faecium 1,231,410]
 gi|257829491|gb|EEV56098.1| ribosomal protein S18 [Enterococcus faecium 1,231,408]
 gi|257832860|gb|EEV59281.1| ribosomal protein S18 [Enterococcus faecium Com12]
 gi|257837191|gb|EEV62265.1| ribosomal protein S18 [Enterococcus faecium Com15]
 gi|260075409|gb|EEW63715.1| ribosomal protein S18 [Enterococcus faecium C68]
 gi|260078553|gb|EEW66255.1| ribosomal protein S18 [Enterococcus faecium TC 6]
 gi|289161707|gb|EFD09583.1| 30S ribosomal protein S18 [Enterococcus faecium D344SRF]
 gi|291588120|gb|EFF19962.1| ribosomal protein S18 [Enterococcus faecium E1071]
 gi|291590471|gb|EFF22209.1| ribosomal protein S18 [Enterococcus faecium E1636]
 gi|291594023|gb|EFF25492.1| ribosomal protein S18 [Enterococcus faecium E1679]
 gi|291596721|gb|EFF27944.1| ribosomal protein S18 [Enterococcus faecium U0317]
 gi|291600750|gb|EFF31044.1| ribosomal protein S18 [Enterococcus faecium E1039]
 gi|291604798|gb|EFF34280.1| ribosomal protein S18 [Enterococcus faecium E1162]
 gi|291607218|gb|EFF36576.1| ribosomal protein S18 [Enterococcus faecium E980]
 gi|292641899|gb|EFF60065.1| ribosomal protein S18 [Enterococcus faecium PC4.1]
 gi|313587848|gb|EFR66693.1| ribosomal protein S18 [Enterococcus faecium TX0133a01]
 gi|313591730|gb|EFR70575.1| ribosomal protein S18 [Enterococcus faecium TX0133B]
 gi|313594525|gb|EFR73370.1| ribosomal protein S18 [Enterococcus faecium TX0133A]
 gi|313598246|gb|EFR77091.1| ribosomal protein S18 [Enterococcus faecium TX0133C]
 gi|313640628|gb|EFS05208.1| ribosomal protein S18 [Enterococcus faecium TX0133a04]
 gi|313645418|gb|EFS09998.1| ribosomal protein S18 [Enterococcus faecium TX0082]
          Length = 78

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 42/63 (66%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
             ++      IDYKDI LL RF+S+RGKI+P R++    K QR++  AIKRAR +GL+ 
Sbjct: 14 VDYIAANHIEYIDYKDIELLKRFISERGKILPRRVTGTGAKNQRKITVAIKRARIMGLLP 73

Query: 80 YVN 82
          +V+
Sbjct: 74 FVS 76


>gi|15674171|ref|NP_268346.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis
          Il1403]
 gi|116513137|ref|YP_812044.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris
          SK11]
 gi|125625229|ref|YP_001033712.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris
          MG1363]
 gi|281492845|ref|YP_003354825.1| 50S ribosomal protein S18P [Lactococcus lactis subsp. lactis
          KF147]
 gi|13878750|sp|Q9CDN0|RS18_LACLA RecName: Full=30S ribosomal protein S18
 gi|122939895|sp|Q02VU1|RS18_LACLS RecName: Full=30S ribosomal protein S18
 gi|166220956|sp|A2RNZ2|RS18_LACLM RecName: Full=30S ribosomal protein S18
 gi|12725253|gb|AAK06287.1|AE006448_5 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis
          Il1403]
 gi|116108791|gb|ABJ73931.1| SSU ribosomal protein S18P [Lactococcus lactis subsp. cremoris
          SK11]
 gi|124494037|emb|CAL99037.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris
          MG1363]
 gi|281376497|gb|ADA65983.1| SSU ribosomal protein S18P [Lactococcus lactis subsp. lactis
          KF147]
 gi|300072039|gb|ADJ61439.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris
          NZ9000]
 gi|326407763|gb|ADZ64834.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis CV56]
          Length = 81

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 44/73 (60%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
            R     R+K   ++      +DYKD  LL RF+S+RGKI+P R++  S K QR++  A
Sbjct: 4  QRRGGFKRRKKVDFIAANKIEVVDYKDTELLKRFISERGKILPRRVTGTSAKNQRKVVNA 63

Query: 69 IKRARYLGLIAYV 81
          IKRAR + L+ +V
Sbjct: 64 IKRARVMALLPFV 76


>gi|312131694|ref|YP_003999034.1| ssu ribosomal protein s18p [Leadbetterella byssophila DSM 17132]
 gi|311908240|gb|ADQ18681.1| SSU ribosomal protein S18P [Leadbetterella byssophila DSM 17132]
          Length = 84

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 46/75 (61%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
             + R   +R+K C     G   +DYKD   L +FL+++GKI+P R++  S K QR +A
Sbjct: 5  NEPVERKEQNRKKYCRFKKLGIKYVDYKDPNFLLKFLNEQGKILPRRLTGNSLKFQRRVA 64

Query: 67 KAIKRARYLGLIAYV 81
           A+KRAR+L L+ YV
Sbjct: 65 IAVKRARHLALLPYV 79


>gi|210634873|ref|ZP_03298348.1| hypothetical protein COLSTE_02277 [Collinsella stercoris DSM
          13279]
 gi|210158588|gb|EEA89559.1| hypothetical protein COLSTE_02277 [Collinsella stercoris DSM
          13279]
          Length = 88

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             RRK C    +G   IDYKD +LL ++++ RGKI P R++    + Q ++A AIKRAR
Sbjct: 8  RQPRRKYCQFCKEGTEYIDYKDTQLLRKYMTDRGKIKPRRVTGACTQHQHDIANAIKRAR 67

Query: 74 YLGLIAY 80
           + L+ Y
Sbjct: 68 EMALLPY 74


>gi|85859721|ref|YP_461923.1| 30S ribosomal protein S18P [Syntrophus aciditrophicus SB]
 gi|123725273|sp|Q2LUJ7|RS18_SYNAS RecName: Full=30S ribosomal protein S18
 gi|85722812|gb|ABC77755.1| SSU ribosomal protein S18P [Syntrophus aciditrophicus SB]
          Length = 88

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 45/71 (63%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          R+   HRRK C        +IDYK   +L+ ++++RGKI+P RI+    K QREL +AIK
Sbjct: 13 RKKFFHRRKYCKFCSDSTIKIDYKRPDILHDYITERGKIMPRRITGSCSKHQRELTQAIK 72

Query: 71 RARYLGLIAYV 81
          RAR + L+ +V
Sbjct: 73 RARSIALLPFV 83


>gi|315925593|ref|ZP_07921803.1| 30S ribosomal protein S18 [Pseudoramibacter alactolyticus ATCC
          23263]
 gi|315621134|gb|EFV01105.1| 30S ribosomal protein S18 [Pseudoramibacter alactolyticus ATCC
          23263]
          Length = 74

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 41/71 (57%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    RRK C         +DYKDI  L +++S+RGKI+P R +    K QR++ +A+
Sbjct: 1  MPRPFRRRRKVCEFCEHEDMVVDYKDIATLKKYISERGKILPRRATGACAKHQRKITQAV 60

Query: 70 KRARYLGLIAY 80
           RAR + L+ Y
Sbjct: 61 NRARNMALLPY 71


>gi|227432792|ref|ZP_03914755.1| SSU ribosomal protein S18P [Leuconostoc mesenteroides subsp.
          cremoris ATCC 19254]
 gi|227351461|gb|EEJ41724.1| SSU ribosomal protein S18P [Leuconostoc mesenteroides subsp.
          cremoris ATCC 19254]
          Length = 94

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/64 (43%), Positives = 41/64 (64%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYK+  LL RF+S+RGKI+P R++  S K QR++  AIKRAR + L+
Sbjct: 29 KVDFIAANHIEYIDYKNTELLERFISERGKILPRRLTGTSAKNQRKVTTAIKRARIMALL 88

Query: 79 AYVN 82
           +V 
Sbjct: 89 PFVT 92


>gi|332654781|ref|ZP_08420523.1| ribosomal protein S18 [Ruminococcaceae bacterium D16]
 gi|332516124|gb|EGJ45732.1| ribosomal protein S18 [Ruminococcaceae bacterium D16]
          Length = 79

 Score = 94.3 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 38/70 (54%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C         IDYKD   L R+ S+RGKI+P R +      QR+L +AIKRA
Sbjct: 9  RGRKRRKVCAFCVDKVECIDYKDAAKLRRYTSERGKILPRRTTGTCAMHQRQLTEAIKRA 68

Query: 73 RYLGLIAYVN 82
          R + L+ YV 
Sbjct: 69 RQVALLPYVT 78


>gi|116332690|ref|YP_794217.1| ribosomal protein S18 [Lactobacillus brevis ATCC 367]
 gi|122270614|sp|Q03UD6|RS18_LACBA RecName: Full=30S ribosomal protein S18
 gi|116098037|gb|ABJ63186.1| SSU ribosomal protein S18P [Lactobacillus brevis ATCC 367]
          Length = 78

 Score = 94.3 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 30/64 (46%), Positives = 43/64 (67%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYKD  LL RF+S+RGKI+P R++  S K QR+L  AIKR+R +GL+
Sbjct: 13 KVDFIAANHIEYIDYKDTDLLRRFISERGKILPRRVTGTSAKNQRKLTIAIKRSRIMGLM 72

Query: 79 AYVN 82
           +V+
Sbjct: 73 PFVS 76


>gi|116515284|ref|YP_802913.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Cc (Cinara
          cedri)]
 gi|122285320|sp|Q056X9|RS18_BUCCC RecName: Full=30S ribosomal protein S18
 gi|116257138|gb|ABJ90820.1| 30S ribosomal protein S18 [Buchnera aphidicola str. Cc (Cinara
          cedri)]
          Length = 75

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 47/70 (67%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G  +IDYKDI +L  ++++ GKIVPSRI+    K QR+L++AIK A
Sbjct: 3  RYFRRRKFCRFTAEGIKKIDYKDIMILKNYITENGKIVPSRITGTKAKYQRQLSRAIKIA 62

Query: 73 RYLGLIAYVN 82
          R+LG I Y +
Sbjct: 63 RFLGFIPYTD 72


>gi|307244733|ref|ZP_07526835.1| ribosomal protein S18 [Peptostreptococcus stomatis DSM 17678]
 gi|306491910|gb|EFM63961.1| ribosomal protein S18 [Peptostreptococcus stomatis DSM 17678]
          Length = 75

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 40/62 (64%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C      + +IDYK+++ L +++++RGKI+P RI+    K QRE+ KAIK AR + L+ 
Sbjct: 12 VCQFCADKSTKIDYKNVQKLEKYVTERGKILPRRITGTCAKHQREVTKAIKLARNVALLP 71

Query: 80 YV 81
          Y 
Sbjct: 72 YT 73


>gi|218778773|ref|YP_002430091.1| 30S ribosomal protein S18 [Desulfatibacillum alkenivorans AK-01]
 gi|218760157|gb|ACL02623.1| ribosomal protein S18 [Desulfatibacillum alkenivorans AK-01]
          Length = 82

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 35/62 (56%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         I+YKD R L  F ++RGKIVP RIS    K QR L  AIKRAR + L+ 
Sbjct: 15 VCRFCADKTLEINYKDPRTLKYFTTERGKIVPRRISGTCAKHQRALTTAIKRARAIALMP 74

Query: 80 YV 81
          +V
Sbjct: 75 FV 76


>gi|73541692|ref|YP_296212.1| 30S ribosomal protein S18 [Ralstonia eutropha JMP134]
 gi|123774065|sp|Q46ZR5|RS181_RALEJ RecName: Full=30S ribosomal protein S18 1
 gi|72119105|gb|AAZ61368.1| SSU ribosomal protein S18P [Ralstonia eutropha JMP134]
          Length = 92

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 28/73 (38%), Positives = 43/73 (58%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +  +  R++ C  +  G  +IDYKD+  L  F+   GKI P+R++      QR+L  AIK
Sbjct: 17 QNPLFKRKRFCRFTVAGVEQIDYKDLDTLKDFIGDNGKITPARLTGTKAHYQRQLDTAIK 76

Query: 71 RARYLGLIAYVNL 83
          RAR+L L+ Y +L
Sbjct: 77 RARFLALMPYTDL 89


>gi|294084212|ref|YP_003550970.1| 30S ribosomal protein S18 [Candidatus Puniceispirillum marinum
          IMCC1322]
 gi|292663785|gb|ADE38886.1| ribosomal protein S18 [Candidatus Puniceispirillum marinum
          IMCC1322]
          Length = 84

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 59/76 (77%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
              LR+  + RRKSCP SG  AP+IDYKD +LL R+ S+RGKI+PSRIS+VS KKQREL
Sbjct: 7  KREALRKPFNRRRKSCPFSGANAPKIDYKDTKLLARYTSERGKIIPSRISAVSAKKQREL 66

Query: 66 AKAIKRARYLGLIAYV 81
          A AIKR+R+L L+ YV
Sbjct: 67 ATAIKRSRFLALMPYV 82


>gi|108803692|ref|YP_643629.1| 30S ribosomal protein S18P [Rubrobacter xylanophilus DSM 9941]
 gi|122976088|sp|Q1AXR1|RS18_RUBXD RecName: Full=30S ribosomal protein S18
 gi|108764935|gb|ABG03817.1| SSU ribosomal protein S18P [Rubrobacter xylanophilus DSM 9941]
          Length = 81

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 44/78 (56%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A         S ++K C    +    +DYKD  +L RF S+RGKI   R++ +  + QR
Sbjct: 1  MAKKKGGATTRSGKKKVCVFCKENIEYVDYKDYNMLRRFTSERGKIRARRVTGLCPQHQR 60

Query: 64 ELAKAIKRARYLGLIAYV 81
          E A+AIKRAR + L+ Y+
Sbjct: 61 ETARAIKRAREMALLPYI 78


>gi|313888625|ref|ZP_07822290.1| ribosomal protein S18 [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845354|gb|EFR32750.1| ribosomal protein S18 [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 74

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 44/71 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++R    R+K  P       +IDYKD+  L  ++S RGKI+P RI+ ++ K QRE+  AI
Sbjct: 1  MQRRFGRRKKVDPFEKDKTKKIDYKDVETLRNYISDRGKILPRRITGLNAKHQREMTVAI 60

Query: 70 KRARYLGLIAY 80
          KRAR + L+ Y
Sbjct: 61 KRARQIALLPY 71


>gi|238925607|ref|YP_002939124.1| 30S ribosomal protein S18 [Eubacterium rectale ATCC 33656]
 gi|238877283|gb|ACR76990.1| 30S ribosomal protein S18 [Eubacterium rectale ATCC 33656]
 gi|291524157|emb|CBK89744.1| SSU ribosomal protein S18P [Eubacterium rectale DSM 17629]
 gi|291527800|emb|CBK93386.1| SSU ribosomal protein S18P [Eubacterium rectale M104/1]
          Length = 85

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C   G     IDYKD   L R++S+RGKI+P RI+    K QR L  AIKRAR+L L+ 
Sbjct: 23 VCVFCG-KDNVIDYKDTNKLKRYISERGKILPRRITGNCAKHQRALTVAIKRARHLALMP 81

Query: 80 YV 81
          YV
Sbjct: 82 YV 83


>gi|110003930|emb|CAK98270.1| 30s ribosomal protein s18 [Spiroplasma citri]
          Length = 74

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 42/72 (58%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          +       +K C  +      IDYKD+ LL +F+S  G+I+P R++  + K QR LA AI
Sbjct: 1  MNPKFKRFKKQCYFTKNKITYIDYKDVELLKKFISGNGQILPKRVTGTTAKNQRMLATAI 60

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ +V
Sbjct: 61 KRARQMALLPFV 72


>gi|120609917|ref|YP_969595.1| 30S ribosomal protein S18 [Acidovorax citrulli AAC00-1]
 gi|319763794|ref|YP_004127731.1| ribosomal protein s18 [Alicycliphilus denitrificans BC]
 gi|326316064|ref|YP_004233736.1| 30S ribosomal protein S18 [Acidovorax avenae subsp. avenae ATCC
          19860]
 gi|330823942|ref|YP_004387245.1| 30S ribosomal protein S18 [Alicycliphilus denitrificans K601]
 gi|166220916|sp|A1TLI3|RS18_ACIAC RecName: Full=30S ribosomal protein S18
 gi|120588381|gb|ABM31821.1| SSU ribosomal protein S18P [Acidovorax citrulli AAC00-1]
 gi|317118355|gb|ADV00844.1| ribosomal protein S18 [Alicycliphilus denitrificans BC]
 gi|323372900|gb|ADX45169.1| 30S ribosomal protein S18 [Acidovorax avenae subsp. avenae ATCC
          19860]
 gi|329309314|gb|AEB83729.1| 30S ribosomal protein S18 [Alicycliphilus denitrificans K601]
          Length = 93

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (57%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R++ C  +  G   IDYKD+  L  F+++ GKI+P+R++      Q
Sbjct: 10 DKRPKRNTQSLLFKRKRFCRFTVAGVEEIDYKDVDTLRDFIAENGKIIPARLTGTRAIYQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 70 RQLNTAIKRARFLALVPYSD 89


>gi|184154485|ref|YP_001842825.1| 30S ribosomal protein S18 [Lactobacillus fermentum IFO 3956]
 gi|227514127|ref|ZP_03944176.1| ribosomal protein S18 [Lactobacillus fermentum ATCC 14931]
 gi|256848498|ref|ZP_05553940.1| ribosomal protein S18 [Lactobacillus coleohominis 101-4-CHN]
 gi|260662546|ref|ZP_05863441.1| 30S ribosomal protein S18 [Lactobacillus fermentum 28-3-CHN]
 gi|229560042|sp|B2GEV6|RS18_LACF3 RecName: Full=30S ribosomal protein S18
 gi|183225829|dbj|BAG26345.1| 30S ribosomal protein S18 [Lactobacillus fermentum IFO 3956]
 gi|227087498|gb|EEI22810.1| ribosomal protein S18 [Lactobacillus fermentum ATCC 14931]
 gi|256714765|gb|EEU29744.1| ribosomal protein S18 [Lactobacillus coleohominis 101-4-CHN]
 gi|260553237|gb|EEX26180.1| 30S ribosomal protein S18 [Lactobacillus fermentum 28-3-CHN]
          Length = 78

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 41/63 (65%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR +GL+
Sbjct: 13 KVDFIAANHIEYIDYKDTDLLRRFISERGKILPRRVTGTSAKNQRRLTIAIKRARIMGLL 72

Query: 79 AYV 81
           +V
Sbjct: 73 PFV 75


>gi|116750608|ref|YP_847295.1| 30S ribosomal protein S18 [Syntrophobacter fumaroxidans MPOB]
 gi|205618953|sp|A0LN58|RS18_SYNFM RecName: Full=30S ribosomal protein S18
 gi|116699672|gb|ABK18860.1| SSU ribosomal protein S18P [Syntrophobacter fumaroxidans MPOB]
          Length = 81

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 39/65 (60%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C        +IDYKD + L  F+++RGKIVP RIS    K QREL  A+KRAR + L+
Sbjct: 14 KVCRFCVDSELKIDYKDSKTLRYFVTERGKIVPRRISGNCAKHQRELTLAVKRARQIALL 73

Query: 79 AYVNL 83
           +  +
Sbjct: 74 PHTTI 78


>gi|323698324|ref|ZP_08110236.1| ribosomal protein S18 [Desulfovibrio sp. ND132]
 gi|323458256|gb|EGB14121.1| ribosomal protein S18 [Desulfovibrio desulfuricans ND132]
          Length = 87

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 39/74 (52%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R+  + R+K C         +DYK   +L  F+++RGKI+  RI+    K QR L   I
Sbjct: 3  FRKKFTPRKKFCRFCADAELPLDYKRPDILRDFVTERGKIIARRITGTCAKHQRRLTNEI 62

Query: 70 KRARYLGLIAYVNL 83
          KRAR + L+ Y  +
Sbjct: 63 KRARQMALLFYTTV 76


>gi|302393056|ref|YP_003828876.1| 30S ribosomal protein S18P [Acetohalobium arabaticum DSM 5501]
 gi|302205133|gb|ADL13811.1| SSU ribosomal protein S18P [Acetohalobium arabaticum DSM 5501]
          Length = 71

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/64 (46%), Positives = 41/64 (64%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          RKSC         IDYK++  L+++L+ RGKIVP RIS    + QR+L KAIKRAR + L
Sbjct: 6  RKSCEFCANKIDHIDYKEVNKLDKYLTDRGKIVPRRISGNCARHQRQLTKAIKRARSIAL 65

Query: 78 IAYV 81
          + + 
Sbjct: 66 LPFT 69


>gi|332665254|ref|YP_004448042.1| 30S ribosomal protein S18 [Haliscomenobacter hydrossis DSM 1100]
 gi|332334068|gb|AEE51169.1| 30S ribosomal protein S18 [Haliscomenobacter hydrossis DSM 1100]
          Length = 88

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 34/83 (40%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 1  MAEVAPTPLLRRNV--SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVS 58
          MA       L       +R+K C     G   IDYKD   L +F++++GKI+P RI+  S
Sbjct: 1  MANKDDIKFLSNPKIGQNRKKYCRFRKFGIKYIDYKDGDFLLQFINEQGKILPRRITGNS 60

Query: 59 HKKQRELAKAIKRARYLGLIAYV 81
           K QR++A A+KRAR+L L+ YV
Sbjct: 61 LKYQRKVATAVKRARHLALLPYV 83


>gi|257866284|ref|ZP_05645937.1| ribosomal protein S18 [Enterococcus casseliflavus EC30]
 gi|257873200|ref|ZP_05652853.1| ribosomal protein S18 [Enterococcus casseliflavus EC10]
 gi|257875901|ref|ZP_05655554.1| ribosomal protein S18 [Enterococcus casseliflavus EC20]
 gi|325567633|ref|ZP_08144300.1| 30S ribosomal protein S18 [Enterococcus casseliflavus ATCC 12755]
 gi|257800242|gb|EEV29270.1| ribosomal protein S18 [Enterococcus casseliflavus EC30]
 gi|257807364|gb|EEV36186.1| ribosomal protein S18 [Enterococcus casseliflavus EC10]
 gi|257810067|gb|EEV38887.1| ribosomal protein S18 [Enterococcus casseliflavus EC20]
 gi|325159066|gb|EGC71212.1| 30S ribosomal protein S18 [Enterococcus casseliflavus ATCC 12755]
          Length = 78

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
             ++      IDYKDI LL RF+S+RGKI+P R++    K QR+L  AIKRAR +GL+ 
Sbjct: 14 VDYIAANHIEHIDYKDIELLKRFISERGKILPRRVTGTGAKNQRKLTIAIKRARIMGLLP 73

Query: 80 YV 81
          +V
Sbjct: 74 FV 75


>gi|326799756|ref|YP_004317575.1| 30S ribosomal protein S18 [Sphingobacterium sp. 21]
 gi|326550520|gb|ADZ78905.1| 30S ribosomal protein S18 [Sphingobacterium sp. 21]
          Length = 87

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 46/67 (68%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R+K C     G   IDYKD   L +F++ +GKI+P R++  S K QR++A+A+KRAR++
Sbjct: 17 NRKKYCRFKKNGIKYIDYKDANFLLKFVNDQGKILPRRLTGTSLKFQRKVAQAVKRARHI 76

Query: 76 GLIAYVN 82
          GL+ YV 
Sbjct: 77 GLLPYVT 83


>gi|296271508|ref|YP_003654140.1| 30S ribosomal protein S18 [Thermobispora bispora DSM 43833]
 gi|296094295|gb|ADG90247.1| ribosomal protein S18 [Thermobispora bispora DSM 43833]
          Length = 78

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 39/69 (56%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             ++K C    +    +DYKD  LL +F+S RGKI   R++    + QR++A AIK AR
Sbjct: 7  RKPKKKVCLFCHEKISYVDYKDTALLRKFISDRGKIRARRVTGNCTQHQRDVATAIKNAR 66

Query: 74 YLGLIAYVN 82
           + L+ Y +
Sbjct: 67 EMALLPYTS 75


>gi|126701289|ref|YP_001090186.1| 30S ribosomal protein S18 [Clostridium difficile 630]
 gi|254977322|ref|ZP_05273794.1| 30S ribosomal protein S18 [Clostridium difficile QCD-66c26]
 gi|255094653|ref|ZP_05324131.1| 30S ribosomal protein S18 [Clostridium difficile CIP 107932]
 gi|255102879|ref|ZP_05331856.1| 30S ribosomal protein S18 [Clostridium difficile QCD-63q42]
 gi|255308699|ref|ZP_05352870.1| 30S ribosomal protein S18 [Clostridium difficile ATCC 43255]
 gi|255316406|ref|ZP_05357989.1| 30S ribosomal protein S18 [Clostridium difficile QCD-76w55]
 gi|255519065|ref|ZP_05386741.1| 30S ribosomal protein S18 [Clostridium difficile QCD-97b34]
 gi|255652249|ref|ZP_05399151.1| 30S ribosomal protein S18 [Clostridium difficile QCD-37x79]
 gi|255657618|ref|ZP_05403027.1| 30S ribosomal protein S18 [Clostridium difficile QCD-23m63]
 gi|260685203|ref|YP_003216488.1| 30S ribosomal protein S18 [Clostridium difficile CD196]
 gi|260688862|ref|YP_003219996.1| 30S ribosomal protein S18 [Clostridium difficile R20291]
 gi|296452701|ref|ZP_06894392.1| 30S ribosomal protein S18 [Clostridium difficile NAP08]
 gi|296880045|ref|ZP_06904015.1| 30S ribosomal protein S18 [Clostridium difficile NAP07]
 gi|306521964|ref|ZP_07408311.1| 30S ribosomal protein S18 [Clostridium difficile QCD-32g58]
 gi|122973570|sp|Q181R4|RS18_CLOD6 RecName: Full=30S ribosomal protein S18
 gi|115252726|emb|CAJ70570.1| 30S ribosomal protein S18 [Clostridium difficile]
 gi|260211366|emb|CBA67007.1| 30S ribosomal protein S18 [Clostridium difficile CD196]
 gi|260214879|emb|CBE07674.1| 30S ribosomal protein S18 [Clostridium difficile R20291]
 gi|296258483|gb|EFH05387.1| 30S ribosomal protein S18 [Clostridium difficile NAP08]
 gi|296429022|gb|EFH14899.1| 30S ribosomal protein S18 [Clostridium difficile NAP07]
          Length = 75

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 43/73 (58%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          ++ +    +++ C        +IDYK  + L +++++RGKI+P RIS    K QREL  A
Sbjct: 1  MMNKKRRKKKRVCQFCADKNAKIDYKSTQRLQKYITERGKILPRRISGTCAKHQRELTVA 60

Query: 69 IKRARYLGLIAYV 81
          IKRAR + L+ Y 
Sbjct: 61 IKRARNIALLPYT 73


>gi|104773266|ref|YP_618246.1| 30S ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus ATCC 11842]
 gi|123252027|sp|Q1GC35|RS18_LACDA RecName: Full=30S ribosomal protein S18
 gi|103422347|emb|CAI96855.1| 30S ribosomal protein S18 [Lactobacillus delbrueckii subsp.
          bulgaricus ATCC 11842]
          Length = 78

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 27/62 (43%), Positives = 41/62 (66%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
             ++      +DYKD+ LL  F+S+RGKI+P  ++  S K QR++A AIKRAR +GL+ 
Sbjct: 14 VDLIAANHIDYVDYKDVDLLKHFISERGKILPRSVTGTSAKNQRKVANAIKRARIMGLLP 73

Query: 80 YV 81
          +V
Sbjct: 74 FV 75


>gi|300172598|ref|YP_003771763.1| 30S ribosomal protein S18 [Leuconostoc gasicomitatum LMG 18811]
 gi|299886976|emb|CBL90944.1| 30S ribosomal protein S18 [Leuconostoc gasicomitatum LMG 18811]
          Length = 94

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 28/64 (43%), Positives = 41/64 (64%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYK+  LL RF+S+RGKI+P R++  S K QR++  AIKRAR + L+
Sbjct: 29 KVDFIAANHIEHIDYKNTELLERFISERGKILPRRVTGTSAKNQRKVTIAIKRARIMALL 88

Query: 79 AYVN 82
           +V 
Sbjct: 89 PFVT 92


>gi|262279563|ref|ZP_06057348.1| 30S ribosomal protein S18 [Acinetobacter calcoaceticus RUH2202]
 gi|262259914|gb|EEY78647.1| 30S ribosomal protein S18 [Acinetobacter calcoaceticus RUH2202]
          Length = 75

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI  L +++++ GKIVPSRI+    + QR+LA AIK+A
Sbjct: 3  RFYRRRKFCRFTAENVVYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQA 62

Query: 73 RYLGLIAYVN 82
          RYL LIAY +
Sbjct: 63 RYLSLIAYTD 72


>gi|108761622|ref|YP_633233.1| 30S ribosomal protein S18 [Myxococcus xanthus DK 1622]
 gi|123074131|sp|Q1D290|RS18_MYXXD RecName: Full=30S ribosomal protein S18
 gi|108465502|gb|ABF90687.1| ribosomal protein S18 [Myxococcus xanthus DK 1622]
          Length = 131

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 37/61 (60%)

Query: 20  SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
            C    +    +D+KD   L  F+++RGKI+P RIS    K QRE+A AIKRAR + L+ 
Sbjct: 66  VCRFCAEKNASVDFKDQATLKYFVTERGKIIPRRISGNCAKHQREVAVAIKRARGIALLP 125

Query: 80  Y 80
           Y
Sbjct: 126 Y 126


>gi|255020465|ref|ZP_05292530.1| SSU ribosomal protein S18p [Acidithiobacillus caldus ATCC 51756]
 gi|254970075|gb|EET27572.1| SSU ribosomal protein S18p [Acidithiobacillus caldus ATCC 51756]
          Length = 92

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 42/63 (66%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C    +G   IDYKD++ L  F+ + GKIVPSRI+  S   QR+LA AIKRAR+L L+
Sbjct: 28 KFCRFKAEGVKEIDYKDLKTLQAFIGETGKIVPSRITGTSTLYQRQLATAIKRARFLALL 87

Query: 79 AYV 81
           YV
Sbjct: 88 PYV 90


>gi|114773242|ref|ZP_01450477.1| 30S ribosomal subunit protein S18 [alpha proteobacterium
          HTCC2255]
 gi|114546361|gb|EAU49270.1| 30S ribosomal subunit protein S18 [alpha proteobacterium
          HTCC2255]
          Length = 75

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/59 (50%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          S +G   IDYKD   L  ++++ GKIVPSRI+  S K QR+L+ AIKRAR+L L+ Y +
Sbjct: 14 SAEGVVEIDYKDTATLRNYVTESGKIVPSRITGTSAKYQRQLSTAIKRARFLALLPYTD 72


>gi|302343161|ref|YP_003807690.1| ribosomal protein S18 [Desulfarculus baarsii DSM 2075]
 gi|301639774|gb|ADK85096.1| ribosomal protein S18 [Desulfarculus baarsii DSM 2075]
          Length = 78

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 42/70 (60%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++    RRK C        +IDYKD R L  F ++RGKI+P RIS    K QREL  AIK
Sbjct: 4  KKRRFGRRKVCRFCADTTIKIDYKDPRTLRYFTTERGKIIPRRISGCCAKHQRELTLAIK 63

Query: 71 RARYLGLIAY 80
          R+R++ L+ +
Sbjct: 64 RSRHIALLPF 73


>gi|147679225|ref|YP_001213440.1| 30S ribosomal protein S18 [Pelotomaculum thermopropionicum SI]
 gi|205616629|sp|A5CY50|RS18_PELTS RecName: Full=30S ribosomal protein S18
 gi|146275322|dbj|BAF61071.1| ribosomal protein S18 [Pelotomaculum thermopropionicum SI]
          Length = 76

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 42/72 (58%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
            +    +++ C      A  +DYKD++ L +++++RGKI+P RIS    K QR L  AI
Sbjct: 3  REKGRRGKKRICNFCVDKAEVVDYKDVQRLKKYITERGKILPRRISGNCAKHQRLLTTAI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ + 
Sbjct: 63 KRARNIALLPFT 74


>gi|295698471|ref|YP_003603126.1| ribosomal protein S18 [Candidatus Riesia pediculicola USDA]
 gi|291157471|gb|ADD79916.1| ribosomal protein S18 [Candidatus Riesia pediculicola USDA]
          Length = 76

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 48/73 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++ N   R+K C  + + A  IDYKDI  L  ++++ GKIVPSRI+    K QR+L++AI
Sbjct: 1  MKHNFFRRKKFCRFTAEKAREIDYKDIEKLRNYITESGKIVPSRITGTKVKYQRKLSRAI 60

Query: 70 KRARYLGLIAYVN 82
          K ARYL L+ Y +
Sbjct: 61 KIARYLALLPYTD 73


>gi|255263624|ref|ZP_05342966.1| ribosomal protein S18 [Thalassiobium sp. R2A62]
 gi|255105959|gb|EET48633.1| ribosomal protein S18 [Thalassiobium sp. R2A62]
          Length = 75

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 54/72 (75%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRKS P  G+ AP+IDYKD RLL R++S+RGKIVPSRI++V  K QR LA+A
Sbjct: 1  MATKPFFRRRKSDPFEGENAPKIDYKDTRLLQRYISERGKIVPSRITAVGAKNQRALARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|89054112|ref|YP_509563.1| 30S ribosomal protein S18 [Jannaschia sp. CCS1]
 gi|123286752|sp|Q28RX4|RS18_JANSC RecName: Full=30S ribosomal protein S18
 gi|88863661|gb|ABD54538.1| SSU ribosomal protein S18P [Jannaschia sp. CCS1]
          Length = 75

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 42/72 (58%), Positives = 54/72 (75%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK+ P  G+ AP+IDYKD RLL R++S+RGKIVPSRI++V  K QR LAKA
Sbjct: 1  MAAKPFFRRRKTDPFEGENAPKIDYKDTRLLQRYISERGKIVPSRITAVGAKNQRALAKA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|114568043|ref|YP_755197.1| 30S ribosomal protein S18 [Syntrophomonas wolfei subsp. wolfei
          str. Goettingen]
 gi|114338978|gb|ABI69826.1| SSU ribosomal protein S18P [Syntrophomonas wolfei subsp. wolfei
          str. Goettingen]
          Length = 74

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         +DYK+I  L R++++RGKI+P RI+      QR+L  AIKRAR + L+ Y
Sbjct: 12 CNWCADKIEVVDYKEIPRLRRYITERGKILPRRITGNCAHHQRQLTVAIKRARIMALLPY 71

Query: 81 VN 82
           +
Sbjct: 72 TS 73


>gi|295425406|ref|ZP_06818104.1| 30S ribosomal protein S18 [Lactobacillus amylolyticus DSM 11664]
 gi|295064908|gb|EFG55818.1| 30S ribosomal protein S18 [Lactobacillus amylolyticus DSM 11664]
          Length = 77

 Score = 93.9 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 45/63 (71%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      +DYKD+ LL RF+S+RGKI+P R++  S K QR++AKAIKRAR +GL+
Sbjct: 12 KVDYIAANHINYVDYKDVDLLKRFISERGKILPRRVTGTSAKNQRKVAKAIKRARIMGLL 71

Query: 79 AYV 81
           +V
Sbjct: 72 PFV 74


>gi|209885493|ref|YP_002289350.1| ribosomal protein S18 [Oligotropha carboxidovorans OM5]
 gi|229560048|sp|B6JGW4|RS18_OLICO RecName: Full=30S ribosomal protein S18
 gi|209873689|gb|ACI93485.1| ribosomal protein S18 [Oligotropha carboxidovorans OM5]
          Length = 79

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 46/71 (64%), Positives = 59/71 (83%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+ID+KD +LL R++S+RGKIVPSRI++VS  KQRELA+AIK
Sbjct: 7  RRPFFRRRKTCPFTGSNAPKIDFKDSKLLMRYVSERGKIVPSRITAVSALKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|89068231|ref|ZP_01155641.1| 30S ribosomal protein S18 [Oceanicola granulosus HTCC2516]
 gi|89046148|gb|EAR52206.1| 30S ribosomal protein S18 [Oceanicola granulosus HTCC2516]
          Length = 75

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 40/72 (55%), Positives = 54/72 (75%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRK+ P  G+ AP+IDYKD R L R++S+RGKIVPSRI++V  K QR+LA+A
Sbjct: 1  MAAKPFFRRRKTDPFEGENAPKIDYKDTRTLQRYVSERGKIVPSRITAVGSKNQRQLAQA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|188587503|ref|YP_001919048.1| SSU ribosomal protein S18P [Natranaerobius thermophilus
          JW/NM-WN-LF]
 gi|205558577|sp|B2A454|RS18_NATTJ RecName: Full=30S ribosomal protein S18
 gi|179352190|gb|ACB86460.1| SSU ribosomal protein S18P [Natranaerobius thermophilus
          JW/NM-WN-LF]
          Length = 74

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 39/69 (56%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              R K C    +    + YKD+  L +++++RGKI+P RI+    K QR+L  AIK+A
Sbjct: 3  RRRRRNKVCSFCAEKTTTVSYKDLDRLKKYITERGKILPRRINGNCAKHQRQLTTAIKKA 62

Query: 73 RYLGLIAYV 81
          R L L+ Y 
Sbjct: 63 RQLALLPYT 71


>gi|302390766|ref|YP_003826587.1| SSU ribosomal protein S18P [Thermosediminibacter oceani DSM
          16646]
 gi|302201394|gb|ADL08964.1| SSU ribosomal protein S18P [Thermosediminibacter oceani DSM
          16646]
          Length = 74

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 37/63 (58%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYKD+  L +F+++R KI+P RI+    + QR+L  AIKRAR + L+ 
Sbjct: 11 VCSFCMDKIDYIDYKDVARLRKFITERAKILPRRITGNCARHQRQLTVAIKRARNIALLP 70

Query: 80 YVN 82
          + +
Sbjct: 71 FTS 73


>gi|258647410|ref|ZP_05734879.1| ribosomal protein S18 [Prevotella tannerae ATCC 51259]
 gi|260852778|gb|EEX72647.1| ribosomal protein S18 [Prevotella tannerae ATCC 51259]
          Length = 88

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 43/67 (64%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           R+K C     G   IDYKD   L +FL+++GKI+P R++  S K QR +A+A+KRAR L
Sbjct: 18 KRKKYCRFKKSGIKYIDYKDPEFLKKFLNEQGKILPRRLTGTSLKYQRRVAQAVKRARQL 77

Query: 76 GLIAYVN 82
           L+ +V 
Sbjct: 78 ALLPFVT 84


>gi|167462797|ref|ZP_02327886.1| 30S ribosomal protein S18 (BS21) [Paenibacillus larvae subsp.
          larvae BRL-230010]
 gi|322381355|ref|ZP_08055358.1| 30S ribosomal protein S18-like protein [Paenibacillus larvae
          subsp. larvae B-3650]
 gi|321154931|gb|EFX47202.1| 30S ribosomal protein S18-like protein [Paenibacillus larvae
          subsp. larvae B-3650]
          Length = 100

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 42/75 (56%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P        RRK C  +      IDYKDI  L +F+S+RGKI+P R++  S K QR L  
Sbjct: 25 PRRGGKGGKRRKVCYFTANKIKHIDYKDIDTLKKFISERGKILPRRVTGTSAKYQRMLTI 84

Query: 68 AIKRARYLGLIAYVN 82
          AIKRAR + L+ Y  
Sbjct: 85 AIKRARQVALLPYTT 99


>gi|313902809|ref|ZP_07836206.1| SSU ribosomal protein S18P [Thermaerobacter subterraneus DSM
          13965]
 gi|313466929|gb|EFR62446.1| SSU ribosomal protein S18P [Thermaerobacter subterraneus DSM
          13965]
          Length = 75

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 36/62 (58%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         +DYKD   L +FL++RGKI+P RI+      QR+L +AIKRAR + L+ 
Sbjct: 12 VCEFCVNRIAVVDYKDSARLRKFLTERGKILPRRITGNCAGHQRQLTRAIKRARIMALLP 71

Query: 80 YV 81
          + 
Sbjct: 72 FT 73


>gi|331700406|ref|YP_004397365.1| 30S ribosomal protein S18 [Lactobacillus buchneri NRRL B-30929]
 gi|329127749|gb|AEB72302.1| 30S ribosomal protein S18 [Lactobacillus buchneri NRRL B-30929]
          Length = 79

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 32/63 (50%), Positives = 42/63 (66%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYKDI LL RF+S+RGKI+P R++  S K QR L  AIKRAR +GL+
Sbjct: 14 KVDFIAANHIEYIDYKDIDLLKRFVSERGKILPRRVTGTSAKNQRALTIAIKRARIMGLM 73

Query: 79 AYV 81
           +V
Sbjct: 74 PFV 76


>gi|160881890|ref|YP_001560858.1| 30S ribosomal protein S18 [Clostridium phytofermentans ISDg]
 gi|160430556|gb|ABX44119.1| ribosomal protein S18 [Clostridium phytofermentans ISDg]
          Length = 91

 Score = 93.9 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGA-PRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          +    P+ RR    R+K C          IDYKD+  L R++S+RGKI+P RI+    K 
Sbjct: 10 DKGDAPMKRRMTRRRKKVCAFCADKNHKEIDYKDVNKLKRYVSERGKILPRRITGNCAKH 69

Query: 62 QRELAKAIKRARYLGLIAYV 81
          QR L  A+KRAR++ L+ Y 
Sbjct: 70 QRALTVAVKRARHIALMPYT 89


>gi|295106369|emb|CBL03912.1| SSU ribosomal protein S18P [Gordonibacter pamelaeae 7-10-1-b]
          Length = 86

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 8/80 (10%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M++ A  P        RRK C      A  +DYKD ++L ++++ RGKI P R++    +
Sbjct: 1  MSDYAKQP--------RRKFCQFCKDEANYVDYKDTQMLRKYVTDRGKIKPRRVTGACTQ 52

Query: 61 KQRELAKAIKRARYLGLIAY 80
           QR++A A+KRAR + L+ Y
Sbjct: 53 HQRDIANAVKRAREMALMPY 72


>gi|325479860|gb|EGC82945.1| ribosomal protein S18 [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 75

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 45/72 (62%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  R    R+K  P     +  IDYKDI  L RF++ RGKI+P R++ ++ K QRE+ +A
Sbjct: 1  MAGRRFRPRKKVDPFVKDPSKVIDYKDIETLKRFVTDRGKILPRRVTGLNAKHQREVTRA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR + L+ Y
Sbjct: 61 IKRARQVALLPY 72


>gi|206895301|ref|YP_002246973.1| ribosomal protein S18 [Coprothermobacter proteolyticus DSM 5265]
 gi|229559979|sp|B5Y876|RS18_COPPD RecName: Full=30S ribosomal protein S18
 gi|206737918|gb|ACI16996.1| ribosomal protein S18 [Coprothermobacter proteolyticus DSM 5265]
          Length = 74

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 33/68 (48%), Positives = 42/68 (61%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             R K CPL   G   +DYKD+  L RF S RGKI+P R++ V    QR L++AIKRAR
Sbjct: 5  RKRRIKLCPLCADGVREVDYKDVNRLRRFTSDRGKILPRRVTGVCAFHQRSLSRAIKRAR 64

Query: 74 YLGLIAYV 81
           + L+ YV
Sbjct: 65 EMALLPYV 72


>gi|116491827|ref|YP_803562.1| SSU ribosomal protein S18P [Pediococcus pentosaceus ATCC 25745]
 gi|122266709|sp|Q03I52|RS18_PEDPA RecName: Full=30S ribosomal protein S18
 gi|116101977|gb|ABJ67120.1| SSU ribosomal protein S18P [Pediococcus pentosaceus ATCC 25745]
          Length = 78

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 40/62 (64%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
             ++      IDYKD  LL RF+S+RGKI+P R+S  S K QR L  AIKRAR +GL+ 
Sbjct: 14 VDYIAANHIEYIDYKDTELLKRFISERGKILPRRVSGTSAKNQRRLTIAIKRARIMGLLP 73

Query: 80 YV 81
          +V
Sbjct: 74 FV 75


>gi|254438780|ref|ZP_05052274.1| ribosomal protein S18 [Octadecabacter antarcticus 307]
 gi|198254226|gb|EDY78540.1| ribosomal protein S18 [Octadecabacter antarcticus 307]
          Length = 75

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 41/72 (56%), Positives = 52/72 (72%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRKS P  G  AP+IDYKD R L R++S+RGKIVPSRI++V  K QR LA+A
Sbjct: 1  MATKPFFRRRKSDPFDGDNAPKIDYKDTRTLQRYVSERGKIVPSRITAVGAKNQRALARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|270289884|ref|ZP_06196110.1| 30S ribosomal protein S18 [Pediococcus acidilactici 7_4]
 gi|304385863|ref|ZP_07368207.1| 30S ribosomal protein S18 [Pediococcus acidilactici DSM 20284]
 gi|270281421|gb|EFA27253.1| 30S ribosomal protein S18 [Pediococcus acidilactici 7_4]
 gi|304328367|gb|EFL95589.1| 30S ribosomal protein S18 [Pediococcus acidilactici DSM 20284]
          Length = 78

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 40/62 (64%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
             ++      IDYKD  LL RF+S+RGKI+P R+S  S K QR L  AIKRAR +GL+ 
Sbjct: 14 VDYIAANHIEYIDYKDTELLKRFISERGKILPRRVSGTSAKNQRRLTIAIKRARIMGLLP 73

Query: 80 YV 81
          +V
Sbjct: 74 FV 75


>gi|254454485|ref|ZP_05067922.1| ribosomal protein S18 [Octadecabacter antarcticus 238]
 gi|198268891|gb|EDY93161.1| ribosomal protein S18 [Octadecabacter antarcticus 238]
          Length = 75

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 41/72 (56%), Positives = 52/72 (72%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRKS P  G  AP+IDYKD R L R++S+RGKIVPSRI++V  K QR LA+A
Sbjct: 1  MATKPFFRRRKSDPFEGDNAPKIDYKDTRTLQRYVSERGKIVPSRITAVGAKNQRALARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|153810611|ref|ZP_01963279.1| hypothetical protein RUMOBE_00992 [Ruminococcus obeum ATCC 29174]
 gi|149833790|gb|EDM88871.1| hypothetical protein RUMOBE_00992 [Ruminococcus obeum ATCC 29174]
          Length = 87

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 49/79 (62%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          E   +P+ RR    R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K Q
Sbjct: 7  ERPDSPMKRRGGRRRKKVCVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQ 66

Query: 63 RELAKAIKRARYLGLIAYV 81
          R L  A+KRAR+L ++ YV
Sbjct: 67 RALTVAVKRARHLSMMPYV 85


>gi|157825190|ref|YP_001492910.1| 30S ribosomal protein S18 [Rickettsia akari str. Hartford]
 gi|166220982|sp|A8GLX7|RS18_RICAH RecName: Full=30S ribosomal protein S18
 gi|157799148|gb|ABV74402.1| 30S ribosomal protein S18 [Rickettsia akari str. Hartford]
          Length = 95

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 50/71 (70%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++    RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK
Sbjct: 21 KKVFFRRRKGCPLSVHNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIK 80

Query: 71 RARYLGLIAYV 81
           AR L L+ +V
Sbjct: 81 IARILALLPFV 91


>gi|239995320|ref|ZP_04715844.1| 30S ribosomal protein S18 [Alteromonas macleodii ATCC 27126]
 gi|332143173|ref|YP_004428911.1| 30S ribosomal protein S18 [Alteromonas macleodii str. 'Deep
          ecotype']
 gi|229470505|sp|B4S011|RS18_ALTMD RecName: Full=30S ribosomal protein S18
 gi|327553195|gb|AEA99913.1| 30S ribosomal protein S18 [Alteromonas macleodii str. 'Deep
          ecotype']
          Length = 75

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 30/59 (50%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+L+ AIKRAR+L L+ Y +
Sbjct: 14 TAEGVTEIDYKDIATLKNYITESGKIVPSRITGTSAKYQRQLSSAIKRARFLALLPYTD 72


>gi|257065997|ref|YP_003152253.1| 30S ribosomal protein S18 [Anaerococcus prevotii DSM 20548]
 gi|256797877|gb|ACV28532.1| ribosomal protein S18 [Anaerococcus prevotii DSM 20548]
          Length = 75

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 45/72 (62%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  R    R+K  P     +  IDYKDI  L RF++ RGKI+P R++ ++ K QRE+ +A
Sbjct: 1  MAGRRFRPRKKVDPFVKDPSKVIDYKDIETLKRFVTDRGKILPRRVTGLNAKHQREITRA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR + L+ Y
Sbjct: 61 IKRARQVALLPY 72


>gi|238650507|ref|YP_002916359.1| 30S ribosomal protein S18 [Rickettsia peacockii str. Rustic]
 gi|259494818|sp|C4K160|RS18_RICPU RecName: Full=30S ribosomal protein S18
 gi|238624605|gb|ACR47311.1| 30S ribosomal protein S18 [Rickettsia peacockii str. Rustic]
          Length = 95

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 50/71 (70%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++    RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK
Sbjct: 21 KKVFFRRRKGCPLSVSNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIK 80

Query: 71 RARYLGLIAYV 81
           AR L L+ +V
Sbjct: 81 IARILALLPFV 91


>gi|295133966|ref|YP_003584642.1| 30S ribosomal protein S18 [Zunongwangia profunda SM-A87]
 gi|294981981|gb|ADF52446.1| 30S ribosomal protein S18 [Zunongwangia profunda SM-A87]
          Length = 99

 Score = 93.5 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 43/67 (64%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S  +K C     G   IDYKD   L  F++++GK++P R++  S K QR++A A+KRAR+
Sbjct: 28 SKTKKYCRFKRSGIKYIDYKDPDFLMSFVNEQGKLLPRRLTGTSLKYQRKVAVAVKRARH 87

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 88 LALMPYV 94


>gi|209964875|ref|YP_002297790.1| ribosomal protein S18 [Rhodospirillum centenum SW]
 gi|209958341|gb|ACI98977.1| ribosomal protein S18 [Rhodospirillum centenum SW]
          Length = 89

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 56/63 (88%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP IDYKD++LL+RF+S+RGKIVPSRI++VS KKQRELA+AIKRAR+L L+
Sbjct: 25 KTCPFSGPNAPAIDYKDVKLLSRFISERGKIVPSRITAVSAKKQRELARAIKRARFLALL 84

Query: 79 AYV 81
           YV
Sbjct: 85 PYV 87


>gi|120555297|ref|YP_959648.1| 30S ribosomal protein S18 [Marinobacter aquaeolei VT8]
 gi|166220958|sp|A1U392|RS18_MARAV RecName: Full=30S ribosomal protein S18
 gi|120325146|gb|ABM19461.1| SSU ribosomal protein S18P [Marinobacter aquaeolei VT8]
          Length = 76

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLDTLKGYITETGKIVPSRITGTKARYQRQLATAIKRARYLALLPYTD 72


>gi|295099557|emb|CBK88646.1| SSU ribosomal protein S18P [Eubacterium cylindroides T2-87]
          Length = 76

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 44/72 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++    R+K C  +      IDYKD+ LL RF++  GKI+P R++    K QR LAKAI
Sbjct: 3  FKKQRMGRKKVCYFTKNKIKEIDYKDVELLKRFINANGKIIPRRVTGTRAKYQRMLAKAI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 63 KRARQMALLPYV 74


>gi|269959107|ref|YP_003328896.1| 30S ribosomal protein S18 [Anaplasma centrale str. Israel]
 gi|269848938|gb|ACZ49582.1| 30S ribosomal protein S18 [Anaplasma centrale str. Israel]
          Length = 96

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 55/77 (71%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          +P   L+R    + +SCPL+      IDYK+  LL++F+S+ G+I+PSRI+SVS KKQ+ 
Sbjct: 20 SPLVYLKRPYFRKSRSCPLAQCPDEDIDYKNRALLSKFVSEYGRILPSRITSVSSKKQKL 79

Query: 65 LAKAIKRARYLGLIAYV 81
          LA+A+KRAR+L L+ Y 
Sbjct: 80 LARAVKRARFLALLPYC 96


>gi|124266721|ref|YP_001020725.1| 30S ribosomal protein S18 [Methylibium petroleiphilum PM1]
 gi|166220959|sp|A2SG01|RS18_METPP RecName: Full=30S ribosomal protein S18
 gi|124259496|gb|ABM94490.1| SSU ribosomal protein S18P [Methylibium petroleiphilum PM1]
          Length = 96

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 45/80 (56%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R++ C  +  G   IDYKD+  L  F+++ GKI P+R++      Q
Sbjct: 13 DKRPKRNTQSLLFRRKRFCRFTVTGVTEIDYKDVDTLRDFIAENGKITPARLTGTRAFFQ 72

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L+  IKRAR+L L+ Y +
Sbjct: 73 RQLSTCIKRARFLALLPYSD 92


>gi|317123154|ref|YP_004103157.1| 30S ribosomal protein S18P [Thermaerobacter marianensis DSM
          12885]
 gi|315593134|gb|ADU52430.1| SSU ribosomal protein S18P [Thermaerobacter marianensis DSM
          12885]
          Length = 75

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         +DYKD   L +FL++RGKI+P RI+    + QR+L +AIKRAR + L+ 
Sbjct: 12 VCEFCVNRIAVVDYKDAGRLRKFLTERGKILPRRITGNCARHQRQLTRAIKRARIMALLP 71

Query: 80 YV 81
          + 
Sbjct: 72 FT 73


>gi|256618519|ref|ZP_05475365.1| ribosomal protein S18 [Enterococcus faecalis ATCC 4200]
 gi|256598046|gb|EEU17222.1| ribosomal protein S18 [Enterococcus faecalis ATCC 4200]
          Length = 79

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 41/63 (65%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
             ++      IDYKD  LL RF+S+RGKI+P R++    K QR+L  AIKRAR +GL+ 
Sbjct: 14 VDYIAANHIEYIDYKDTELLKRFISERGKILPRRVTGTGAKNQRKLTIAIKRARIMGLLP 73

Query: 80 YVN 82
          +V+
Sbjct: 74 FVS 76


>gi|299143652|ref|ZP_07036732.1| ribosomal protein S18 [Peptoniphilus sp. oral taxon 386 str.
          F0131]
 gi|298518137|gb|EFI41876.1| ribosomal protein S18 [Peptoniphilus sp. oral taxon 386 str.
          F0131]
          Length = 74

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 45/71 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++R    R+K  P       +IDYKDI LL  ++S+RGKI+P RI+ +S K QR +  AI
Sbjct: 1  MQRRFRPRKKVDPFEKDKTKKIDYKDIALLRNYISERGKILPRRITGLSAKHQRAITTAI 60

Query: 70 KRARYLGLIAY 80
          KRAR + L+ Y
Sbjct: 61 KRARQVALLPY 71


>gi|49082502|gb|AAT50651.1| PA4934 [synthetic construct]
          Length = 77

 Score = 93.5 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 31/59 (52%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++S+ GKIVPSRI+    K QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLNTLRAYVSETGKIVPSRITGTKAKYQRQLATAIKRARYLALLPYTD 72


>gi|257093840|ref|YP_003167481.1| 30S ribosomal protein S18 [Candidatus Accumulibacter phosphatis
          clade IIA str. UW-1]
 gi|257046364|gb|ACV35552.1| ribosomal protein S18 [Candidatus Accumulibacter phosphatis clade
          IIA str. UW-1]
          Length = 91

 Score = 93.5 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 41/68 (60%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RRK C  + +    IDYKD+ L   ++++  KI+P+R++      QR L+ AIKRAR+
Sbjct: 21 FKRRKFCRFTAEKMEEIDYKDVDLFKEYVAENAKIMPARLTGTKAGYQRMLSVAIKRARF 80

Query: 75 LGLIAYVN 82
          L L+ Y +
Sbjct: 81 LALLPYTD 88


>gi|298530249|ref|ZP_07017651.1| ribosomal protein S18 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509623|gb|EFI33527.1| ribosomal protein S18 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 85

 Score = 93.5 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 38/70 (54%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          +  + R+K C         +DYK++ +L  F++ RGKI+  RI+    K QR L   IK+
Sbjct: 4  KKFAPRKKFCRFCASKENILDYKNVDMLKDFITDRGKIIARRITGNCAKHQRALTTEIKK 63

Query: 72 ARYLGLIAYV 81
          AR + L+ Y 
Sbjct: 64 ARQMALLYYT 73


>gi|299133697|ref|ZP_07026891.1| ribosomal protein S18 [Afipia sp. 1NLS2]
 gi|298591533|gb|EFI51734.1| ribosomal protein S18 [Afipia sp. 1NLS2]
          Length = 79

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/71 (64%), Positives = 59/71 (83%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK+CP +G  AP+ID+KD +LL R++S+RGKIVPSRI++VS  KQRELA+AIK
Sbjct: 7  RRPFFRRRKTCPFTGPNAPKIDFKDSKLLMRYVSERGKIVPSRITAVSALKQRELARAIK 66

Query: 71 RARYLGLIAYV 81
          RAR+LGL+ YV
Sbjct: 67 RARFLGLLPYV 77


>gi|118588140|ref|ZP_01545550.1| 30S ribosomal protein S18 [Stappia aggregata IAM 12614]
 gi|118439762|gb|EAV46393.1| 30S ribosomal protein S18 [Stappia aggregata IAM 12614]
          Length = 82

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 56/63 (88%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKDIRLL R++S+RGKIVPSRI++VS KKQRELA+AIKRAR LGL+
Sbjct: 18 KTCPFSGTNAPKIDYKDIRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARLLGLL 77

Query: 79 AYV 81
           +V
Sbjct: 78 PFV 80


>gi|162447065|ref|YP_001620197.1| 30S ribosomal protein S18 [Acholeplasma laidlawii PG-8A]
 gi|205556720|sp|A9NEP1|RS18_ACHLI RecName: Full=30S ribosomal protein S18
 gi|161985172|gb|ABX80821.1| small subunit ribosomal protein S18 [Acholeplasma laidlawii
          PG-8A]
          Length = 80

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 44/68 (64%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             R+K C  +      ID+KD  LL RF+++RGKI+P R++  S K QR LA AIKRAR
Sbjct: 11 FRKRKKVCFFTQNKFTHIDFKDTELLKRFITERGKILPRRVTGTSAKWQRPLAVAIKRAR 70

Query: 74 YLGLIAYV 81
          ++ L+ +V
Sbjct: 71 HMALLPFV 78


>gi|239814826|ref|YP_002943736.1| 30S ribosomal protein S18 [Variovorax paradoxus S110]
 gi|319792759|ref|YP_004154399.1| ribosomal protein s18 [Variovorax paradoxus EPS]
 gi|259494822|sp|C5CUP2|RS18_VARPS RecName: Full=30S ribosomal protein S18
 gi|239801403|gb|ACS18470.1| ribosomal protein S18 [Variovorax paradoxus S110]
 gi|315595222|gb|ADU36288.1| ribosomal protein S18 [Variovorax paradoxus EPS]
          Length = 93

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 46/80 (57%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R++ C  +  G   IDYKDI  L  F+S+ GKI+P+R++      Q
Sbjct: 10 DKRPKRNTQSLLFKRKRFCRFTVAGVEEIDYKDIDTLRDFISENGKIIPARLTGTRAIYQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L ++ Y +
Sbjct: 70 RQLNTAIKRARFLAMVPYSD 89


>gi|89897780|ref|YP_521267.1| 30S ribosomal protein S18 [Desulfitobacterium hafniense Y51]
 gi|219670929|ref|YP_002461364.1| 30S ribosomal protein S18 [Desulfitobacterium hafniense DCB-2]
 gi|123091592|sp|Q24MB9|RS18_DESHY RecName: Full=30S ribosomal protein S18
 gi|89337228|dbj|BAE86823.1| 30S ribosomal protein S18 [Desulfitobacterium hafniense Y51]
 gi|219541189|gb|ACL22928.1| ribosomal protein S18 [Desulfitobacterium hafniense DCB-2]
          Length = 76

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 38/62 (61%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYKD   + +++++RGKI+P RIS    K QR++  AIKRAR++ L+ 
Sbjct: 13 VCSFCVDKVESIDYKDTHKIRKYITERGKILPRRISGNCAKHQRQVTVAIKRARHIALLP 72

Query: 80 YV 81
          Y+
Sbjct: 73 YI 74


>gi|289770861|ref|ZP_06530239.1| 30S ribosomal protein S18 2 [Streptomyces lividans TK24]
 gi|289701060|gb|EFD68489.1| 30S ribosomal protein S18 2 [Streptomyces lividans TK24]
          Length = 105

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 47/79 (59%)

Query: 2   AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
           ++  P P        R++  PL   G   +DYKD  LL +F+S RGKI   R++ V+ ++
Sbjct: 24  SDPMPRPRKADRTPARQRPNPLDRDGVTYVDYKDTELLRKFVSDRGKIRSRRVTRVTSQQ 83

Query: 62  QRELAKAIKRARYLGLIAY 80
           QR+LA+AIK AR + L+ Y
Sbjct: 84  QRQLARAIKNAREMALLPY 102


>gi|229816198|ref|ZP_04446508.1| hypothetical protein COLINT_03245 [Collinsella intestinalis DSM
          13280]
 gi|229808206|gb|EEP43998.1| hypothetical protein COLINT_03245 [Collinsella intestinalis DSM
          13280]
          Length = 88

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 40/67 (59%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             RRK C    +    IDYKD +LL ++++ RGKI P R++    + Q ++A AIKRAR
Sbjct: 8  RQPRRKYCQFCKENTEFIDYKDTQLLRKYMTDRGKIKPRRVTGACTQHQHDIANAIKRAR 67

Query: 74 YLGLIAY 80
           + L+ Y
Sbjct: 68 EMALLPY 74


>gi|126735966|ref|ZP_01751710.1| ribosomal protein S18 [Roseobacter sp. CCS2]
 gi|126714523|gb|EBA11390.1| ribosomal protein S18 [Roseobacter sp. CCS2]
          Length = 75

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/72 (56%), Positives = 53/72 (73%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRKS P  G  AP+IDYKD RLL R++S+RGKIVP+RI++V  K QR LA+A
Sbjct: 1  MATKPFFRRRKSDPFEGDNAPKIDYKDTRLLQRYISERGKIVPARITAVGAKNQRALARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|126661839|ref|ZP_01732838.1| 30S ribosomal protein S18 [Flavobacteria bacterium BAL38]
 gi|126625218|gb|EAZ95907.1| 30S ribosomal protein S18 [Flavobacteria bacterium BAL38]
          Length = 98

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 43/66 (65%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
            +K C     G   IDYKD   L +F++++GKI+P R++  S K QR+++ A+KRAR+L
Sbjct: 28 KTKKYCRFKKSGIKYIDYKDADFLLKFVNEQGKILPRRLTGTSLKYQRKVSVAVKRARHL 87

Query: 76 GLIAYV 81
           L+ YV
Sbjct: 88 ALMPYV 93


>gi|187251761|ref|YP_001876243.1| 30S ribosomal protein S18 [Elusimicrobium minutum Pei191]
 gi|226735118|sp|B2KEG0|RS18_ELUMP RecName: Full=30S ribosomal protein S18
 gi|186971921|gb|ACC98906.1| Ribosomal protein S18 [Elusimicrobium minutum Pei191]
          Length = 113

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 40/76 (52%)

Query: 5   APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
           A  P  ++    RRK C L  +    +DYK+ + +  F    GKI+  RI+    K QR+
Sbjct: 33  AKGPFGKKRFESRRKVCKLCAEKIENVDYKNFQFIKSFTMDSGKILSRRITGTCAKHQRQ 92

Query: 65  LAKAIKRARYLGLIAY 80
           +A A+KR R L ++ Y
Sbjct: 93  IASAVKRDRNLAILPY 108


>gi|121607971|ref|YP_995778.1| 30S ribosomal protein S18 [Verminephrobacter eiseniae EF01-2]
 gi|241764689|ref|ZP_04762701.1| ribosomal protein S18 [Acidovorax delafieldii 2AN]
 gi|166222255|sp|A1WGK3|RS18_VEREI RecName: Full=30S ribosomal protein S18
 gi|121552611|gb|ABM56760.1| SSU ribosomal protein S18P [Verminephrobacter eiseniae EF01-2]
 gi|241365859|gb|EER60508.1| ribosomal protein S18 [Acidovorax delafieldii 2AN]
          Length = 93

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (57%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R++ C  +  G   IDYKD+  L  F+++ GKI+P+R++      Q
Sbjct: 10 DKRPKRNTQSLLFKRKRFCRFTVTGVEEIDYKDVDTLRDFIAENGKIIPARLTGTRAIFQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 70 RQLNTAIKRARFLALVPYSD 89


>gi|332995432|gb|AEF05487.1| 30S ribosomal protein S18 [Alteromonas sp. SN2]
          Length = 75

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/59 (50%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          +  G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+L+ AIKRAR+L L+ Y +
Sbjct: 14 TADGVTEIDYKDIATLKNYITESGKIVPSRITGTSAKYQRQLSSAIKRARFLALLPYTD 72


>gi|225011730|ref|ZP_03702168.1| ribosomal protein S18 [Flavobacteria bacterium MS024-2A]
 gi|225004233|gb|EEG42205.1| ribosomal protein S18 [Flavobacteria bacterium MS024-2A]
          Length = 98

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 45/67 (67%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S ++K C     G   +DYKD   L +F++++GKI+P R++  S K QR+++ A+KRAR+
Sbjct: 27 STQKKYCRFKRTGIKYVDYKDPDFLIKFVNEQGKILPRRLTGTSLKYQRKVSVAVKRARH 86

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 87 LALMPYV 93


>gi|312621642|ref|YP_004023255.1| 30S ribosomal protein S18 [Caldicellulosiruptor kronotskyensis
          2002]
 gi|312202109|gb|ADQ45436.1| ribosomal protein S18 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 92

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 42/70 (60%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKR
Sbjct: 21 SRQKKKKRVCSFCVERIYEIDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKR 80

Query: 72 ARYLGLIAYV 81
          AR L L+ ++
Sbjct: 81 ARILALLPFI 90


>gi|110638978|ref|YP_679187.1| 30S ribosomal protein S18 [Cytophaga hutchinsonii ATCC 33406]
 gi|122966648|sp|Q11RW9|RS18_CYTH3 RecName: Full=30S ribosomal protein S18
 gi|110281659|gb|ABG59845.1| SSU ribosomal protein S18P [Cytophaga hutchinsonii ATCC 33406]
          Length = 83

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 47/71 (66%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
            V +R+K C     G   IDYKD   L +F++++GKI+P R++  S K QR++++A+KR
Sbjct: 9  NRVENRKKYCRFKKMGIFYIDYKDPNFLLKFVNEQGKILPRRLTGTSLKYQRKVSQAVKR 68

Query: 72 ARYLGLIAYVN 82
          AR +GL+ YV 
Sbjct: 69 ARLIGLLPYVT 79


>gi|15640395|ref|NP_230022.1| 30S ribosomal protein S18 [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121590975|ref|ZP_01678295.1| ribosomal protein S18 [Vibrio cholerae 2740-80]
 gi|121730199|ref|ZP_01682589.1| ribosomal protein S18 [Vibrio cholerae V52]
 gi|147675772|ref|YP_001218637.1| 30S ribosomal protein S18 [Vibrio cholerae O395]
 gi|153216652|ref|ZP_01950559.1| ribosomal protein S18 [Vibrio cholerae 1587]
 gi|153820254|ref|ZP_01972921.1| ribosomal protein S18 [Vibrio cholerae NCTC 8457]
 gi|153824149|ref|ZP_01976816.1| ribosomal protein S18 [Vibrio cholerae B33]
 gi|153827640|ref|ZP_01980307.1| ribosomal protein S18 [Vibrio cholerae MZO-2]
 gi|153830451|ref|ZP_01983118.1| ribosomal protein S18 [Vibrio cholerae 623-39]
 gi|227080580|ref|YP_002809131.1| ribosomal protein S18 [Vibrio cholerae M66-2]
 gi|229504951|ref|ZP_04394462.1| SSU ribosomal protein S18p [Vibrio cholerae BX 330286]
 gi|229508611|ref|ZP_04398107.1| SSU ribosomal protein S18p [Vibrio cholerae B33]
 gi|229512612|ref|ZP_04402082.1| SSU ribosomal protein S18p [Vibrio cholerae TMA 21]
 gi|229516023|ref|ZP_04405474.1| SSU ribosomal protein S18p [Vibrio cholerae RC9]
 gi|229519925|ref|ZP_04409356.1| SSU ribosomal protein S18p [Vibrio cholerae TM 11079-80]
 gi|229525062|ref|ZP_04414467.1| SSU ribosomal protein S18p [Vibrio cholerae bv. albensis VL426]
 gi|229526943|ref|ZP_04416340.1| SSU ribosomal protein S18p [Vibrio cholerae 12129(1)]
 gi|229606351|ref|YP_002876999.1| 30S ribosomal protein S18 [Vibrio cholerae MJ-1236]
 gi|254286208|ref|ZP_04961167.1| ribosomal protein S18 [Vibrio cholerae AM-19226]
 gi|254851679|ref|ZP_05241029.1| 30S ribosomal protein S18 [Vibrio cholerae MO10]
 gi|255747166|ref|ZP_05421109.1| SSU ribosomal protein S18p [Vibrio cholera CIRS 101]
 gi|258622405|ref|ZP_05717428.1| 30S ribosomal protein S18 [Vibrio mimicus VM573]
 gi|258625990|ref|ZP_05720855.1| 30S ribosomal protein S18 [Vibrio mimicus VM603]
 gi|261210395|ref|ZP_05924689.1| SSU ribosomal protein S18p [Vibrio sp. RC341]
 gi|262163855|ref|ZP_06031595.1| SSU ribosomal protein S18p [Vibrio mimicus VM223]
 gi|262166874|ref|ZP_06034596.1| SSU ribosomal protein S18p [Vibrio cholerae RC27]
 gi|262172536|ref|ZP_06040214.1| SSU ribosomal protein S18p [Vibrio mimicus MB-451]
 gi|262401541|ref|ZP_06078108.1| SSU ribosomal protein S18p [Vibrio sp. RC586]
 gi|297582252|ref|ZP_06944167.1| ribosomal protein S18 [Vibrio cholerae RC385]
 gi|298501265|ref|ZP_07011063.1| SSU ribosomal protein S18 [Vibrio cholerae MAK 757]
 gi|11387102|sp|Q9KUZ0|RS18_VIBCH RecName: Full=30S ribosomal protein S18
 gi|172047710|sp|A5F3K5|RS18_VIBC3 RecName: Full=30S ribosomal protein S18
 gi|254812964|sp|C3LRA0|RS18_VIBCM RecName: Full=30S ribosomal protein S18
 gi|9654785|gb|AAF93541.1| ribosomal protein S18 [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|121547201|gb|EAX57328.1| ribosomal protein S18 [Vibrio cholerae 2740-80]
 gi|121628057|gb|EAX60602.1| ribosomal protein S18 [Vibrio cholerae V52]
 gi|124114163|gb|EAY32983.1| ribosomal protein S18 [Vibrio cholerae 1587]
 gi|126509205|gb|EAZ71799.1| ribosomal protein S18 [Vibrio cholerae NCTC 8457]
 gi|126518326|gb|EAZ75549.1| ribosomal protein S18 [Vibrio cholerae B33]
 gi|146317655|gb|ABQ22194.1| ribosomal protein S18 [Vibrio cholerae O395]
 gi|148874053|gb|EDL72188.1| ribosomal protein S18 [Vibrio cholerae 623-39]
 gi|149737890|gb|EDM52795.1| ribosomal protein S18 [Vibrio cholerae MZO-2]
 gi|150423623|gb|EDN15565.1| ribosomal protein S18 [Vibrio cholerae AM-19226]
 gi|227008468|gb|ACP04680.1| ribosomal protein S18 [Vibrio cholerae M66-2]
 gi|227012224|gb|ACP08434.1| ribosomal protein S18 [Vibrio cholerae O395]
 gi|229335555|gb|EEO01035.1| SSU ribosomal protein S18p [Vibrio cholerae 12129(1)]
 gi|229338643|gb|EEO03660.1| SSU ribosomal protein S18p [Vibrio cholerae bv. albensis VL426]
 gi|229343053|gb|EEO08040.1| SSU ribosomal protein S18p [Vibrio cholerae TM 11079-80]
 gi|229346926|gb|EEO11893.1| SSU ribosomal protein S18p [Vibrio cholerae RC9]
 gi|229350394|gb|EEO15344.1| SSU ribosomal protein S18p [Vibrio cholerae TMA 21]
 gi|229354379|gb|EEO19306.1| SSU ribosomal protein S18p [Vibrio cholerae B33]
 gi|229358009|gb|EEO22925.1| SSU ribosomal protein S18p [Vibrio cholerae BX 330286]
 gi|229369006|gb|ACQ59429.1| SSU ribosomal protein S18p [Vibrio cholerae MJ-1236]
 gi|254847384|gb|EET25798.1| 30S ribosomal protein S18 [Vibrio cholerae MO10]
 gi|255735215|gb|EET90617.1| SSU ribosomal protein S18p [Vibrio cholera CIRS 101]
 gi|258581738|gb|EEW06622.1| 30S ribosomal protein S18 [Vibrio mimicus VM603]
 gi|258585319|gb|EEW10045.1| 30S ribosomal protein S18 [Vibrio mimicus VM573]
 gi|260840453|gb|EEX67019.1| SSU ribosomal protein S18p [Vibrio sp. RC341]
 gi|261893612|gb|EEY39598.1| SSU ribosomal protein S18p [Vibrio mimicus MB-451]
 gi|262024704|gb|EEY43383.1| SSU ribosomal protein S18p [Vibrio cholerae RC27]
 gi|262027835|gb|EEY46500.1| SSU ribosomal protein S18p [Vibrio mimicus VM223]
 gi|262352256|gb|EEZ01385.1| SSU ribosomal protein S18p [Vibrio sp. RC586]
 gi|297533510|gb|EFH72356.1| ribosomal protein S18 [Vibrio cholerae RC385]
 gi|297540019|gb|EFH76082.1| SSU ribosomal protein S18 [Vibrio cholerae MAK 757]
 gi|327483226|gb|AEA77633.1| SSU ribosomal protein S18p [Vibrio cholerae LMA3894-4]
          Length = 75

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/59 (52%), Positives = 43/59 (72%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+  S K QR+LA+AIKRARYL L+ Y +
Sbjct: 14 TAEGVQEIDYKDVATLKNYITEAGKIVPSRITGTSAKYQRQLARAIKRARYLALLPYTD 72


>gi|121605292|ref|YP_982621.1| 30S ribosomal protein S18 [Polaromonas naphthalenivorans CJ2]
 gi|166220969|sp|A1VPX2|RS18_POLNA RecName: Full=30S ribosomal protein S18
 gi|120594261|gb|ABM37700.1| SSU ribosomal protein S18P [Polaromonas naphthalenivorans CJ2]
          Length = 94

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R++ C  +  G   IDYKDI  L  F+S+ GKI+P+R++      Q
Sbjct: 10 DKRPKRNTQSLLFKRKRFCRFTAAGVEEIDYKDIDTLRDFVSENGKIIPARLTGTRAIFQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R++  A+KRAR+L ++ Y +
Sbjct: 70 RQINTAVKRARFLAMLPYSD 89


>gi|332295125|ref|YP_004437048.1| 30S ribosomal protein S18 [Thermodesulfobium narugense DSM 14796]
 gi|332178228|gb|AEE13917.1| 30S ribosomal protein S18 [Thermodesulfobium narugense DSM 14796]
          Length = 77

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 41/69 (59%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK+C    +    IDYKD+  L ++LS RGKI+P R + +  K QR+L  AIKRA
Sbjct: 7  RKRVRRKACSFCAEKVKYIDYKDVNRLKKYLSDRGKILPKRATGLCAKHQRQLTTAIKRA 66

Query: 73 RYLGLIAYV 81
          R + L+ + 
Sbjct: 67 RMIALLPFT 75


>gi|227500388|ref|ZP_03930450.1| possible ribosomal protein S18 [Anaerococcus tetradius ATCC
          35098]
 gi|227217451|gb|EEI82770.1| possible ribosomal protein S18 [Anaerococcus tetradius ATCC
          35098]
          Length = 76

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 45/72 (62%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  R    R+K  P     +  IDYKDI  L RF++ RGKI+P R++ ++ K QRE+ +A
Sbjct: 2  MAGRRFRPRKKVDPFVKDPSKVIDYKDIETLKRFVTDRGKILPRRVTGLNAKHQREITRA 61

Query: 69 IKRARYLGLIAY 80
          IKRAR + L+ Y
Sbjct: 62 IKRARQVALLPY 73


>gi|146301223|ref|YP_001195814.1| 30S ribosomal protein S18 [Flavobacterium johnsoniae UW101]
 gi|205557694|sp|A5FE76|RS18_FLAJO RecName: Full=30S ribosomal protein S18
 gi|146155641|gb|ABQ06495.1| 30S ribosomal protein S18 [Flavobacterium johnsoniae UW101]
          Length = 98

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 43/66 (65%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
            +K C     G   IDYKD   L +F++++GKI+P R++  S K QR+++ A+KRAR+L
Sbjct: 28 KTKKYCRFKKSGIKYIDYKDADFLLKFVNEQGKILPRRLTGTSLKYQRKVSVAVKRARHL 87

Query: 76 GLIAYV 81
           L+ YV
Sbjct: 88 ALMPYV 93


>gi|257439412|ref|ZP_05615167.1| ribosomal protein S18 [Faecalibacterium prausnitzii A2-165]
 gi|257198071|gb|EEU96355.1| ribosomal protein S18 [Faecalibacterium prausnitzii A2-165]
          Length = 71

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/66 (40%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C         IDYKD+  L +++S+R KI+P R++      QR L  AIKRAR++ 
Sbjct: 5  RKKVCSFCVDRIDTIDYKDVPRLRKYVSERAKIIPRRVTGTCAYHQRALTTAIKRARHVA 64

Query: 77 LIAYVN 82
          L+ YV+
Sbjct: 65 LMPYVS 70


>gi|312126896|ref|YP_003991770.1| 30S ribosomal protein S18 [Caldicellulosiruptor hydrothermalis
          108]
 gi|311776915|gb|ADQ06401.1| ribosomal protein S18 [Caldicellulosiruptor hydrothermalis 108]
          Length = 92

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 42/70 (60%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKR
Sbjct: 21 SRQKKKKRVCSFCVERIYEIDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKR 80

Query: 72 ARYLGLIAYV 81
          AR L L+ ++
Sbjct: 81 ARILALLPFI 90


>gi|253581023|ref|ZP_04858284.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847686|gb|EES75655.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 87

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 49/79 (62%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          E   +P+ RR    R+K C   GK    IDYKD+  L +++S+RGKI+P RI+    K Q
Sbjct: 7  ERPDSPMKRRGGRRRKKVCVFCGKENNEIDYKDVAKLRKYVSERGKILPRRITGNCAKHQ 66

Query: 63 RELAKAIKRARYLGLIAYV 81
          R L  AIKRAR++ ++ Y+
Sbjct: 67 RALTVAIKRARHMSMMPYI 85


>gi|217977084|ref|YP_002361231.1| 30S ribosomal protein S18 [Methylocella silvestris BL2]
 gi|254812948|sp|B8ESH9|RS18_METSB RecName: Full=30S ribosomal protein S18
 gi|217502460|gb|ACK49869.1| ribosomal protein S18 [Methylocella silvestris BL2]
          Length = 80

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD RLL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LGL+
Sbjct: 16 KTCPFSGPNAPKIDYKDTRLLSRYISERGKIVPSRITAVSAKKQRELAQAIKRARFLGLL 75

Query: 79 AYV 81
           YV
Sbjct: 76 PYV 78


>gi|172059038|ref|YP_001815498.1| ribosomal protein S18 [Exiguobacterium sibiricum 255-15]
 gi|171991559|gb|ACB62481.1| ribosomal protein S18 [Exiguobacterium sibiricum 255-15]
          Length = 76

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 40/62 (64%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +      IDYKD+ LL RF+S+RGKI+P R++  S K QR L  AIKR+R + LI 
Sbjct: 13 VCYFTSNHITHIDYKDVELLKRFISERGKILPRRVTGTSAKYQRPLTIAIKRSRQMALIP 72

Query: 80 YV 81
          YV
Sbjct: 73 YV 74


>gi|229586275|ref|YP_002844776.1| 30S ribosomal protein S18 [Rickettsia africae ESF-5]
 gi|259494817|sp|C3PM73|RS18_RICAE RecName: Full=30S ribosomal protein S18
 gi|228021325|gb|ACP53033.1| 30S ribosomal protein S18 [Rickettsia africae ESF-5]
          Length = 95

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 50/71 (70%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++    RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK
Sbjct: 21 KKVFFRRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIK 80

Query: 71 RARYLGLIAYV 81
           AR L L+ +V
Sbjct: 81 IARILALLPFV 91


>gi|323136068|ref|ZP_08071151.1| ribosomal protein S18 [Methylocystis sp. ATCC 49242]
 gi|322399159|gb|EFY01678.1| ribosomal protein S18 [Methylocystis sp. ATCC 49242]
          Length = 78

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 47/63 (74%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          KSCP SG  AP+IDYKD RLL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LGL+
Sbjct: 14 KSCPFSGANAPKIDYKDTRLLSRYISERGKIVPSRITAVSAKKQRELAQAIKRARFLGLL 73

Query: 79 AYV 81
           YV
Sbjct: 74 PYV 76


>gi|228473999|ref|ZP_04058740.1| ribosomal protein S18 [Capnocytophaga gingivalis ATCC 33624]
 gi|326336347|ref|ZP_08202518.1| 30S ribosomal protein S18 [Capnocytophaga sp. oral taxon 338 str.
          F0234]
 gi|228274513|gb|EEK13354.1| ribosomal protein S18 [Capnocytophaga gingivalis ATCC 33624]
 gi|325691521|gb|EGD33489.1| 30S ribosomal protein S18 [Capnocytophaga sp. oral taxon 338 str.
          F0234]
          Length = 97

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/66 (43%), Positives = 43/66 (65%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
            +K C     G   IDYKD   L +F++++GK++P RI+  S K QR++A A+KRAR+L
Sbjct: 27 KNKKYCRFKKLGIKYIDYKDPDFLLKFINEQGKLLPRRITGTSLKFQRKIAVAVKRARHL 86

Query: 76 GLIAYV 81
           L+ YV
Sbjct: 87 ALLPYV 92


>gi|221068653|ref|ZP_03544758.1| ribosomal protein S18 [Comamonas testosteroni KF-1]
 gi|264677151|ref|YP_003277057.1| ribosomal protein S18 [Comamonas testosteroni CNB-2]
 gi|299530695|ref|ZP_07044110.1| 30S ribosomal protein S18 [Comamonas testosteroni S44]
 gi|220713676|gb|EED69044.1| ribosomal protein S18 [Comamonas testosteroni KF-1]
 gi|262207663|gb|ACY31761.1| ribosomal protein S18 [Comamonas testosteroni CNB-2]
 gi|298721211|gb|EFI62153.1| 30S ribosomal protein S18 [Comamonas testosteroni S44]
          Length = 93

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (57%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R++ C  +  G   IDYKD+  L  F+++ GKIVP+R++      Q
Sbjct: 10 DKRPKRNTQSLLFKRKRFCRFTVAGVEEIDYKDVDTLRDFIAENGKIVPARLTGTRAIYQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L ++ Y +
Sbjct: 70 RQLNTAIKRARFLAMLPYSD 89


>gi|254294300|ref|YP_003060323.1| ribosomal protein S18 [Hirschia baltica ATCC 49814]
 gi|254042831|gb|ACT59626.1| ribosomal protein S18 [Hirschia baltica ATCC 49814]
          Length = 86

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 56/70 (80%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK CP SG  AP +DYKD++LL R++S++GKIVP+RI++VS KKQR L++AIK
Sbjct: 14 RRPFGRRRKVCPFSGDAAPALDYKDVKLLQRYISEKGKIVPARITAVSQKKQRRLSQAIK 73

Query: 71 RARYLGLIAY 80
          RAR+L L+ Y
Sbjct: 74 RARHLALLPY 83


>gi|258655464|ref|YP_003204620.1| 30S ribosomal protein S18 [Nakamurella multipartita DSM 44233]
 gi|258558689|gb|ACV81631.1| ribosomal protein S18 [Nakamurella multipartita DSM 44233]
          Length = 78

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 37/63 (58%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C    + A  IDYKD  LL RF+S RGKI   R++    + QR++A A+K AR + L+ 
Sbjct: 13 VCAFCKENAQPIDYKDTTLLRRFISDRGKIRARRVTGNCTQHQRDIATAVKNAREVALLP 72

Query: 80 YVN 82
          Y +
Sbjct: 73 YTS 75


>gi|170751790|ref|YP_001758050.1| 30S ribosomal protein S18 [Methylobacterium radiotolerans JCM
          2831]
 gi|205558300|sp|B1LYI3|RS18_METRJ RecName: Full=30S ribosomal protein S18
 gi|170658312|gb|ACB27367.1| ribosomal protein S18 [Methylobacterium radiotolerans JCM 2831]
          Length = 83

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 58/63 (92%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD++LL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LGL+
Sbjct: 19 KTCPFSGANAPKIDYKDVKLLSRYVSERGKIVPSRITAVSAKKQRELAQAIKRARFLGLL 78

Query: 79 AYV 81
           YV
Sbjct: 79 PYV 81


>gi|86142229|ref|ZP_01060739.1| ribosomal protein S18 [Leeuwenhoekiella blandensis MED217]
 gi|85830981|gb|EAQ49438.1| ribosomal protein S18 [Leeuwenhoekiella blandensis MED217]
          Length = 99

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 43/68 (63%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S  +K C     G   +DYKD   L  F++++GK++P R++  S K QR+++ A+KRAR+
Sbjct: 28 SKTKKYCRFKRSGIKYVDYKDADWLASFVNEQGKLLPRRLTGTSLKYQRKVSVAVKRARH 87

Query: 75 LGLIAYVN 82
          L L+ YV 
Sbjct: 88 LALMPYVT 95


>gi|15891988|ref|NP_359702.1| 30S ribosomal protein S18 [Rickettsia conorii str. Malish 7]
 gi|34580977|ref|ZP_00142457.1| 30S ribosomal protein S18 [Rickettsia sibirica 246]
 gi|157827936|ref|YP_001494178.1| 30S ribosomal protein S18 [Rickettsia rickettsii str. 'Sheila
          Smith']
 gi|165932624|ref|YP_001649413.1| 30S ribosomal protein S18 [Rickettsia rickettsii str. Iowa]
 gi|20140122|sp|Q92JK2|RS18_RICCN RecName: Full=30S ribosomal protein S18
 gi|166220985|sp|A8GQJ5|RS18_RICRS RecName: Full=30S ribosomal protein S18
 gi|189029685|sp|B0BVY1|RS18_RICRO RecName: Full=30S ribosomal protein S18
 gi|15619102|gb|AAL02603.1| 30S ribosomal protein S18 [Rickettsia conorii str. Malish 7]
 gi|28262362|gb|EAA25866.1| 30S ribosomal protein S18 [Rickettsia sibirica 246]
 gi|157800417|gb|ABV75670.1| 30S ribosomal protein S18 [Rickettsia rickettsii str. 'Sheila
          Smith']
 gi|165907711|gb|ABY72007.1| SSU ribosomal protein S18P [Rickettsia rickettsii str. Iowa]
          Length = 95

 Score = 93.1 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 50/71 (70%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++    RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK
Sbjct: 21 KKVFFRRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIK 80

Query: 71 RARYLGLIAYV 81
           AR L L+ +V
Sbjct: 81 IARILALLPFV 91


>gi|255035775|ref|YP_003086396.1| 30S ribosomal protein S18 [Dyadobacter fermentans DSM 18053]
 gi|254948531|gb|ACT93231.1| ribosomal protein S18 [Dyadobacter fermentans DSM 18053]
          Length = 83

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 45/69 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
             +R+K C     G   IDYK+   L + ++++GKI+P R++  S K QR++++AIKRA
Sbjct: 10 KNINRKKYCRFKKAGIKYIDYKNPDFLLKLVNEQGKILPRRLTGTSLKYQRKVSQAIKRA 69

Query: 73 RYLGLIAYV 81
          R+L L+ +V
Sbjct: 70 RHLALLPFV 78


>gi|332298063|ref|YP_004439985.1| 30S ribosomal protein S18 [Treponema brennaborense DSM 12168]
 gi|332181166|gb|AEE16854.1| 30S ribosomal protein S18 [Treponema brennaborense DSM 12168]
          Length = 103

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 6   PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
             P  +     R+K C    + A  IDYKD   L R+ ++RGKI+P RI+    K QR L
Sbjct: 27  RAPRSKGKTFFRKKVCRFCAQKAK-IDYKDADALRRYTTERGKILPRRITGTCAKHQRRL 85

Query: 66  AKAIKRARYLGLIAYV 81
           A  IKRAR + L+ +V
Sbjct: 86  ALEIKRARAICLLPFV 101


>gi|325279432|ref|YP_004251974.1| 30S ribosomal protein S18 [Odoribacter splanchnicus DSM 20712]
 gi|324311241|gb|ADY31794.1| 30S ribosomal protein S18 [Odoribacter splanchnicus DSM 20712]
          Length = 89

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 43/67 (64%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           ++K C         IDYKD   L +FL+++GKI+P RI+  S K QR++A A+KRAR+L
Sbjct: 19 KKKKYCRFRKARIKFIDYKDPEFLKKFLNEQGKILPRRITGTSVKFQRKVATAVKRARHL 78

Query: 76 GLIAYVN 82
           L+ YV 
Sbjct: 79 ALLPYVT 85


>gi|77919594|ref|YP_357409.1| 30S ribosomal protein S18 [Pelobacter carbinolicus DSM 2380]
 gi|123756603|sp|Q3A318|RS18_PELCD RecName: Full=30S ribosomal protein S18
 gi|77545677|gb|ABA89239.1| SSU ribosomal protein S18P [Pelobacter carbinolicus DSM 2380]
          Length = 91

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 44/76 (57%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P     R    RRK C        +IDYK+IR L  F+++RGKIVP RIS    + QR++
Sbjct: 10 PAKRSVRRRFSRRKGCRFCADNTLKIDYKEIRNLRYFITERGKIVPRRISGNCAEHQRKI 69

Query: 66 AKAIKRARYLGLIAYV 81
           +AIKRAR + L+ + 
Sbjct: 70 REAIKRARNIALLPFT 85


>gi|227486388|ref|ZP_03916704.1| possible ribosomal protein S18 [Anaerococcus lactolyticus ATCC
          51172]
 gi|227235569|gb|EEI85584.1| possible ribosomal protein S18 [Anaerococcus lactolyticus ATCC
          51172]
          Length = 74

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 45/71 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          + R    R+K  P     +  IDYKDI  L RF++ RGKI+P R++ ++ K QRE+ +AI
Sbjct: 1  MARRFKPRKKVDPFVKDPSKVIDYKDIETLKRFVTDRGKILPRRVTGLNAKHQREITRAI 60

Query: 70 KRARYLGLIAY 80
          KRAR + L+ Y
Sbjct: 61 KRARQVALLPY 71


>gi|15603919|ref|NP_220434.1| 30S ribosomal protein S18 [Rickettsia prowazekii str. Madrid E]
 gi|6226086|sp|Q9ZEA5|RS18_RICPR RecName: Full=30S ribosomal protein S18
 gi|3860610|emb|CAA14511.1| 30S RIBOSOMAL PROTEIN S18 (rpsR) [Rickettsia prowazekii]
 gi|292571636|gb|ADE29551.1| 30S ribosomal protein S18 [Rickettsia prowazekii Rp22]
          Length = 95

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 50/71 (70%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++    RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK
Sbjct: 21 KKVFFRRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIK 80

Query: 71 RARYLGLIAYV 81
           AR L L+ +V
Sbjct: 81 IARILALLPFV 91


>gi|154253799|ref|YP_001414623.1| 30S ribosomal protein S18 [Parvibaculum lavamentivorans DS-1]
 gi|205616358|sp|A7HYI3|RS18_PARL1 RecName: Full=30S ribosomal protein S18
 gi|154157749|gb|ABS64966.1| ribosomal protein S18 [Parvibaculum lavamentivorans DS-1]
          Length = 81

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 56/63 (88%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+L LI
Sbjct: 17 KTCPFSGANAPKIDYKDVKLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARFLALI 76

Query: 79 AYV 81
           YV
Sbjct: 77 PYV 79


>gi|313906073|ref|ZP_07839425.1| ribosomal protein S18 [Eubacterium cellulosolvens 6]
 gi|313469118|gb|EFR64468.1| ribosomal protein S18 [Eubacterium cellulosolvens 6]
          Length = 101

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C   G     IDYKD   L R++S+RGKI+P R++    K QR +  A+KRAR+L ++ Y
Sbjct: 40 CVFCG-KDNEIDYKDAAKLRRYISERGKILPRRVTGNCAKHQRAITLAVKRARHLAILPY 98

Query: 81 V 81
          V
Sbjct: 99 V 99


>gi|239946941|ref|ZP_04698694.1| ribosomal protein S18 [Rickettsia endosymbiont of Ixodes
          scapularis]
 gi|239921217|gb|EER21241.1| ribosomal protein S18 [Rickettsia endosymbiont of Ixodes
          scapularis]
          Length = 95

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 50/71 (70%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++    RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK
Sbjct: 21 KKVFFRRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIK 80

Query: 71 RARYLGLIAYV 81
           AR L L+ +V
Sbjct: 81 IARILALLPFV 91


>gi|187928273|ref|YP_001898760.1| 30S ribosomal protein S18 [Ralstonia pickettii 12J]
 gi|241662846|ref|YP_002981206.1| 30S ribosomal protein S18 [Ralstonia pickettii 12D]
 gi|309782228|ref|ZP_07676957.1| ribosomal protein S18 [Ralstonia sp. 5_7_47FAA]
 gi|187725163|gb|ACD26328.1| ribosomal protein S18 [Ralstonia pickettii 12J]
 gi|240864873|gb|ACS62534.1| ribosomal protein S18 [Ralstonia pickettii 12D]
 gi|308918999|gb|EFP64667.1| ribosomal protein S18 [Ralstonia sp. 5_7_47FAA]
          Length = 95

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 45/81 (55%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          A+       +  +  R+K C  +  G  +IDYKD+  L  F+ + GKI P+R++      
Sbjct: 11 AKNKKRFQQQNPLFKRKKFCRFTVAGVEQIDYKDLDTLKDFIGENGKITPARLTGTRAIY 70

Query: 62 QRELAKAIKRARYLGLIAYVN 82
          QR+L  AIKRAR+L L+ Y +
Sbjct: 71 QRQLDTAIKRARFLALMPYTD 91


>gi|42527183|ref|NP_972281.1| 30S ribosomal protein S18 [Treponema denticola ATCC 35405]
 gi|59798792|sp|Q73M34|RS18_TREDE RecName: Full=30S ribosomal protein S18
 gi|41817607|gb|AAS12192.1| ribosomal protein S18 [Treponema denticola ATCC 35405]
          Length = 89

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 43/72 (59%), Gaps = 1/72 (1%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +    +R+K C    +    IDYK+   L RF+++RGKI+P RI+    K QR+LA  I
Sbjct: 16 RKGRSFYRKKVCRFCAQKVK-IDYKEPDALRRFITERGKILPRRITGTCAKHQRKLAVEI 74

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ +V
Sbjct: 75 KRARAVALLPFV 86


>gi|83749657|ref|ZP_00946638.1| SSU ribosomal protein S18P [Ralstonia solanacearum UW551]
 gi|207723263|ref|YP_002253662.1| 30s ribosomal protein s18 [Ralstonia solanacearum MolK2]
 gi|207743342|ref|YP_002259734.1| 30s ribosomal protein s18 [Ralstonia solanacearum IPO1609]
 gi|83723659|gb|EAP70856.1| SSU ribosomal protein S18P [Ralstonia solanacearum UW551]
 gi|206588461|emb|CAQ35424.1| 30s ribosomal protein s18 [Ralstonia solanacearum MolK2]
 gi|206594739|emb|CAQ61666.1| 30s ribosomal protein s18 [Ralstonia solanacearum IPO1609]
          Length = 95

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 45/81 (55%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          A+       +  +  R+K C  +  G  +IDYKD+  L  F+ + GKI P+R++      
Sbjct: 11 AKNKKRFQQQNPLFKRKKFCRFTVAGVEQIDYKDLDTLKDFIGENGKITPARLTGTRSHY 70

Query: 62 QRELAKAIKRARYLGLIAYVN 82
          QR+L  AIKRAR+L L+ Y +
Sbjct: 71 QRQLDTAIKRARFLALMPYTD 91


>gi|317503266|ref|ZP_07961321.1| 30S ribosomal protein S18 [Prevotella salivae DSM 15606]
 gi|315665623|gb|EFV05235.1| 30S ribosomal protein S18 [Prevotella salivae DSM 15606]
          Length = 90

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 44/69 (63%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
           + ++K C     G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+AIKRAR
Sbjct: 18 DTRKKKYCRFKKSGIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAIKRAR 77

Query: 74 YLGLIAYVN 82
           + L+ YV 
Sbjct: 78 QIALLPYVT 86


>gi|301632590|ref|XP_002945365.1| PREDICTED: 30S ribosomal protein S18-like [Xenopus (Silurana)
          tropicalis]
          Length = 93

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 46/80 (57%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R++ C  +  G   IDYKD+  L  F+++ GKI+P+R++      Q
Sbjct: 10 DKRPKRNTQSLLFKRKRFCRFTVAGVEEIDYKDVDTLRDFIAENGKIIPARLTGTRAIYQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L ++ Y +
Sbjct: 70 RQLNTAIKRARFLAMLPYSD 89


>gi|312792728|ref|YP_004025651.1| 30S ribosomal protein S18 [Caldicellulosiruptor kristjanssonii
          177R1B]
 gi|312877716|ref|ZP_07737670.1| ribosomal protein S18 [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795517|gb|EFR11892.1| ribosomal protein S18 [Caldicellulosiruptor lactoaceticus 6A]
 gi|312179868|gb|ADQ40038.1| ribosomal protein S18 [Caldicellulosiruptor kristjanssonii
          177R1B]
          Length = 92

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 42/70 (60%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKR
Sbjct: 21 SRQKKKKRVCSFCVERIYEIDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKR 80

Query: 72 ARYLGLIAYV 81
          AR L L+ ++
Sbjct: 81 ARILALLPFI 90


>gi|171463205|ref|YP_001797318.1| ribosomal protein S18 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
 gi|229560050|sp|B1XTM7|RS18_POLNS RecName: Full=30S ribosomal protein S18
 gi|171192743|gb|ACB43704.1| ribosomal protein S18 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
          Length = 84

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 43/76 (56%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
              +  +  R++ C  +  G  +IDYKD+  L  F+ +  KI P+R++    K QR+L 
Sbjct: 5  KKPAQNPLFKRKRYCRFTVAGVEQIDYKDVDTLKGFIGENAKITPARLTGTKAKYQRQLD 64

Query: 67 KAIKRARYLGLIAYVN 82
           AIKRARYL L+ + +
Sbjct: 65 TAIKRARYLALLPFSD 80


>gi|302872491|ref|YP_003841127.1| ribosomal protein S18 [Caldicellulosiruptor obsidiansis OB47]
 gi|302575350|gb|ADL43141.1| ribosomal protein S18 [Caldicellulosiruptor obsidiansis OB47]
          Length = 92

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 42/70 (60%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKR
Sbjct: 21 SRQKKKKRVCSFCVERIYEIDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKR 80

Query: 72 ARYLGLIAYV 81
          AR L L+ ++
Sbjct: 81 ARILALLPFI 90


>gi|120435464|ref|YP_861150.1| 30S ribosomal protein S18 [Gramella forsetii KT0803]
 gi|205558459|sp|A0M0D8|RS18_GRAFK RecName: Full=30S ribosomal protein S18
 gi|117577614|emb|CAL66083.1| 30S ribosomal protein S18 [Gramella forsetii KT0803]
          Length = 99

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 43/67 (64%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          +  +K C     G   IDYKD   L  F++++GK++P R++  S K QR++A A+KRAR+
Sbjct: 28 TKAKKYCRFKRSGIKYIDYKDPDFLMGFVNEQGKLLPRRLTGTSLKFQRKVATAVKRARH 87

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 88 LALMPYV 94


>gi|255535655|ref|YP_003096026.1| SSU ribosomal protein S18p [Flavobacteriaceae bacterium 3519-10]
 gi|255341851|gb|ACU07964.1| SSU ribosomal protein S18p [Flavobacteriaceae bacterium 3519-10]
          Length = 100

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 43/69 (62%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
          N    +K C     G   +DYKD   L +F++++GKI+P R +  S K QR+++ AIKRA
Sbjct: 27 NTKTDKKYCRFKKYGIKHVDYKDANFLLQFVNEQGKILPRRYTGTSLKYQRKVSAAIKRA 86

Query: 73 RYLGLIAYV 81
          R+L ++ YV
Sbjct: 87 RHLAMMPYV 95


>gi|317050838|ref|YP_004111954.1| 30S ribosomal protein S18 [Desulfurispirillum indicum S5]
 gi|316945922|gb|ADU65398.1| ribosomal protein S18 [Desulfurispirillum indicum S5]
          Length = 123

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 41/72 (56%)

Query: 12  RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
           R    R+K C    +    IDYKD++ L  F+++R KI P R++    K QR LA AIKR
Sbjct: 51  RRRFGRKKVCAFCAEKVDYIDYKDVKRLRTFITERSKIKPRRMTGTCAKHQRSLATAIKR 110

Query: 72  ARYLGLIAYVNL 83
           +R + L+ +  L
Sbjct: 111 SRMMALLPFTAL 122


>gi|296444436|ref|ZP_06886401.1| ribosomal protein S18 [Methylosinus trichosporium OB3b]
 gi|296258083|gb|EFH05145.1| ribosomal protein S18 [Methylosinus trichosporium OB3b]
          Length = 78

 Score = 92.7 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 47/63 (74%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          KSCP SG  AP+IDYKD RLL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LGL+
Sbjct: 14 KSCPFSGANAPKIDYKDTRLLSRYISERGKIVPSRITAVSAKKQRELAQAIKRARFLGLL 73

Query: 79 AYV 81
           YV
Sbjct: 74 PYV 76


>gi|282882898|ref|ZP_06291503.1| ribosomal protein S18 [Peptoniphilus lacrimalis 315-B]
 gi|300813419|ref|ZP_07093767.1| ribosomal protein S18 [Peptoniphilus sp. oral taxon 836 str.
          F0141]
 gi|281297309|gb|EFA89800.1| ribosomal protein S18 [Peptoniphilus lacrimalis 315-B]
 gi|300512469|gb|EFK39621.1| ribosomal protein S18 [Peptoniphilus sp. oral taxon 836 str.
          F0141]
          Length = 74

 Score = 92.7 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 47/71 (66%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++R  + R+K  P       +IDYKD+ +L  ++S+RGKI+P RI+ ++ K QRE+  AI
Sbjct: 1  MQRRFTRRKKVDPFEKDKTKKIDYKDVDMLRNYISERGKILPRRITGLNAKHQREMTVAI 60

Query: 70 KRARYLGLIAY 80
          KRAR + LI Y
Sbjct: 61 KRARQIALIPY 71


>gi|95930451|ref|ZP_01313187.1| ribosomal protein S18 [Desulfuromonas acetoxidans DSM 684]
 gi|95133491|gb|EAT15154.1| ribosomal protein S18 [Desulfuromonas acetoxidans DSM 684]
          Length = 85

 Score = 92.7 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 45/71 (63%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    RRK C      + +IDYK++R L  F+S+RGKIVP RIS      QR++ +AIKR
Sbjct: 10 RRRFGRRKGCRFCADSSLKIDYKEVRTLRYFISERGKIVPRRISGNCATHQRKVTEAIKR 69

Query: 72 ARYLGLIAYVN 82
          AR + L+++ +
Sbjct: 70 ARNIALLSFTS 80


>gi|284047347|ref|YP_003397687.1| ribosomal protein S18 [Conexibacter woesei DSM 14684]
 gi|283951568|gb|ADB54312.1| ribosomal protein S18 [Conexibacter woesei DSM 14684]
          Length = 108

 Score = 92.7 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 44/67 (65%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S RRK CP   +   ++D+KDI  L +F+S+RGKI   RI+    + Q ++++A+KRAR 
Sbjct: 20 SSRRKPCPYCKEKVDQVDWKDIGSLRKFVSERGKIRSRRITGACRRHQNQVSRAVKRARE 79

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 80 LALLPYV 86


>gi|291285953|ref|YP_003502769.1| 30S ribosomal protein S18 [Denitrovibrio acetiphilus DSM 12809]
 gi|290883113|gb|ADD66813.1| ribosomal protein S18 [Denitrovibrio acetiphilus DSM 12809]
          Length = 76

 Score = 92.7 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 44/69 (63%), Gaps = 1/69 (1%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          +    R+K C    +    IDYKD++LL +F+++RGKI+P R++    + QR+LA A+K 
Sbjct: 5  KRRFQRKKVCRFCTETID-IDYKDVKLLRQFVTERGKIMPRRLTGTCARHQRQLATAVKT 63

Query: 72 ARYLGLIAY 80
          AR + L+ +
Sbjct: 64 ARIIALLPF 72


>gi|17546028|ref|NP_519430.1| 30S ribosomal protein S18 [Ralstonia solanacearum GMI1000]
 gi|300691703|ref|YP_003752698.1| 30S ribosomal protein S18 [Ralstonia solanacearum PSI07]
 gi|300704316|ref|YP_003745919.1| 30S ribosomal protein S18 [Ralstonia solanacearum CFBP2957]
 gi|20978684|sp|Q8XZT6|RS18_RALSO RecName: Full=30S ribosomal protein S18
 gi|17428323|emb|CAD15011.1| probable 30s ribosomal protein s18 [Ralstonia solanacearum
          GMI1000]
 gi|299067361|emb|CBJ38560.1| 30S ribosomal protein S18 [Ralstonia solanacearum CMR15]
 gi|299071980|emb|CBJ43310.1| 30S ribosomal protein S18 [Ralstonia solanacearum CFBP2957]
 gi|299078763|emb|CBJ51423.1| 30S ribosomal protein S18 [Ralstonia solanacearum PSI07]
          Length = 92

 Score = 92.7 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 45/81 (55%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          A+       +  +  R+K C  +  G  +IDYKD+  L  F+ + GKI P+R++      
Sbjct: 8  AKNKKRFQQQNPLFKRKKFCRFTVAGVEQIDYKDLDTLKDFIGENGKITPARLTGTRSHY 67

Query: 62 QRELAKAIKRARYLGLIAYVN 82
          QR+L  AIKRAR+L L+ Y +
Sbjct: 68 QRQLDTAIKRARFLALMPYTD 88


>gi|254504113|ref|ZP_05116264.1| ribosomal protein S18 [Labrenzia alexandrii DFL-11]
 gi|222440184|gb|EEE46863.1| ribosomal protein S18 [Labrenzia alexandrii DFL-11]
          Length = 82

 Score = 92.7 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 56/63 (88%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKDIRLL R++S+RGKIVPSRI++VS KKQREL++AIKRAR LGL+
Sbjct: 18 KTCPFSGSNAPKIDYKDIRLLQRYISERGKIVPSRITAVSAKKQRELSRAIKRARLLGLL 77

Query: 79 AYV 81
           +V
Sbjct: 78 PFV 80


>gi|328544026|ref|YP_004304135.1| 30S ribosomal protein S18 [polymorphum gilvum SL003B-26A1]
 gi|326413770|gb|ADZ70833.1| 30S ribosomal protein S18 [Polymorphum gilvum SL003B-26A1]
          Length = 82

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 47/63 (74%), Positives = 56/63 (88%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG GAP IDYKDIRLL R++S+RGKIVPSRI++VS KKQRELA+AIKRAR LGL+
Sbjct: 18 KTCPFSGAGAPAIDYKDIRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARLLGLL 77

Query: 79 AYV 81
           +V
Sbjct: 78 PFV 80


>gi|291545083|emb|CBL18192.1| SSU ribosomal protein S18P [Ruminococcus sp. 18P13]
          Length = 80

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 41/79 (51%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +      R     R+K C         IDYKDI  L + ++ R KI+P R++      QR
Sbjct: 1  MERERNSRGGKRPRKKVCMFCVDRVETIDYKDIARLRKCMTDRAKILPRRVTGTCAFHQR 60

Query: 64 ELAKAIKRARYLGLIAYVN 82
          EL  AIKRAR++ L+ YV+
Sbjct: 61 ELTVAIKRARHIALLPYVS 79


>gi|224368965|ref|YP_002603129.1| 30S ribosomal protein S18 [Desulfobacterium autotrophicum HRM2]
 gi|223691682|gb|ACN14965.1| RpsR [Desulfobacterium autotrophicum HRM2]
          Length = 83

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA     P  ++    RRK C         I YKD + L  F+++RGKI+P RI+    K
Sbjct: 1  MAFQKKNP--KKRFFQRRKVCRFCADSTLEISYKDAKALRSFITERGKIIPRRITGTCAK 58

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QR L+ AIK+AR + L+ YV
Sbjct: 59 HQRVLSSAIKQARTIALLPYV 79


>gi|182679260|ref|YP_001833406.1| 30S ribosomal protein S18 [Beijerinckia indica subsp. indica ATCC
          9039]
 gi|205557047|sp|B2IHD2|RS18_BEII9 RecName: Full=30S ribosomal protein S18
 gi|182635143|gb|ACB95917.1| ribosomal protein S18 [Beijerinckia indica subsp. indica ATCC
          9039]
          Length = 80

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD RLL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LGL+
Sbjct: 16 KTCPFSGPNAPKIDYKDTRLLSRYISERGKIVPSRITAVSAKKQRELAQAIKRARFLGLL 75

Query: 79 AYV 81
           YV
Sbjct: 76 PYV 78


>gi|163755338|ref|ZP_02162458.1| 30S ribosomal protein S18 [Kordia algicida OT-1]
 gi|161324758|gb|EDP96087.1| 30S ribosomal protein S18 [Kordia algicida OT-1]
          Length = 98

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 44/67 (65%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          +  +K C     G   IDYKD   L +F++++GK++P R++  S K QR+++ A+KRAR+
Sbjct: 27 TKAKKYCRFKKSGIKYIDYKDPDFLLKFVNEQGKLLPRRLTGTSLKYQRKVSVAVKRARH 86

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 87 LALMPYV 93


>gi|291280361|ref|YP_003497196.1| 30S ribosomal protein S18 [Deferribacter desulfuricans SSM1]
 gi|290755063|dbj|BAI81440.1| 30S ribosomal protein S18 [Deferribacter desulfuricans SSM1]
          Length = 76

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    R+K C    +    IDYKD  LL +F ++RGKI+P R++    K QR LA AIK 
Sbjct: 5  RRRFQRQKVCKFCTEHID-IDYKDANLLKQFTTERGKIMPRRLTGTCAKHQRRLADAIKT 63

Query: 72 ARYLGLIAYV 81
          AR + L+ + 
Sbjct: 64 ARIMALLPFT 73


>gi|205562295|sp|A9KKC8|RS18_CLOPH RecName: Full=30S ribosomal protein S18
          Length = 76

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 20 SCPLSGKGA-PRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
           C          IDYKD+  L R++S+RGKI+P RI+    K QR L  A+KRAR++ L+
Sbjct: 12 VCAFCADKNHKEIDYKDVNKLKRYVSERGKILPRRITGNCAKHQRALTVAVKRARHIALM 71

Query: 79 AYV 81
           Y 
Sbjct: 72 PYT 74


>gi|150025893|ref|YP_001296719.1| 30S ribosomal protein S18 [Flavobacterium psychrophilum JIP02/86]
 gi|205557707|sp|A6H0P2|RS18_FLAPJ RecName: Full=30S ribosomal protein S18
 gi|149772434|emb|CAL43916.1| 30S ribosomal protein S18 [Flavobacterium psychrophilum JIP02/86]
          Length = 98

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/66 (40%), Positives = 42/66 (63%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
            +K C     G   IDYKD   L +F++++GKI+P R++  S K QR+++ A+KRAR+L
Sbjct: 28 KTKKYCRFKKSGIKYIDYKDADFLLKFVNEQGKILPRRLTGTSLKYQRKVSVAVKRARHL 87

Query: 76 GLIAYV 81
            + YV
Sbjct: 88 AFMPYV 93


>gi|218961877|ref|YP_001741652.1| 30S ribosomal subunit protein S18 [Candidatus Cloacamonas
          acidaminovorans]
 gi|167730534|emb|CAO81446.1| 30S ribosomal subunit protein S18 [Candidatus Cloacamonas
          acidaminovorans]
          Length = 78

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 37/61 (60%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C        +IDYK+I +L  ++S+ GKI P+R++    K QR+L   IKRAR + LI Y
Sbjct: 16 CRFCANKEIQIDYKNIDVLKPYISEVGKIEPARLTGTCAKHQRKLTTEIKRARQMALIPY 75

Query: 81 V 81
          V
Sbjct: 76 V 76


>gi|317486567|ref|ZP_07945388.1| ribosomal protein S18 [Bilophila wadsworthia 3_1_6]
 gi|316922167|gb|EFV43432.1| ribosomal protein S18 [Bilophila wadsworthia 3_1_6]
          Length = 87

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 39/72 (54%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++  + RRK C         +DYK   +L  ++++RGKI+  RI+    K QR L+  I
Sbjct: 3  FKKKFAPRRKFCRFCADADLPLDYKRPDILRDYITERGKIIARRITGTCAKHQRLLSTEI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ Y 
Sbjct: 63 KRARQMALLFYT 74


>gi|218886447|ref|YP_002435768.1| 30S ribosomal protein S18 [Desulfovibrio vulgaris str. 'Miyazaki
          F']
 gi|226735112|sp|B8DRL3|RS18_DESVM RecName: Full=30S ribosomal protein S18
 gi|218757401|gb|ACL08300.1| ribosomal protein S18 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 87

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 38/72 (52%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++  + RRK C         +DYK   +L  F+++RGKI+  RI+      QR L + I
Sbjct: 3  FKKKFTPRRKFCRFCADKDLPLDYKRADILRDFITERGKIIARRITGTCAHHQRLLTREI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ Y 
Sbjct: 63 KRARQMALLFYT 74


>gi|83644550|ref|YP_432985.1| ribosomal protein S18 [Hahella chejuensis KCTC 2396]
 gi|123739986|sp|Q2SLB4|RS18_HAHCH RecName: Full=30S ribosomal protein S18
 gi|83632593|gb|ABC28560.1| ribosomal protein S18 [Hahella chejuensis KCTC 2396]
          Length = 76

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+ +L  ++++ GKIVPSRI+    + QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDVEVLKGYITETGKIVPSRITGTKARYQRQLATAIKRARYLALLPYTD 72


>gi|15600127|ref|NP_253621.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa PAO1]
 gi|107104033|ref|ZP_01367951.1| hypothetical protein PaerPA_01005106 [Pseudomonas aeruginosa
          PACS2]
 gi|116053083|ref|YP_793402.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152988792|ref|YP_001350982.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa PA7]
 gi|218894029|ref|YP_002442898.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa LESB58]
 gi|254238351|ref|ZP_04931674.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa C3719]
 gi|254244175|ref|ZP_04937497.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa 2192]
 gi|296391774|ref|ZP_06881249.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa PAb1]
 gi|313109936|ref|ZP_07795864.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa 39016]
 gi|20978739|sp|Q9HUN0|RS18_PSEAE RecName: Full=30S ribosomal protein S18
 gi|122256904|sp|Q02F84|RS18_PSEAB RecName: Full=30S ribosomal protein S18
 gi|166220975|sp|A6VD47|RS18_PSEA7 RecName: Full=30S ribosomal protein S18
 gi|226735123|sp|B7V1Z7|RS18_PSEA8 RecName: Full=30S ribosomal protein S18
 gi|9951213|gb|AAG08319.1|AE004906_7 30S ribosomal protein S18 [Pseudomonas aeruginosa PAO1]
 gi|115588304|gb|ABJ14319.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126170282|gb|EAZ55793.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa C3719]
 gi|126197553|gb|EAZ61616.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa 2192]
 gi|150963950|gb|ABR85975.1| ribosomal protein S18 [Pseudomonas aeruginosa PA7]
 gi|218774257|emb|CAW30074.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa LESB58]
 gi|310882366|gb|EFQ40960.1| 30S ribosomal protein S18 [Pseudomonas aeruginosa 39016]
          Length = 76

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/59 (52%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++S+ GKIVPSRI+    K QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLNTLKAYVSETGKIVPSRITGTKAKYQRQLATAIKRARYLALLPYTD 72


>gi|295093121|emb|CBK82212.1| SSU ribosomal protein S18P [Coprococcus sp. ART55/1]
          Length = 87

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 47/80 (58%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
           + A  P+ RRN+  R+K C         IDYKD   L +++S+RGKI+P RI+    K 
Sbjct: 6  TDRADAPMKRRNIRRRKKVCEYCANKEAVIDYKDSNALRKYISERGKILPRRITGTCAKH 65

Query: 62 QRELAKAIKRARYLGLIAYV 81
          QR +  A+KRAR + ++ YV
Sbjct: 66 QRAITIAVKRARQIAILPYV 85


>gi|295697816|ref|YP_003591054.1| ribosomal protein S18 [Bacillus tusciae DSM 2912]
 gi|295413418|gb|ADG07910.1| ribosomal protein S18 [Bacillus tusciae DSM 2912]
          Length = 76

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 37/62 (59%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C        R+DYKD   L +++++RGKI+P RIS    + QR++  A+KRAR + L+ 
Sbjct: 13 VCNFCVDKIDRVDYKDADRLRKYMTERGKILPRRISGNCARHQRQVTVAVKRARQVALLP 72

Query: 80 YV 81
          Y 
Sbjct: 73 YT 74


>gi|242279494|ref|YP_002991623.1| 30S ribosomal protein S18 [Desulfovibrio salexigens DSM 2638]
 gi|259494806|sp|C6BVA9|RS18_DESAD RecName: Full=30S ribosomal protein S18
 gi|242122388|gb|ACS80084.1| ribosomal protein S18 [Desulfovibrio salexigens DSM 2638]
          Length = 86

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 39/74 (52%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +R  + +RK C         +DYK   +L  F+++RGKI+  RI+    K QR L   I
Sbjct: 3  FKRKFTPKRKFCRFCADKNLPLDYKRPDILKDFVTERGKIIARRITGTCAKHQRRLTTEI 62

Query: 70 KRARYLGLIAYVNL 83
          KR+R + L+ Y  +
Sbjct: 63 KRSRQMALMHYTTV 76


>gi|297563757|ref|YP_003682731.1| ribosomal protein S18 [Nocardiopsis dassonvillei subsp.
          dassonvillei DSM 43111]
 gi|296848205|gb|ADH70225.1| ribosomal protein S18 [Nocardiopsis dassonvillei subsp.
          dassonvillei DSM 43111]
          Length = 78

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C    +    IDYKD  LL +F+S+RGKI   R++    + QR++A AIK AR + L+ 
Sbjct: 13 VCLFCQEKQSYIDYKDTTLLRKFISERGKIRARRVTGNCTQHQRDVATAIKNAREVALLP 72

Query: 80 YVN 82
          Y +
Sbjct: 73 YTS 75


>gi|254784760|ref|YP_003072188.1| 30S ribosomal protein S18 [Teredinibacter turnerae T7901]
 gi|259494820|sp|C5BN46|RS18_TERTT RecName: Full=30S ribosomal protein S18
 gi|237683566|gb|ACR10830.1| ribosomal protein S18 [Teredinibacter turnerae T7901]
          Length = 75

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/59 (50%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  +IDYKD+  L  ++S+ GKIVPSRI+    K QR+LA A+KRARYL L+ Y +
Sbjct: 14 TAEGVKQIDYKDLETLKAYISETGKIVPSRITGTKAKYQRQLATAVKRARYLALLPYTD 72


>gi|163815607|ref|ZP_02206980.1| hypothetical protein COPEUT_01782 [Coprococcus eutactus ATCC
          27759]
 gi|158449244|gb|EDP26239.1| hypothetical protein COPEUT_01782 [Coprococcus eutactus ATCC
          27759]
          Length = 87

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 47/80 (58%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
           + A  P+ RRN+  R+K C         IDYKD   L +++S+RGKI+P RI+    K 
Sbjct: 6  TDRADAPMKRRNIRRRKKVCEYCANKEAVIDYKDSNALRKYISERGKILPRRITGTCAKH 65

Query: 62 QRELAKAIKRARYLGLIAYV 81
          QR +  A+KRAR + ++ YV
Sbjct: 66 QRAITIAVKRARQIAVLPYV 85


>gi|146296359|ref|YP_001180130.1| 30S ribosomal protein S18 [Caldicellulosiruptor saccharolyticus
          DSM 8903]
 gi|205557109|sp|A4XJ54|RS18_CALS8 RecName: Full=30S ribosomal protein S18
 gi|145409935|gb|ABP66939.1| SSU ribosomal protein S18P [Caldicellulosiruptor saccharolyticus
          DSM 8903]
          Length = 91

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 42/70 (60%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKR
Sbjct: 20 SRQKKKKRVCSFCVERIYDIDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKR 79

Query: 72 ARYLGLIAYV 81
          AR L L+ ++
Sbjct: 80 ARILALLPFI 89


>gi|260587267|ref|ZP_05853180.1| ribosomal protein S18 [Blautia hansenii DSM 20583]
 gi|331083585|ref|ZP_08332696.1| hypothetical protein HMPREF0992_01620 [Lachnospiraceae bacterium
          6_1_63FAA]
 gi|260542462|gb|EEX23031.1| ribosomal protein S18 [Blautia hansenii DSM 20583]
 gi|330403796|gb|EGG83348.1| hypothetical protein HMPREF0992_01620 [Lachnospiraceae bacterium
          6_1_63FAA]
          Length = 87

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/79 (40%), Positives = 45/79 (56%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
              +P+ RR    R+K C   G+    I YKD   L R++S+RGKI+P RI+    K Q
Sbjct: 7  NRPDSPMKRRGGRRRKKVCVFCGQENNEISYKDANKLKRYVSERGKILPRRITGNCAKHQ 66

Query: 63 RELAKAIKRARYLGLIAYV 81
          R L   IK+AR+L ++ YV
Sbjct: 67 RALTVEIKKARHLAIMPYV 85


>gi|154498399|ref|ZP_02036777.1| hypothetical protein BACCAP_02388 [Bacteroides capillosus ATCC
          29799]
 gi|150272467|gb|EDM99652.1| hypothetical protein BACCAP_02388 [Bacteroides capillosus ATCC
          29799]
          Length = 79

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 36/64 (56%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYKD   L RFLS+R KI+P R +      QR+L +AIKRAR + L+
Sbjct: 15 KVCTFCVDKVEHIDYKDAVKLRRFLSERSKILPRRTTGTCAMHQRQLTEAIKRARQIALL 74

Query: 79 AYVN 82
           YV 
Sbjct: 75 PYVT 78


>gi|325105010|ref|YP_004274664.1| SSU ribosomal protein S18P [Pedobacter saltans DSM 12145]
 gi|324973858|gb|ADY52842.1| SSU ribosomal protein S18P [Pedobacter saltans DSM 12145]
          Length = 87

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 45/67 (67%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R+K C     G   IDYKD   L +F++ +GKI+P R++  S K QR++A+A+KRAR +
Sbjct: 17 NRKKYCRFKKNGIKYIDYKDANFLLKFINDQGKILPRRLTGTSLKYQRKVAQAVKRARII 76

Query: 76 GLIAYVN 82
          G++ +V 
Sbjct: 77 GILPFVT 83


>gi|237757030|ref|ZP_04585482.1| ribosomal protein S18 [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237690810|gb|EEP59966.1| ribosomal protein S18 [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 79

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +     R+K C    +     +YKDI  L  F+S+RGKI+PSRIS    K QR+LA  IK
Sbjct: 8  KPYFPKRKKYCKFCAEKKEP-NYKDIETLKGFISERGKIIPSRISGTCAKHQRKLAVEIK 66

Query: 71 RARYLGLIAYV 81
          +AR L L+ YV
Sbjct: 67 KARQLALLPYV 77


>gi|222530063|ref|YP_002573945.1| 30S ribosomal protein S18 [Caldicellulosiruptor bescii DSM 6725]
 gi|222456910|gb|ACM61172.1| ribosomal protein S18 [Caldicellulosiruptor bescii DSM 6725]
          Length = 92

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 42/70 (60%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
               +++ C    +    IDYKD+  L +FL++RGKI+P R +    + QR+L +AIKR
Sbjct: 21 SRQKKKKRVCSFCVERIYEIDYKDVNRLKKFLTERGKIMPRRTTGNCARHQRQLTRAIKR 80

Query: 72 ARYLGLIAYV 81
          AR L L+ ++
Sbjct: 81 ARILALLPFI 90


>gi|329896991|ref|ZP_08271784.1| SSU ribosomal protein S18p [gamma proteobacterium IMCC3088]
 gi|328921499|gb|EGG28884.1| SSU ribosomal protein S18p [gamma proteobacterium IMCC3088]
          Length = 75

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  +IDYKD+  L  ++++ GKIVPSRI+    K QR+LA A+KRARYL L+ Y +
Sbjct: 14 TAEGVKQIDYKDLETLKAYITETGKIVPSRITGTKAKYQRQLATAVKRARYLALLPYTD 72


>gi|281424416|ref|ZP_06255329.1| ribosomal protein S18 [Prevotella oris F0302]
 gi|299140845|ref|ZP_07033983.1| ribosomal protein S18 [Prevotella oris C735]
 gi|281401685|gb|EFB32516.1| ribosomal protein S18 [Prevotella oris F0302]
 gi|298577811|gb|EFI49679.1| ribosomal protein S18 [Prevotella oris C735]
          Length = 90

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 44/69 (63%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
           + ++K C     G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR
Sbjct: 18 DTRKKKYCRFKKSGIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRAR 77

Query: 74 YLGLIAYVN 82
           + L+ YV 
Sbjct: 78 QIALLPYVT 86


>gi|227508138|ref|ZP_03938187.1| 30S ribosomal protein S18 [Lactobacillus brevis subsp.
          gravesensis ATCC 27305]
 gi|227511162|ref|ZP_03941211.1| 30S ribosomal protein S18 [Lactobacillus buchneri ATCC 11577]
 gi|227523349|ref|ZP_03953398.1| 30S ribosomal protein S18 [Lactobacillus hilgardii ATCC 8290]
 gi|227085644|gb|EEI20956.1| 30S ribosomal protein S18 [Lactobacillus buchneri ATCC 11577]
 gi|227089455|gb|EEI24767.1| 30S ribosomal protein S18 [Lactobacillus hilgardii ATCC 8290]
 gi|227192367|gb|EEI72434.1| 30S ribosomal protein S18 [Lactobacillus brevis subsp.
          gravesensis ATCC 27305]
          Length = 78

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 44/63 (69%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYKD+ LL RF+S+RGKI+P R++  S K QR+L  AIKRAR +GL+
Sbjct: 13 KVDFIAANHIEYIDYKDVDLLKRFVSERGKILPRRVTGTSAKNQRKLTIAIKRARIMGLM 72

Query: 79 AYV 81
          ++V
Sbjct: 73 SFV 75


>gi|86130271|ref|ZP_01048871.1| 30S ribosomal protein S18 [Dokdonia donghaensis MED134]
 gi|332293237|ref|YP_004431846.1| ribosomal protein S18 [Krokinobacter diaphorus 4H-3-7-5]
 gi|85818946|gb|EAQ40105.1| 30S ribosomal protein S18 [Dokdonia donghaensis MED134]
 gi|332171323|gb|AEE20578.1| ribosomal protein S18 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 98

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 26/67 (38%), Positives = 42/67 (62%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
            +K C     G   +DYKD   L  F++++GK++P R++  S K QR+++ A+KRAR+L
Sbjct: 28 KAKKYCRFKKSGIKYVDYKDADWLAGFVNEQGKLLPRRLTGTSLKYQRKVSVAVKRARHL 87

Query: 76 GLIAYVN 82
           L+ YV 
Sbjct: 88 ALMPYVT 94


>gi|32491010|ref|NP_871264.1| hypothetical protein WGLp261 [Wigglesworthia glossinidia
          endosymbiont of Glossina brevipalpis]
 gi|31340412|sp|Q8D2U3|RS18_WIGBR RecName: Full=30S ribosomal protein S18
 gi|25166216|dbj|BAC24407.1| rpsR [Wigglesworthia glossinidia endosymbiont of Glossina
          brevipalpis]
          Length = 75

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/70 (45%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +    IDYKDI LL  ++++ GKIVPSRI+    + QR+L++A+KRA
Sbjct: 3  RNFRRRKFCRFTLEKINNIDYKDIILLKNYITENGKIVPSRITGTRARYQRQLSRAVKRA 62

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 63 RYLSLLPYTD 72


>gi|257789801|ref|YP_003180407.1| 30S ribosomal protein S18 [Eggerthella lenta DSM 2243]
 gi|317489260|ref|ZP_07947777.1| ribosomal protein S18 [Eggerthella sp. 1_3_56FAA]
 gi|325832274|ref|ZP_08165273.1| ribosomal protein S18 [Eggerthella sp. HGA1]
 gi|257473698|gb|ACV54018.1| ribosomal protein S18 [Eggerthella lenta DSM 2243]
 gi|316911661|gb|EFV33253.1| ribosomal protein S18 [Eggerthella sp. 1_3_56FAA]
 gi|325486110|gb|EGC88564.1| ribosomal protein S18 [Eggerthella sp. HGA1]
          Length = 86

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 8/80 (10%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M++ A  P        RRK C    +    IDYKD ++L ++++ RGKI P R++    +
Sbjct: 1  MSDYAKQP--------RRKFCQFCKEDTQYIDYKDTQMLRKYVTDRGKIKPRRVTGACTQ 52

Query: 61 KQRELAKAIKRARYLGLIAY 80
           QR++A A+KRAR + L+ Y
Sbjct: 53 HQRDIANAVKRAREMALMPY 72


>gi|189501828|ref|YP_001957545.1| 30S ribosomal protein S18 [Candidatus Amoebophilus asiaticus 5a2]
 gi|189497269|gb|ACE05816.1| hypothetical protein Aasi_0398 [Candidatus Amoebophilus asiaticus
          5a2]
          Length = 83

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              ++K C     G   +DYK++  L RFL+++GKI+P RIS  S K Q+++A+AIKRA
Sbjct: 10 RRHTKKKYCRFKKLGIKYVDYKNLDFLFRFLNEQGKILPRRISGNSLKYQKKVAQAIKRA 69

Query: 73 RYLGLIAYVN 82
          R+L L+ YV 
Sbjct: 70 RHLALLPYVT 79


>gi|160944120|ref|ZP_02091350.1| hypothetical protein FAEPRAM212_01622 [Faecalibacterium
          prausnitzii M21/2]
 gi|313113168|ref|ZP_07798794.1| ribosomal protein S18 [Faecalibacterium cf. prausnitzii KLE1255]
 gi|158444796|gb|EDP21800.1| hypothetical protein FAEPRAM212_01622 [Faecalibacterium
          prausnitzii M21/2]
 gi|310624507|gb|EFQ07836.1| ribosomal protein S18 [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 71

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/66 (40%), Positives = 40/66 (60%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R+K C         IDYKD+  L +++S+R KI+P R++      QR L  AIKRAR++ 
Sbjct: 5  RKKVCSFCVDRIDTIDYKDVPRLRKYVSERAKIIPRRVTGTCAYHQRALTIAIKRARHVA 64

Query: 77 LIAYVN 82
          L+ YV+
Sbjct: 65 LMPYVS 70


>gi|15618861|ref|NP_225147.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae CWL029]
 gi|15836485|ref|NP_301009.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae J138]
 gi|16752078|ref|NP_445444.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae AR39]
 gi|33242320|ref|NP_877261.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae TW-183]
 gi|6707742|sp|Q9Z6V4|RS18_CHLPN RecName: Full=30S ribosomal protein S18
 gi|4377277|gb|AAD19090.1| S18 Ribosomal Protein [Chlamydophila pneumoniae CWL029]
 gi|7189819|gb|AAF38692.1| ribosomal protein S18 [Chlamydophila pneumoniae AR39]
 gi|8979326|dbj|BAA99160.1| S18 ribosomal protein [Chlamydophila pneumoniae J138]
 gi|33236831|gb|AAP98918.1| 30S ribosomal protein S18 [Chlamydophila pneumoniae TW-183]
 gi|269302744|gb|ACZ32844.1| ribosomal protein S18 [Chlamydophila pneumoniae LPCoLN]
          Length = 82

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 45/69 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
                K CP    G   IDYKD+  L +F+++RGK++P RI+ VS + Q  L++AIKRA
Sbjct: 11 RRKRFNKKCPFVSAGWKTIDYKDVETLKKFITERGKVLPRRITGVSSRFQGVLSQAIKRA 70

Query: 73 RYLGLIAYV 81
          R+LGL+ +V
Sbjct: 71 RHLGLLPFV 79


>gi|68171814|ref|ZP_00545152.1| Ribosomal protein S18 [Ehrlichia chaffeensis str. Sapulpa]
 gi|88657819|ref|YP_507130.1| 30S ribosomal protein S18 [Ehrlichia chaffeensis str. Arkansas]
 gi|123722798|sp|Q2GHF3|RS18_EHRCR RecName: Full=30S ribosomal protein S18
 gi|67998763|gb|EAM85477.1| Ribosomal protein S18 [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599276|gb|ABD44745.1| putative ribosomal protein S18 [Ehrlichia chaffeensis str.
          Arkansas]
          Length = 95

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 52/77 (67%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          +P   L+R    R K+CPL       IDYK+  LL++F S+ G+I+PSRI+SVS +KQR 
Sbjct: 19 SPLAYLKRPYFKRSKACPLEQCPNEDIDYKNKGLLSKFTSEYGRILPSRITSVSSRKQRL 78

Query: 65 LAKAIKRARYLGLIAYV 81
          L+ A+KRARYL L+ Y 
Sbjct: 79 LSTAVKRARYLALLPYC 95


>gi|157803227|ref|YP_001491776.1| 30S ribosomal protein S18 [Rickettsia canadensis str. McKiel]
 gi|166220984|sp|A8EXA8|RS18_RICCK RecName: Full=30S ribosomal protein S18
 gi|157784490|gb|ABV72991.1| 30S ribosomal protein S18 [Rickettsia canadensis str. McKiel]
          Length = 95

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 50/71 (70%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++    RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK
Sbjct: 21 KKVFFRRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIK 80

Query: 71 RARYLGLIAYV 81
           AR L L+ +V
Sbjct: 81 IARILALLPFV 91


>gi|229496127|ref|ZP_04389848.1| ribosomal protein S18 [Porphyromonas endodontalis ATCC 35406]
 gi|229316958|gb|EEN82870.1| ribosomal protein S18 [Porphyromonas endodontalis ATCC 35406]
          Length = 90

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 46/69 (66%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
           S+++K C     G   IDYKD   L +FL+++G+I+P RI+  S K QR +A+A+KRAR
Sbjct: 18 DSNKKKYCRFKKSGIKYIDYKDPEFLKKFLNEQGRILPRRITGTSLKFQRRIARAVKRAR 77

Query: 74 YLGLIAYVN 82
          +L L+ +V 
Sbjct: 78 HLALLPFVT 86


>gi|269925896|ref|YP_003322519.1| ribosomal protein S18 [Thermobaculum terrenum ATCC BAA-798]
 gi|269789556|gb|ACZ41697.1| ribosomal protein S18 [Thermobaculum terrenum ATCC BAA-798]
          Length = 116

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 38/71 (53%)

Query: 11  RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
           R     RRK C        ++DYKDI  + R+LS R KI   R +    K QR LA A+K
Sbjct: 40  RGRYVPRRKVCAFCADHIDKVDYKDIARIGRYLSDRAKIEGRRKTGTCAKHQRSLAVALK 99

Query: 71  RARYLGLIAYV 81
           RARY+ L+ Y 
Sbjct: 100 RARYMALMPYT 110


>gi|163788027|ref|ZP_02182473.1| 30S ribosomal protein S18 [Flavobacteriales bacterium ALC-1]
 gi|159876347|gb|EDP70405.1| 30S ribosomal protein S18 [Flavobacteriales bacterium ALC-1]
          Length = 98

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 43/67 (64%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S  +K C     G   +DYKD   L  F++++GK++P R++  S K QR+++ A+KRAR+
Sbjct: 27 SKTKKYCRFKKSGIKYVDYKDADWLLGFVNEQGKLLPRRLTGTSLKYQRKVSVAVKRARH 86

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 87 LALMPYV 93


>gi|28376983|ref|NP_783875.1| 30S ribosomal protein S18 [Lactobacillus plantarum WCFS1]
 gi|254555178|ref|YP_003061595.1| 30S ribosomal protein S18 [Lactobacillus plantarum JDM1]
 gi|300769114|ref|ZP_07079003.1| 30S ribosomal protein S18 [Lactobacillus plantarum subsp.
          plantarum ATCC 14917]
 gi|308179200|ref|YP_003923328.1| 30S ribosomal protein S18 [Lactobacillus plantarum subsp.
          plantarum ST-III]
 gi|38258549|sp|Q890K0|RS18_LACPL RecName: Full=30S ribosomal protein S18
 gi|28269814|emb|CAD62711.1| ribosomal protein S18 [Lactobacillus plantarum WCFS1]
 gi|254044105|gb|ACT60898.1| 30S ribosomal protein S18 [Lactobacillus plantarum JDM1]
 gi|300493354|gb|EFK28533.1| 30S ribosomal protein S18 [Lactobacillus plantarum subsp.
          plantarum ATCC 14917]
 gi|308044691|gb|ADN97234.1| 30S ribosomal protein S18 [Lactobacillus plantarum subsp.
          plantarum ST-III]
          Length = 78

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 43/64 (67%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K   ++      IDYKD  LL RF+S+RGKI+P R++  S K QR L  AIKRAR +GL+
Sbjct: 13 KVDFIAANHIEYIDYKDTDLLRRFISERGKILPRRVTGTSAKNQRSLTIAIKRARIMGLL 72

Query: 79 AYVN 82
          A+V+
Sbjct: 73 AFVS 76


>gi|89900979|ref|YP_523450.1| 30S ribosomal protein S18 [Rhodoferax ferrireducens T118]
 gi|123397182|sp|Q21WD4|RS18_RHOFD RecName: Full=30S ribosomal protein S18
 gi|89345716|gb|ABD69919.1| SSU ribosomal protein S18P [Rhodoferax ferrireducens T118]
          Length = 94

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (57%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R++ C  +  G   IDYKDI  L  F+++ GKI+P+R++      Q
Sbjct: 11 DKRPKRPAQNLLFKRKRFCRFTVTGVEEIDYKDIDTLRDFIAENGKIIPARLTGTRAIFQ 70

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L ++ Y +
Sbjct: 71 RQLNTAIKRARFLAMLPYSD 90


>gi|67458534|ref|YP_246158.1| 30S ribosomal protein S18 [Rickettsia felis URRWXCal2]
 gi|75536999|sp|Q4UN65|RS18_RICFE RecName: Full=30S ribosomal protein S18
 gi|67004067|gb|AAY60993.1| 30S ribosomal protein S18 [Rickettsia felis URRWXCal2]
          Length = 95

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 50/71 (70%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++    RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK
Sbjct: 21 KKVFFRRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIK 80

Query: 71 RARYLGLIAYV 81
           AR L L+ +V
Sbjct: 81 IARILALLPFV 91


>gi|315640348|ref|ZP_07895464.1| 30S ribosomal protein S18 [Enterococcus italicus DSM 15952]
 gi|315483884|gb|EFU74364.1| 30S ribosomal protein S18 [Enterococcus italicus DSM 15952]
          Length = 78

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 40/63 (63%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
             L+      +DYKDI LL RF+S+RGKI+P R++    K QR+L  AIKRAR +GL+ 
Sbjct: 14 VDYLAANHIEHVDYKDIELLKRFISERGKILPRRVTGTGAKNQRKLTIAIKRARIMGLLP 73

Query: 80 YVN 82
          +  
Sbjct: 74 FAT 76


>gi|302543993|ref|ZP_07296335.1| ribosomal protein S18 [Streptomyces hygroscopicus ATCC 53653]
 gi|307329989|ref|ZP_07609141.1| ribosomal protein S18 [Streptomyces violaceusniger Tu 4113]
 gi|302461611|gb|EFL24704.1| ribosomal protein S18 [Streptomyces himastatinicus ATCC 53653]
 gi|306884365|gb|EFN15399.1| ribosomal protein S18 [Streptomyces violaceusniger Tu 4113]
          Length = 78

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 36/63 (57%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C    +    +DYKD  LL +F+S RGKI   R++    + QR++A A+K +R + L+ 
Sbjct: 13 VCVFCKEKISYVDYKDTNLLRKFISDRGKIRARRVTGNCTQHQRDVATAVKNSREMALLP 72

Query: 80 YVN 82
          Y +
Sbjct: 73 YTS 75


>gi|145588609|ref|YP_001155206.1| ribosomal protein S18 [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
 gi|189029683|sp|A4SVX8|RS18_POLSQ RecName: Full=30S ribosomal protein S18
 gi|145047015|gb|ABP33642.1| SSU ribosomal protein S18P [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
          Length = 90

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 43/77 (55%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
               +  +  R++ C  +  G  +IDYKD+  L  F+ +  KI P+R++    K QR+L
Sbjct: 10 KKKPAQNPLFKRKRYCRFTVAGVEQIDYKDVDTLKDFIGENAKITPARLTGTKAKYQRQL 69

Query: 66 AKAIKRARYLGLIAYVN 82
            AIKRARYL L+ + +
Sbjct: 70 DTAIKRARYLALLPFSD 86


>gi|330443831|ref|YP_004376817.1| 30S ribosomal protein S18 [Chlamydophila pecorum E58]
 gi|328806941|gb|AEB41114.1| ribosomal protein S18 [Chlamydophila pecorum E58]
          Length = 82

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/69 (47%), Positives = 44/69 (63%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
                K CP    G   IDYKD+  L +F+++RGKI+P RI+ VS + Q  LA+AIKRA
Sbjct: 11 RRKRFNKKCPFVSAGWKTIDYKDVETLKKFITERGKILPRRITGVSSRFQGILAQAIKRA 70

Query: 73 RYLGLIAYV 81
          R LGL+ +V
Sbjct: 71 RLLGLLPFV 79


>gi|312138605|ref|YP_004005941.1| 30S ribosomal protein s18 rpsr [Rhodococcus equi 103S]
 gi|325676329|ref|ZP_08156008.1| 30S ribosomal protein S18 [Rhodococcus equi ATCC 33707]
 gi|311887944|emb|CBH47256.1| 30S ribosomal protein S18 RpsR [Rhodococcus equi 103S]
 gi|325552890|gb|EGD22573.1| 30S ribosomal protein S18 [Rhodococcus equi ATCC 33707]
          Length = 84

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          + +P+   R     R K  PL   G   +DYKD+ LL  F+S RGKI   R++ ++ ++Q
Sbjct: 4  KRSPSRKSRGEQGRRPKKNPLIAAGIETVDYKDVNLLRTFISDRGKIRSRRVTGLTPQQQ 63

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R++A A+K AR + L+ + +
Sbjct: 64 RQVAVAVKNAREMALLPFTS 83


>gi|283768493|ref|ZP_06341405.1| ribosomal protein S18 [Bulleidia extructa W1219]
 gi|283104885|gb|EFC06257.1| ribosomal protein S18 [Bulleidia extructa W1219]
          Length = 76

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 41/72 (56%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R+    RRK C  +      IDYKD+ LL +F+S   KI P R++    K QR LA AI
Sbjct: 3  FRKQRMGRRKVCYFTKNNIKFIDYKDVELLKKFISPNAKITPRRVTGTRAKYQRPLAIAI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ YV
Sbjct: 63 KRARQMALLPYV 74


>gi|149372600|ref|ZP_01891712.1| 30S ribosomal protein S18 [unidentified eubacterium SCB49]
 gi|149354643|gb|EDM43207.1| 30S ribosomal protein S18 [unidentified eubacterium SCB49]
          Length = 98

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 44/67 (65%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           ++K C     G   +DYKD   L RF++++GK++P R++  S K QR++A A+KR+R+L
Sbjct: 28 KQKKYCRFKKSGIKYVDYKDGEWLLRFVNEQGKLLPRRLTGTSLKYQRKVAVAVKRSRHL 87

Query: 76 GLIAYVN 82
           L+ YV 
Sbjct: 88 ALMPYVT 94


>gi|158319027|ref|YP_001511535.1| 30S ribosomal protein S18 [Frankia sp. EAN1pec]
 gi|288921430|ref|ZP_06415708.1| ribosomal protein S18 [Frankia sp. EUN1f]
 gi|229559985|sp|A8L8T2|RS18_FRASN RecName: Full=30S ribosomal protein S18
 gi|158114432|gb|ABW16629.1| ribosomal protein S18 [Frankia sp. EAN1pec]
 gi|288347164|gb|EFC81463.1| ribosomal protein S18 [Frankia sp. EUN1f]
          Length = 78

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 38/69 (55%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             ++K C         IDYKD  LL +F+S RGKI   R++    + QR++A A+K +R
Sbjct: 7  RKPKKKVCVFCKDKVHYIDYKDTSLLRKFISDRGKIRARRVTGNCSQHQRDVATAVKNSR 66

Query: 74 YLGLIAYVN 82
           + L+ Y +
Sbjct: 67 EMALLPYTS 75


>gi|254283309|ref|ZP_04958277.1| ribosomal protein S18 [gamma proteobacterium NOR51-B]
 gi|219679512|gb|EED35861.1| ribosomal protein S18 [gamma proteobacterium NOR51-B]
          Length = 75

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L +++++ GKIVPSRI+    K QR+LA A+KRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLETLKQYVTETGKIVPSRITGTKAKYQRQLATAVKRARYLALLPYSD 72


>gi|284034855|ref|YP_003384786.1| 30S ribosomal protein S18 [Kribbella flavida DSM 17836]
 gi|283814148|gb|ADB35987.1| ribosomal protein S18 [Kribbella flavida DSM 17836]
          Length = 77

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 41/74 (55%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + +     ++K C      A  +DYKD  LL +F+S RGKI   R++    + QR++A A
Sbjct: 1  MAKIIRKPKKKVCGFCKDKATYVDYKDTALLRKFISDRGKIRARRVTGNCVQHQRDVATA 60

Query: 69 IKRARYLGLIAYVN 82
          IK AR + L+ Y +
Sbjct: 61 IKNAREVALLPYTS 74


>gi|225016117|ref|ZP_03705350.1| hypothetical protein CLOSTMETH_00061 [Clostridium methylpentosum
          DSM 5476]
 gi|224951114|gb|EEG32323.1| hypothetical protein CLOSTMETH_00061 [Clostridium methylpentosum
          DSM 5476]
          Length = 77

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 43/71 (60%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    R+K C         IDYKDI  L R++S+R KIVP R++    + QR+L  A+KR
Sbjct: 6  RGRRGRKKVCAFCVDKVENIDYKDIAKLRRYMSERAKIVPRRVTGTCARHQRQLTVAVKR 65

Query: 72 ARYLGLIAYVN 82
          AR+L ++ Y++
Sbjct: 66 ARHLAMLPYIS 76


>gi|220905285|ref|YP_002480597.1| 30S ribosomal protein S18 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. ATCC 27774]
 gi|254765423|sp|B8J3A9|RS18_DESDA RecName: Full=30S ribosomal protein S18
 gi|219869584|gb|ACL49919.1| ribosomal protein S18 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. ATCC 27774]
          Length = 87

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 38/72 (52%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++  + RRK C         ++YK   +L  F+++RGKI+  RI+      QR L + I
Sbjct: 3  FKKKFAPRRKFCRFCADKDLPLNYKRPDILRDFITERGKIIARRITGTCAHHQRLLTREI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ Y 
Sbjct: 63 KRARQMALLIYT 74


>gi|148657503|ref|YP_001277708.1| 30S ribosomal protein S18 [Roseiflexus sp. RS-1]
 gi|205556677|sp|A5UYQ5|RS182_ROSS1 RecName: Full=30S ribosomal protein S18 2
 gi|148569613|gb|ABQ91758.1| SSU ribosomal protein S18P [Roseiflexus sp. RS-1]
          Length = 90

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         +DYKD++ L R +S+RGKI+P R + V  + QR L  AIKRAR++ L+
Sbjct: 22 KVCMFCADQIRVVDYKDVKRLQRCMSERGKILPRRRTGVCARHQRSLTVAIKRARHMALL 81

Query: 79 AYV 81
           +V
Sbjct: 82 PFV 84


>gi|90020705|ref|YP_526532.1| 30S ribosomal protein S18 [Saccharophagus degradans 2-40]
 gi|122996417|sp|Q21LV9|RS18_SACD2 RecName: Full=30S ribosomal protein S18
 gi|89950305|gb|ABD80320.1| SSU ribosomal protein S18P [Saccharophagus degradans 2-40]
          Length = 75

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++S+ GKIVPSRI+    K QR+LA AIKRAR++ L+ Y +
Sbjct: 14 TAEGVKSIDYKDLDTLKAYVSETGKIVPSRITGTKAKYQRQLATAIKRARFIALLPYTD 72


>gi|109900046|ref|YP_663301.1| ribosomal protein S18 [Pseudoalteromonas atlantica T6c]
 gi|332308094|ref|YP_004435945.1| ribosomal protein S18 [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|123064136|sp|Q15PE1|RS18_PSEA6 RecName: Full=30S ribosomal protein S18
 gi|109702327|gb|ABG42247.1| SSU ribosomal protein S18P [Pseudoalteromonas atlantica T6c]
 gi|332175423|gb|AEE24677.1| ribosomal protein S18 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 75

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/59 (52%), Positives = 43/59 (72%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          S  G  +IDYKDI +L  ++++ GKIVPSRI+  S K QR+L+ AIKRAR+L L+ Y +
Sbjct: 14 SADGVVQIDYKDIAMLKNYVTESGKIVPSRITGTSAKYQRQLSTAIKRARFLALLPYTD 72


>gi|255530652|ref|YP_003091024.1| 30S ribosomal protein S18 [Pedobacter heparinus DSM 2366]
 gi|255343636|gb|ACU02962.1| ribosomal protein S18 [Pedobacter heparinus DSM 2366]
          Length = 87

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 47/70 (67%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          +   +R+K C     G   IDYKD   L +F++ +GKI+P R++  S K QR++A+A+KR
Sbjct: 13 KVDDNRKKYCRFRKNGIKYIDYKDANFLLKFINDQGKILPRRLTGTSLKFQRKVAQAVKR 72

Query: 72 ARYLGLIAYV 81
          AR++GL+ +V
Sbjct: 73 ARHIGLLPFV 82


>gi|89094156|ref|ZP_01167099.1| 30S ribosomal protein S18 [Oceanospirillum sp. MED92]
 gi|89081631|gb|EAR60860.1| 30S ribosomal protein S18 [Oceanospirillum sp. MED92]
          Length = 75

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRAR++ L+ Y +
Sbjct: 14 TAEGVQEIDYKDLDTLKGYITETGKIVPSRITGTKARYQRQLATAIKRARFVALLPYTD 72


>gi|57239413|ref|YP_180549.1| 30S ribosomal protein S18 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58579385|ref|YP_197597.1| 30S ribosomal protein S18 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58617440|ref|YP_196639.1| 30S ribosomal protein S18 [Ehrlichia ruminantium str. Gardel]
 gi|75507479|sp|Q5FG28|RS18_EHRRG RecName: Full=30S ribosomal protein S18
 gi|81672777|sp|Q5HAJ5|RS18_EHRRW RecName: Full=30S ribosomal protein S18
 gi|57161492|emb|CAH58418.1| 30S ribosomal protein S18 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58417052|emb|CAI28165.1| 30S ribosomal protein S18 [Ehrlichia ruminantium str. Gardel]
 gi|58418011|emb|CAI27215.1| 30S ribosomal protein S18 [Ehrlichia ruminantium str.
          Welgevonden]
          Length = 95

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 39/77 (50%), Positives = 52/77 (67%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          +P   L+R    R K+CPL       IDYK+  LL++F S+ G+I+PSRI+SVS +KQR 
Sbjct: 19 SPLAYLKRPYFRRSKACPLEQCANEDIDYKNKALLSKFTSEYGRILPSRITSVSSRKQRL 78

Query: 65 LAKAIKRARYLGLIAYV 81
          L+ AIKRARYL L+ Y 
Sbjct: 79 LSTAIKRARYLALLPYC 95


>gi|88704449|ref|ZP_01102163.1| 30S ribosomal protein S18 [Congregibacter litoralis KT71]
 gi|88701500|gb|EAQ98605.1| 30S ribosomal protein S18 [Congregibacter litoralis KT71]
          Length = 75

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++S+ GKIVPSRI+    K QR+L+ A+KRAR+L L+ Y +
Sbjct: 14 TAEGVKEIDYKDLDTLKAYISETGKIVPSRITGTKAKYQRQLSTAVKRARFLALLPYTD 72


>gi|312200937|ref|YP_004020998.1| ribosomal protein S18 [Frankia sp. EuI1c]
 gi|311232273|gb|ADP85128.1| ribosomal protein S18 [Frankia sp. EuI1c]
          Length = 78

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 38/69 (55%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             ++K C         IDYKD  LL +F+S RGKI   R++    + QR++A A+K +R
Sbjct: 7  RKPKKKVCVFCKDKTEYIDYKDTSLLRKFISDRGKIRARRVTGNCSQHQRDVAIAVKNSR 66

Query: 74 YLGLIAYVN 82
           + L+ Y +
Sbjct: 67 EMALLPYTS 75


>gi|118587178|ref|ZP_01544606.1| ribosomal protein S18 [Oenococcus oeni ATCC BAA-1163]
 gi|118432320|gb|EAV39058.1| ribosomal protein S18 [Oenococcus oeni ATCC BAA-1163]
          Length = 106

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 39/62 (62%)

Query: 20  SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
              L+      +DYKD  LL RF++  GKI+P RI+  S K QR++A AIKRAR + L+ 
Sbjct: 42  VDYLAVNHIDYVDYKDTELLQRFIADNGKILPRRITGTSSKNQRKIATAIKRARIMALLP 101

Query: 80  YV 81
           +V
Sbjct: 102 FV 103


>gi|91214893|ref|ZP_01251866.1| ribosomal protein S18 [Psychroflexus torquis ATCC 700755]
 gi|91187320|gb|EAS73690.1| ribosomal protein S18 [Psychroflexus torquis ATCC 700755]
          Length = 98

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 43/67 (64%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            + + C     G   +DYK+   L  F++++GKI+P R++  S K QR++++AIKR+R+
Sbjct: 27 KSKTRFCRFKRAGIKYVDYKNADFLMEFVNEQGKILPRRLTGTSLKYQRKVSQAIKRSRH 86

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 87 LALMPYV 93


>gi|213962614|ref|ZP_03390875.1| ribosomal protein S18 [Capnocytophaga sputigena Capno]
 gi|256820494|ref|YP_003141773.1| 30S ribosomal protein S18 [Capnocytophaga ochracea DSM 7271]
 gi|315223595|ref|ZP_07865450.1| 30S ribosomal protein S18 [Capnocytophaga ochracea F0287]
 gi|213954609|gb|EEB65930.1| ribosomal protein S18 [Capnocytophaga sputigena Capno]
 gi|256582077|gb|ACU93212.1| ribosomal protein S18 [Capnocytophaga ochracea DSM 7271]
 gi|314946511|gb|EFS98505.1| 30S ribosomal protein S18 [Capnocytophaga ochracea F0287]
          Length = 92

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 45/67 (67%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S ++K C     G   IDYKD   L +F++++GK++P R++  S K QR++A A+KRAR+
Sbjct: 21 SKQKKYCRFKKSGIKYIDYKDADFLLKFVNEQGKLLPRRLTGTSLKFQRKVATAVKRARH 80

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 81 LALMPYV 87


>gi|146283969|ref|YP_001174122.1| 30S ribosomal protein S18 [Pseudomonas stutzeri A1501]
 gi|166220978|sp|A4VQM9|RS18_PSEU5 RecName: Full=30S ribosomal protein S18
 gi|145572174|gb|ABP81280.1| 30S ribosomal protein S18 [Pseudomonas stutzeri A1501]
 gi|327482297|gb|AEA85607.1| 30S ribosomal protein S18 [Pseudomonas stutzeri DSM 4166]
          Length = 76

 Score = 91.6 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 30/59 (50%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLNTLKAYISETGKIVPSRITGTKARYQRQLATAIKRARYLALLPYTD 72


>gi|51473301|ref|YP_067058.1| 30S ribosomal protein S18 [Rickettsia typhi str. Wilmington]
 gi|59798674|sp|Q68XR6|RS18_RICTY RecName: Full=30S ribosomal protein S18
 gi|51459613|gb|AAU03576.1| 30S ribosomal protein S18 [Rickettsia typhi str. Wilmington]
          Length = 95

 Score = 91.6 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 50/71 (70%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++    RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK
Sbjct: 21 KKVFFRRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIK 80

Query: 71 RARYLGLIAYV 81
           AR L L+ +V
Sbjct: 81 IARILALLPFV 91


>gi|163853340|ref|YP_001641383.1| ribosomal protein S18 [Methylobacterium extorquens PA1]
 gi|188583606|ref|YP_001927051.1| 30S ribosomal protein S18 [Methylobacterium populi BJ001]
 gi|218532197|ref|YP_002423013.1| 30S ribosomal protein S18 [Methylobacterium chloromethanicum CM4]
 gi|240140756|ref|YP_002965236.1| 30S ribosomal protein S18 [Methylobacterium extorquens AM1]
 gi|254563266|ref|YP_003070361.1| 30S ribosomal protein S18 [Methylobacterium extorquens DM4]
 gi|205558286|sp|A9W8G3|RS18_METEP RecName: Full=30S ribosomal protein S18
 gi|205558291|sp|B1ZFQ7|RS18_METPB RecName: Full=30S ribosomal protein S18
 gi|254812946|sp|B7L2P1|RS18_METC4 RecName: Full=30S ribosomal protein S18
 gi|163664945|gb|ABY32312.1| ribosomal protein S18 [Methylobacterium extorquens PA1]
 gi|179347104|gb|ACB82516.1| ribosomal protein S18 [Methylobacterium populi BJ001]
 gi|218524500|gb|ACK85085.1| ribosomal protein S18 [Methylobacterium chloromethanicum CM4]
 gi|240010733|gb|ACS41959.1| 30S ribosomal protein S18 [Methylobacterium extorquens AM1]
 gi|254270544|emb|CAX26547.1| 30S ribosomal protein S18 [Methylobacterium extorquens DM4]
          Length = 84

 Score = 91.6 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 59/63 (93%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          KSCP SG+ AP+IDYKD++LL+R++S+RGKIVPSRI++VS KKQRELA+AIKR+R+LGL+
Sbjct: 20 KSCPFSGENAPKIDYKDVKLLSRYVSERGKIVPSRITAVSAKKQRELAQAIKRSRFLGLL 79

Query: 79 AYV 81
           YV
Sbjct: 80 PYV 82


>gi|46579370|ref|YP_010178.1| 30S ribosomal protein S18 [Desulfovibrio vulgaris str.
          Hildenborough]
 gi|120603072|ref|YP_967472.1| 30S ribosomal protein S18 [Desulfovibrio vulgaris DP4]
 gi|59798765|sp|Q72DH2|RS18_DESVH RecName: Full=30S ribosomal protein S18
 gi|166220950|sp|A1VF29|RS18_DESVV RecName: Full=30S ribosomal protein S18
 gi|46448784|gb|AAS95437.1| ribosomal protein S18 [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563301|gb|ABM29045.1| SSU ribosomal protein S18P [Desulfovibrio vulgaris DP4]
 gi|311233195|gb|ADP86049.1| ribosomal protein S18 [Desulfovibrio vulgaris RCH1]
          Length = 87

 Score = 91.6 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 38/72 (52%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++  + RRK C         IDYK   +L  F+++RGKI+  RI+      QR L + I
Sbjct: 3  FKKKFAPRRKFCRFCADKELPIDYKRADILRDFITERGKIIARRITGTCAHHQRVLTREI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ Y 
Sbjct: 63 KRARQMALLIYT 74


>gi|261414896|ref|YP_003248579.1| ribosomal protein S18 [Fibrobacter succinogenes subsp.
          succinogenes S85]
 gi|261371352|gb|ACX74097.1| ribosomal protein S18 [Fibrobacter succinogenes subsp.
          succinogenes S85]
 gi|302326241|gb|ADL25442.1| ribosomal protein S18 [Fibrobacter succinogenes subsp.
          succinogenes S85]
          Length = 83

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 46/73 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +     R+K+C  +      IDYKD + L RF+S+RGKI+P RIS  S K QR L +AI
Sbjct: 7  KQATRIRRKKTCWFTENNVKFIDYKDEKTLRRFISERGKIIPRRISGTSAKYQRMLNEAI 66

Query: 70 KRARYLGLIAYVN 82
          KRAR + ++ +V+
Sbjct: 67 KRARQMAILPFVS 79


>gi|56461038|ref|YP_156319.1| ribosomal protein S18 [Idiomarina loihiensis L2TR]
 gi|81678373|sp|Q5QY03|RS18_IDILO RecName: Full=30S ribosomal protein S18
 gi|56180048|gb|AAV82770.1| Ribosomal protein S18 [Idiomarina loihiensis L2TR]
          Length = 75

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 41/58 (70%)

Query: 25 GKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
            G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+LA+AIKRARYL L+ Y +
Sbjct: 15 ADGVKEIDYKDIATLKNYITETGKIVPSRITGTSAKYQRQLARAIKRARYLSLLPYTD 72


>gi|307946729|ref|ZP_07662064.1| ribosomal protein S18 [Roseibium sp. TrichSKD4]
 gi|307770393|gb|EFO29619.1| ribosomal protein S18 [Roseibium sp. TrichSKD4]
          Length = 82

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 43/61 (70%), Positives = 53/61 (86%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          CP SG  +P+IDYKD RLL R++S+RGKIVPSRI++VS KKQRELA+AIKRAR LGL+ +
Sbjct: 20 CPFSGANSPKIDYKDTRLLQRYISERGKIVPSRITAVSAKKQRELARAIKRARLLGLLPF 79

Query: 81 V 81
          V
Sbjct: 80 V 80


>gi|289641251|ref|ZP_06473418.1| ribosomal protein S18 [Frankia symbiont of Datisca glomerata]
 gi|289509013|gb|EFD29945.1| ribosomal protein S18 [Frankia symbiont of Datisca glomerata]
          Length = 78

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 38/69 (55%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             ++K C         IDYKD  LL +F+S RGKI   R++    + QR++A A+K +R
Sbjct: 7  RKPKKKVCVFCKDKTDYIDYKDTSLLRKFISDRGKIRARRVTGNCSQHQRDIAIAVKNSR 66

Query: 74 YLGLIAYVN 82
           + L+ Y +
Sbjct: 67 EMALLPYTS 75


>gi|260063156|ref|YP_003196236.1| 30S ribosomal protein S18 [Robiginitalea biformata HTCC2501]
 gi|88783250|gb|EAR14422.1| ribosomal protein S18 [Robiginitalea biformata HTCC2501]
          Length = 98

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 44/67 (65%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S  +K C     G   IDYKD   L + ++++GKI+P R++  S K QR++A+AIKR+R+
Sbjct: 27 SKEKKYCRFKKSGIKYIDYKDPDFLMKLVNEQGKILPRRLTGTSLKYQRKVAQAIKRSRH 86

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 87 LALMPYV 93


>gi|169824836|ref|YP_001692447.1| 30S ribosomal protein S18 [Finegoldia magna ATCC 29328]
 gi|297587219|ref|ZP_06945864.1| 30S ribosomal protein S18 [Finegoldia magna ATCC 53516]
 gi|302379548|ref|ZP_07268033.1| ribosomal protein S18 [Finegoldia magna ACS-171-V-Col3]
 gi|303234545|ref|ZP_07321182.1| ribosomal protein S18 [Finegoldia magna BVS033A4]
 gi|167831641|dbj|BAG08557.1| 30S ribosomal protein S18 [Finegoldia magna ATCC 29328]
 gi|297575200|gb|EFH93919.1| 30S ribosomal protein S18 [Finegoldia magna ATCC 53516]
 gi|302312455|gb|EFK94451.1| ribosomal protein S18 [Finegoldia magna ACS-171-V-Col3]
 gi|302494379|gb|EFL54148.1| ribosomal protein S18 [Finegoldia magna BVS033A4]
          Length = 74

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 45/71 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++R    R+K  P        IDYKD+ +L  ++S+RGKI+P R++ ++ K QR++  AI
Sbjct: 1  MQRRFRPRKKIDPFQKDKTKVIDYKDVNMLKNYISERGKILPRRVTGLNAKHQRQITDAI 60

Query: 70 KRARYLGLIAY 80
          K+AR + L+ Y
Sbjct: 61 KKARQVALLPY 71


>gi|260219660|emb|CBA26505.1| 30S ribosomal protein S18 [Curvibacter putative symbiont of Hydra
          magnipapillata]
          Length = 93

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (57%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R++ C  +  G   IDYKDI  L  F+++ GKI+P+R++      Q
Sbjct: 10 DKRPKRNTQSLLFKRKRFCRFTVTGVEEIDYKDIDTLRDFIAENGKIIPARLTGTRAIFQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L ++ Y +
Sbjct: 70 RQLNTAIKRARFLAMLPYSD 89


>gi|167750475|ref|ZP_02422602.1| hypothetical protein EUBSIR_01451 [Eubacterium siraeum DSM 15702]
 gi|167656626|gb|EDS00756.1| hypothetical protein EUBSIR_01451 [Eubacterium siraeum DSM 15702]
 gi|291530826|emb|CBK96411.1| SSU ribosomal protein S18P [Eubacterium siraeum 70/3]
 gi|291557667|emb|CBL34784.1| SSU ribosomal protein S18P [Eubacterium siraeum V10Sc8a]
          Length = 99

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/84 (36%), Positives = 45/84 (53%), Gaps = 2/84 (2%)

Query: 1  MAEVAP--TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVS 58
          M+E        +R     R+K C      A  IDYKD+  L + +++R KI+P R++   
Sbjct: 15 MSEREKNEKSTVRPMKRTRKKVCAFCADRAEFIDYKDVAKLRKCMTERYKILPRRVTGCC 74

Query: 59 HKKQRELAKAIKRARYLGLIAYVN 82
             QREL  AIK+AR + LI YV+
Sbjct: 75 AYHQRELTTAIKKARQVALIPYVS 98


>gi|91788895|ref|YP_549847.1| 30S ribosomal protein S18 [Polaromonas sp. JS666]
 gi|123059688|sp|Q128U3|RS18_POLSJ RecName: Full=30S ribosomal protein S18
 gi|91698120|gb|ABE44949.1| SSU ribosomal protein S18P [Polaromonas sp. JS666]
          Length = 94

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 46/80 (57%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +  P    +  +  R++ C  +  G   IDYKDI  L  F+++ GKI+P+R++      Q
Sbjct: 10 DKRPKRNTQSLLFKRKRFCRFTAAGVEEIDYKDIDTLRDFVAENGKIIPARLTGTRAIFQ 69

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R++  A+KRAR+L ++ Y +
Sbjct: 70 RQINTAVKRARFLAMLPYSD 89


>gi|226315507|ref|YP_002775403.1| 30S ribosomal protein S18 [Brevibacillus brevis NBRC 100599]
 gi|254765413|sp|C0ZA45|RS18_BREBN RecName: Full=30S ribosomal protein S18
 gi|226098457|dbj|BAH46899.1| 30S ribosomal protein S18 [Brevibacillus brevis NBRC 100599]
          Length = 76

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 43/72 (59%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +   + RRK C         IDYKDI LL +F+S+RGKI+P R++  S K QR L  AI
Sbjct: 3  RKGRPNKRRKVCFFKVNKIKHIDYKDIDLLKKFISERGKILPRRVTGTSAKYQRALTIAI 62

Query: 70 KRARYLGLIAYV 81
          KR+R + L+ Y 
Sbjct: 63 KRSRQVALLPYT 74


>gi|256829608|ref|YP_003158336.1| 30S riboosomal protein S18 [Desulfomicrobium baculatum DSM 4028]
 gi|256578784|gb|ACU89920.1| ribosomal protein S18 [Desulfomicrobium baculatum DSM 4028]
          Length = 87

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 40/72 (55%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++  + RRK C         +DYK   +LN F++ RGKI+ SRI+    K QR L + +
Sbjct: 3  FKKKFAPRRKYCRFCENPEILLDYKHPEVLNDFVTDRGKIIASRITGTCAKHQRALTREV 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ Y 
Sbjct: 63 KRARQMALMFYT 74


>gi|29840574|ref|NP_829680.1| 30S ribosomal protein S18 [Chlamydophila caviae GPIC]
 gi|33301610|sp|Q821W8|RS18_CHLCV RecName: Full=30S ribosomal protein S18
 gi|29834924|gb|AAP05558.1| ribosomal protein S18 [Chlamydophila caviae GPIC]
          Length = 82

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 42/69 (60%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
                K CP    G   IDYKD   L +F+++RGKI+P RI+ VS + Q  L  AIKRA
Sbjct: 11 RRKRFNKKCPFVSAGWKTIDYKDTETLKKFITERGKILPRRITGVSSRFQGTLTLAIKRA 70

Query: 73 RYLGLIAYV 81
          R++GL+ +V
Sbjct: 71 RHIGLLPFV 79


>gi|332881934|ref|ZP_08449576.1| ribosomal protein S18 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
 gi|332680169|gb|EGJ53124.1| ribosomal protein S18 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
          Length = 92

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 45/67 (67%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S ++K C     G   IDYKD   L +F++++GK++P R++  S K QR++A A+KRAR+
Sbjct: 21 SKQKKYCRFKKLGIKYIDYKDADFLLKFVNEQGKLLPRRLTGTSLKFQRKVATAVKRARH 80

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 81 LALMPYV 87


>gi|225181169|ref|ZP_03734615.1| ribosomal protein S18 [Dethiobacter alkaliphilus AHT 1]
 gi|225168138|gb|EEG76943.1| ribosomal protein S18 [Dethiobacter alkaliphilus AHT 1]
          Length = 76

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 36/64 (56%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C         IDYK    L RF+++RGKI+P RIS    K QR+L  AIKRAR + L+
Sbjct: 12 KVCNFCVDKVQNIDYKLTGKLARFVTERGKILPRRISGNCAKHQRQLTIAIKRARNIALL 71

Query: 79 AYVN 82
           Y  
Sbjct: 72 PYST 75


>gi|158319096|ref|YP_001511603.1| ribosomal protein S18 [Alkaliphilus oremlandii OhILAs]
 gi|205556770|sp|A8MED6|RS18_ALKOO RecName: Full=30S ribosomal protein S18
 gi|158139295|gb|ABW17607.1| ribosomal protein S18 [Alkaliphilus oremlandii OhILAs]
          Length = 78

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C      +  IDYKD+  L +++++RGKI+P RIS      QREL +AIKR+R++ L+ 
Sbjct: 15 ICVFCADKSKNIDYKDVHKLKKYITERGKILPRRISGNCAIHQRELTQAIKRSRHIALLP 74

Query: 80 YV 81
          Y 
Sbjct: 75 YT 76


>gi|92113017|ref|YP_572945.1| SSU ribosomal protein S18P [Chromohalobacter salexigens DSM 3043]
 gi|123084170|sp|Q1QZ62|RS18_CHRSD RecName: Full=30S ribosomal protein S18
 gi|91796107|gb|ABE58246.1| SSU ribosomal protein S18P [Chromohalobacter salexigens DSM 3043]
          Length = 75

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKDI  L  ++++ GKIVPSRI+    + QR+L+ AIKRARYL L+ Y +
Sbjct: 14 TAEGVKYIDYKDIDTLKSYITETGKIVPSRITGTKARYQRQLSTAIKRARYLALLPYTD 72


>gi|171059509|ref|YP_001791858.1| 30S ribosomal protein S18 [Leptothrix cholodnii SP-6]
 gi|229560044|sp|B1XXH3|RS18_LEPCP RecName: Full=30S ribosomal protein S18
 gi|170776954|gb|ACB35093.1| ribosomal protein S18 [Leptothrix cholodnii SP-6]
          Length = 94

 Score = 91.2 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 44/80 (55%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +       +  +  R++ C  +  G   IDYKD+ +L  F+ + GKI P+R++      Q
Sbjct: 11 DRKTKRNQQSLLFKRKRFCRFTVTGVKEIDYKDLDVLRDFVGENGKITPARLTGTRAFFQ 70

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R+L  AIKRAR+L L+ Y +
Sbjct: 71 RQLTTAIKRARFLALLPYSD 90


>gi|326796491|ref|YP_004314311.1| 30S ribosomal protein S18 [Marinomonas mediterranea MMB-1]
 gi|326547255|gb|ADZ92475.1| 30S ribosomal protein S18 [Marinomonas mediterranea MMB-1]
          Length = 76

 Score = 91.2 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRARY+ L+ Y +
Sbjct: 14 TAEGVKEIDYKDLDTLKGYITETGKIVPSRITGTKARYQRQLATAIKRARYIALLPYTD 72


>gi|271970520|ref|YP_003344716.1| 30S ribosomal protein S18 [Streptosporangium roseum DSM 43021]
 gi|270513695|gb|ACZ91973.1| 30S ribosomal protein S18 [Streptosporangium roseum DSM 43021]
          Length = 78

 Score = 91.2 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 43/76 (56%), Gaps = 3/76 (3%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
           P LR+    ++K C         +DYKD  LL +F+S RGKI   R++    + QR++A
Sbjct: 3  KPALRKP---KKKVCLFCHDKISYVDYKDTALLRKFISDRGKIRARRVTGNCTQHQRDVA 59

Query: 67 KAIKRARYLGLIAYVN 82
           AIK AR + L+ Y++
Sbjct: 60 TAIKNAREMALLPYMS 75


>gi|27364783|ref|NP_760311.1| 30S ribosomal protein S18 [Vibrio vulnificus CMCP6]
 gi|28899512|ref|NP_799117.1| 30S ribosomal protein S18 [Vibrio parahaemolyticus RIMD 2210633]
 gi|37681166|ref|NP_935775.1| 30S ribosomal protein S18 [Vibrio vulnificus YJ016]
 gi|84393175|ref|ZP_00991939.1| 30S ribosomal protein S18 [Vibrio splendidus 12B01]
 gi|86148223|ref|ZP_01066520.1| 30S ribosomal protein S18 [Vibrio sp. MED222]
 gi|91227275|ref|ZP_01261700.1| 30S ribosomal protein S18 [Vibrio alginolyticus 12G01]
 gi|148981037|ref|ZP_01816257.1| 30S ribosomal protein S18 [Vibrionales bacterium SWAT-3]
 gi|149191590|ref|ZP_01869835.1| 30S ribosomal protein S18 [Vibrio shilonii AK1]
 gi|153835847|ref|ZP_01988514.1| ribosomal protein S18 [Vibrio harveyi HY01]
 gi|153846004|ref|ZP_01993817.1| ribosomal protein S18 [Vibrio parahaemolyticus AQ3810]
 gi|156972401|ref|YP_001443308.1| 30S ribosomal protein S18 [Vibrio harveyi ATCC BAA-1116]
 gi|163803111|ref|ZP_02196995.1| 30S ribosomal protein S18 [Vibrio sp. AND4]
 gi|218708334|ref|YP_002415955.1| 30S ribosomal protein S18 [Vibrio splendidus LGP32]
 gi|260366343|ref|ZP_05778789.1| ribosomal protein S18 [Vibrio parahaemolyticus K5030]
 gi|260767147|ref|ZP_05876091.1| SSU ribosomal protein S18p [Vibrio furnissii CIP 102972]
 gi|260773678|ref|ZP_05882594.1| SSU ribosomal protein S18p [Vibrio metschnikovii CIP 69.14]
 gi|260775635|ref|ZP_05884532.1| SSU ribosomal protein S18p [Vibrio coralliilyticus ATCC BAA-450]
 gi|260879410|ref|ZP_05891765.1| ribosomal protein S18 [Vibrio parahaemolyticus AN-5034]
 gi|260896871|ref|ZP_05905367.1| ribosomal protein S18 [Vibrio parahaemolyticus Peru-466]
 gi|260902023|ref|ZP_05910418.1| ribosomal protein S18 [Vibrio parahaemolyticus AQ4037]
 gi|261254037|ref|ZP_05946610.1| SSU ribosomal protein S18p [Vibrio orientalis CIP 102891]
 gi|262393107|ref|YP_003284961.1| 30S ribosomal protein S18p [Vibrio sp. Ex25]
 gi|269961474|ref|ZP_06175838.1| 30S ribosomal protein S18 [Vibrio harveyi 1DA3]
 gi|269964320|ref|ZP_06178568.1| 30S ribosomal protein S18 [Vibrio harveyi 1DA3]
 gi|269964440|ref|ZP_06178681.1| 30S ribosomal protein S18 [Vibrio alginolyticus 40B]
 gi|312881936|ref|ZP_07741693.1| 30S ribosomal protein S18 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|320155177|ref|YP_004187556.1| 30S ribosomal protein S18p [Vibrio vulnificus MO6-24/O]
 gi|323493029|ref|ZP_08098164.1| 30S ribosomal protein S18 [Vibrio brasiliensis LMG 20546]
 gi|323496054|ref|ZP_08101114.1| 30S ribosomal protein S18 [Vibrio sinaloensis DSM 21326]
 gi|54039420|sp|P66479|RS18_VIBVU RecName: Full=30S ribosomal protein S18
 gi|54042152|sp|P66478|RS18_VIBPA RecName: Full=30S ribosomal protein S18
 gi|59798812|sp|Q7MH90|RS18_VIBVY RecName: Full=30S ribosomal protein S18
 gi|166222256|sp|A7MSX6|RS18_VIBHB RecName: Full=30S ribosomal protein S18
 gi|254812965|sp|B7VI66|RS18_VIBSL RecName: Full=30S ribosomal protein S18
 gi|27360928|gb|AAO09838.1| ribosomal protein S18 [Vibrio vulnificus CMCP6]
 gi|28807748|dbj|BAC61001.1| ribosomal protein S18 [Vibrio parahaemolyticus RIMD 2210633]
 gi|37199917|dbj|BAC95746.1| ribosomal protein S18 [Vibrio vulnificus YJ016]
 gi|84376227|gb|EAP93111.1| 30S ribosomal protein S18 [Vibrio splendidus 12B01]
 gi|85833993|gb|EAQ52154.1| 30S ribosomal protein S18 [Vibrio sp. MED222]
 gi|91188669|gb|EAS74958.1| 30S ribosomal protein S18 [Vibrio alginolyticus 12G01]
 gi|145961013|gb|EDK26336.1| 30S ribosomal protein S18 [Vibrionales bacterium SWAT-3]
 gi|148834548|gb|EDL51540.1| 30S ribosomal protein S18 [Vibrio shilonii AK1]
 gi|148865657|gb|EDL66797.1| ribosomal protein S18 [Vibrio harveyi HY01]
 gi|149745013|gb|EDM56315.1| ribosomal protein S18 [Vibrio parahaemolyticus AQ3810]
 gi|156523995|gb|ABU69081.1| hypothetical protein VIBHAR_00021 [Vibrio harveyi ATCC BAA-1116]
 gi|159173103|gb|EDP57935.1| 30S ribosomal protein S18 [Vibrio sp. AND4]
 gi|218321353|emb|CAV17303.1| Ribosomal protein S18 [Vibrio splendidus LGP32]
 gi|260608816|gb|EEX34981.1| SSU ribosomal protein S18p [Vibrio coralliilyticus ATCC BAA-450]
 gi|260612817|gb|EEX38020.1| SSU ribosomal protein S18p [Vibrio metschnikovii CIP 69.14]
 gi|260617868|gb|EEX43043.1| SSU ribosomal protein S18p [Vibrio furnissii CIP 102972]
 gi|260937428|gb|EEX93417.1| SSU ribosomal protein S18p [Vibrio orientalis CIP 102891]
 gi|262336701|gb|ACY50496.1| SSU ribosomal protein S18p [Vibrio sp. Ex25]
 gi|269830778|gb|EEZ84996.1| 30S ribosomal protein S18 [Vibrio alginolyticus 40B]
 gi|269830944|gb|EEZ85155.1| 30S ribosomal protein S18 [Vibrio harveyi 1DA3]
 gi|269833851|gb|EEZ87946.1| 30S ribosomal protein S18 [Vibrio harveyi 1DA3]
 gi|308086286|gb|EFO35981.1| ribosomal protein S18 [Vibrio parahaemolyticus Peru-466]
 gi|308089682|gb|EFO39377.1| ribosomal protein S18 [Vibrio parahaemolyticus AN-5034]
 gi|308109417|gb|EFO46957.1| ribosomal protein S18 [Vibrio parahaemolyticus AQ4037]
 gi|308112694|gb|EFO50234.1| ribosomal protein S18 [Vibrio parahaemolyticus K5030]
 gi|309370372|gb|EFP97867.1| 30S ribosomal protein S18 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|315181337|gb|ADT88251.1| 30S ribosomal protein S18 [Vibrio furnissii NCTC 11218]
 gi|319930489|gb|ADV85353.1| SSU ribosomal protein S18p [Vibrio vulnificus MO6-24/O]
 gi|323312727|gb|EGA65856.1| 30S ribosomal protein S18 [Vibrio brasiliensis LMG 20546]
 gi|323318798|gb|EGA71749.1| 30S ribosomal protein S18 [Vibrio sinaloensis DSM 21326]
 gi|328472355|gb|EGF43225.1| 30S ribosomal protein S18 [Vibrio parahaemolyticus 10329]
          Length = 75

 Score = 90.8 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 30/59 (50%), Positives = 43/59 (72%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+  S K QR+LA+AIKR+RYL L+ Y +
Sbjct: 14 TAEGVQEIDYKDVATLKNYITEAGKIVPSRITGTSAKYQRQLARAIKRSRYLALLPYTD 72


>gi|220924504|ref|YP_002499806.1| 30S ribosomal protein S18 [Methylobacterium nodulans ORS 2060]
 gi|254812947|sp|B8IED1|RS18_METNO RecName: Full=30S ribosomal protein S18
 gi|219949111|gb|ACL59503.1| ribosomal protein S18 [Methylobacterium nodulans ORS 2060]
          Length = 82

 Score = 90.8 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 44/63 (69%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD++LL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LG +
Sbjct: 18 KTCPFSGPNAPKIDYKDVKLLSRYVSERGKIVPSRITAVSAKKQRELAQAIKRARFLGFL 77

Query: 79 AYV 81
           YV
Sbjct: 78 PYV 80


>gi|22299604|ref|NP_682851.1| 30S ribosomal protein S18 [Thermosynechococcus elongatus BP-1]
 gi|59798900|sp|Q8DH98|RS18_THEEB RecName: Full=30S ribosomal protein S18
 gi|22295788|dbj|BAC09613.1| 30S ribosomal protein S18 [Thermosynechococcus elongatus BP-1]
          Length = 71

 Score = 90.8 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 50/69 (72%), Gaps = 2/69 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
           +RR+  P+       IDYKD+ LL RF+++RGKI+P R++ ++ K+QR+LA AIKRAR 
Sbjct: 3  FYRRRISPI--PPGQPIDYKDVDLLRRFITERGKILPRRVTGLTAKQQRQLAVAIKRARI 60

Query: 75 LGLIAYVNL 83
          + L+ ++NL
Sbjct: 61 MALLPFLNL 69


>gi|85713276|ref|ZP_01044299.1| Ribosomal protein S18 [Idiomarina baltica OS145]
 gi|85692894|gb|EAQ30869.1| Ribosomal protein S18 [Idiomarina baltica OS145]
          Length = 75

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 42/58 (72%)

Query: 25 GKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
           +G   IDYKDI  L  ++++ GKIVPSRI+  S K QR+LA+AIKRARYL L+ Y +
Sbjct: 15 AEGVKEIDYKDIATLKNYITESGKIVPSRITGTSAKYQRQLARAIKRARYLSLLPYTD 72


>gi|311897277|dbj|BAJ29685.1| putative ribosomal protein S18 [Kitasatospora setae KM-6054]
          Length = 78

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 36/63 (57%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C      A  +DYKD  LL +F+S RGKI   R++    + QR++A A+K +R + L+ 
Sbjct: 13 VCVFCKDKATYVDYKDTNLLRKFISDRGKIRARRVTGNCTQHQRDVATAVKNSREVALLP 72

Query: 80 YVN 82
          Y +
Sbjct: 73 YTS 75


>gi|87119507|ref|ZP_01075404.1| 30S ribosomal protein S18 [Marinomonas sp. MED121]
 gi|86164983|gb|EAQ66251.1| 30S ribosomal protein S18 [Marinomonas sp. MED121]
          Length = 76

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRARY+ L+ Y +
Sbjct: 14 TAEGTVEIDYKDLDTLKGYVTETGKIVPSRITGTKARYQRQLATAIKRARYIALLPYTD 72


>gi|119718879|ref|YP_925844.1| 30S ribosomal protein S18 [Nocardioides sp. JS614]
 gi|166220965|sp|A1SQS2|RS18_NOCSJ RecName: Full=30S ribosomal protein S18
 gi|119539540|gb|ABL84157.1| SSU ribosomal protein S18P [Nocardioides sp. JS614]
          Length = 78

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 40/69 (57%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             ++K C    + A  +DYKD  LL +F+S RGKI   R++    + QR++A A+K AR
Sbjct: 7  RKPKKKVCQFCKEKATGVDYKDTALLRKFISDRGKIRARRVTGNCVQHQRDVAIAVKNAR 66

Query: 74 YLGLIAYVN 82
           + L+ Y +
Sbjct: 67 EVALLPYTS 75


>gi|88803224|ref|ZP_01118750.1| ribosomal protein S18 [Polaribacter irgensii 23-P]
 gi|88780790|gb|EAR11969.1| ribosomal protein S18 [Polaribacter irgensii 23-P]
          Length = 98

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 42/67 (62%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
              K C    KG   IDYKD   L   ++++GKI+P R++  S K QR++A+AIKRAR+
Sbjct: 27 KKEAKYCRFKKKGIKYIDYKDADFLMYLVNEQGKILPRRLTGTSLKYQRKVAQAIKRARH 86

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 87 LALMPYV 93


>gi|312889160|ref|ZP_07748717.1| SSU ribosomal protein S18P [Mucilaginibacter paludis DSM 18603]
 gi|311298322|gb|EFQ75434.1| SSU ribosomal protein S18P [Mucilaginibacter paludis DSM 18603]
          Length = 87

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 46/67 (68%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
          +R+K C     G   IDYKD   L +F++ +GK++P R++  S K QR++A+A+KR+R++
Sbjct: 17 NRKKYCRFKKNGIKYIDYKDANFLLKFINDQGKLLPRRLTGTSLKFQRKVAQAVKRSRHI 76

Query: 76 GLIAYVN 82
          GL+ YV 
Sbjct: 77 GLLPYVT 83


>gi|149279559|ref|ZP_01885688.1| 30S ribosomal protein S18 [Pedobacter sp. BAL39]
 gi|149229595|gb|EDM34985.1| 30S ribosomal protein S18 [Pedobacter sp. BAL39]
          Length = 87

 Score = 90.8 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 47/70 (67%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          +   +R+K C     G   IDYKD   L +F++ +GKI+P R++  S K QR++A+A+KR
Sbjct: 13 KVDDNRKKYCRFKKNGIKYIDYKDANFLLKFINDQGKILPRRLTGTSLKFQRKVAQAVKR 72

Query: 72 ARYLGLIAYV 81
          +R++GL+ +V
Sbjct: 73 SRHIGLLPFV 82


>gi|83816823|ref|YP_445490.1| ribosomal protein S18 [Salinibacter ruber DSM 13855]
 gi|294507376|ref|YP_003571434.1| 30S ribosomal protein S18 [Salinibacter ruber M8]
 gi|123726178|sp|Q2S2U1|RS18_SALRD RecName: Full=30S ribosomal protein S18
 gi|83758217|gb|ABC46330.1| ribosomal protein S18 [Salinibacter ruber DSM 13855]
 gi|294343704|emb|CBH24482.1| 30S ribosomal protein S18 [Salinibacter ruber M8]
          Length = 70

 Score = 90.4 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 40/57 (70%)

Query: 26 KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          +    +DYKD   L +F++ +GKI+P R++ V  + QR++ KAIKRAR+L L+ YV+
Sbjct: 10 EHLEYVDYKDTEFLEQFINNQGKILPRRVTGVPARVQRQITKAIKRARHLALMPYVS 66


>gi|72163492|ref|YP_291149.1| 30S ribosomal protein S18 [Thermobifida fusca YX]
 gi|123733431|sp|Q47K96|RS18_THEFY RecName: Full=30S ribosomal protein S18
 gi|71917224|gb|AAZ57126.1| SSU ribosomal protein S18P [Thermobifida fusca YX]
          Length = 78

 Score = 90.4 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 37/62 (59%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C    +    +DYKD  LL +F+S RGKI   R++    + QR++AKA+K AR + L+ Y
Sbjct: 14 CVFCQEKMTYVDYKDTTLLRKFISDRGKIRARRVTGNCTQHQRDVAKAVKNAREMALLPY 73

Query: 81 VN 82
           +
Sbjct: 74 TS 75


>gi|126665193|ref|ZP_01736176.1| ribosomal protein S18 [Marinobacter sp. ELB17]
 gi|126630563|gb|EBA01178.1| ribosomal protein S18 [Marinobacter sp. ELB17]
          Length = 76

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRAR+L L+ Y +
Sbjct: 14 TAEGVKEIDYKDLDTLKGYVTETGKIVPSRITGTKARYQRQLATAIKRARFLALLPYSD 72


>gi|73667308|ref|YP_303324.1| 30S ribosomal protein S18 [Ehrlichia canis str. Jake]
 gi|123773361|sp|Q3YRC9|RS18_EHRCJ RecName: Full=30S ribosomal protein S18
 gi|72394449|gb|AAZ68726.1| SSU ribosomal protein S18P [Ehrlichia canis str. Jake]
          Length = 95

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 52/77 (67%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          +P   L+R    R K+CPL       IDYK+  LL++F S+ G+I+PSRI+SVS +KQR 
Sbjct: 19 SPLAYLKRPYFKRSKACPLEQCPNEDIDYKNKTLLSKFTSEYGRILPSRITSVSSRKQRL 78

Query: 65 LAKAIKRARYLGLIAYV 81
          L+ A+KRARYL L+ Y 
Sbjct: 79 LSTAVKRARYLALLPYC 95


>gi|89898004|ref|YP_515114.1| 30S ribosomal protein S18 [Chlamydophila felis Fe/C-56]
 gi|329943157|ref|ZP_08291931.1| ribosomal protein S18 [Chlamydophila psittaci Cal10]
 gi|332287739|ref|YP_004422640.1| 30S ribosomal protein S18 [Chlamydophila psittaci 6BC]
 gi|123763226|sp|Q255R9|RS18_CHLFF RecName: Full=30S ribosomal protein S18
 gi|89331376|dbj|BAE80969.1| 30S ribosomal protein S18 [Chlamydophila felis Fe/C-56]
 gi|313848310|emb|CBY17313.1| 30S ribosomal protein S18 [Chlamydophila psittaci RD1]
 gi|325507290|gb|ADZ18928.1| 30S ribosomal protein S18 [Chlamydophila psittaci 6BC]
 gi|328814704|gb|EGF84694.1| ribosomal protein S18 [Chlamydophila psittaci Cal10]
 gi|328914993|gb|AEB55826.1| ribosomal protein S18 [Chlamydophila psittaci 6BC]
          Length = 82

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 41/69 (59%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
                K CP    G   IDYKD   L +F+++RGKI+P RI+ VS + Q  L  AIKRA
Sbjct: 11 RRKRFNKKCPFVSAGWKTIDYKDTETLKKFITERGKILPRRITGVSSRFQGILTLAIKRA 70

Query: 73 RYLGLIAYV 81
          R++G + +V
Sbjct: 71 RHIGFLPFV 79


>gi|15605536|ref|NP_220322.1| 30S ribosomal protein S18 [Chlamydia trachomatis D/UW-3/CX]
 gi|76789545|ref|YP_328631.1| 30S ribosomal protein S18 [Chlamydia trachomatis A/HAR-13]
 gi|166154144|ref|YP_001654262.1| 30S ribosomal protein S18 [Chlamydia trachomatis 434/Bu]
 gi|166155019|ref|YP_001653274.1| 30S ribosomal protein S18 [Chlamydia trachomatis
          L2b/UCH-1/proctitis]
 gi|237803233|ref|YP_002888427.1| 30S ribosomal protein S18 [Chlamydia trachomatis B/Jali20/OT]
 gi|237805154|ref|YP_002889308.1| 30S ribosomal protein S18 [Chlamydia trachomatis B/TZ1A828/OT]
 gi|255311638|ref|ZP_05354208.1| 30S ribosomal protein S18 [Chlamydia trachomatis 6276]
 gi|255317939|ref|ZP_05359185.1| 30S ribosomal protein S18 [Chlamydia trachomatis 6276s]
 gi|255349202|ref|ZP_05381209.1| 30S ribosomal protein S18 [Chlamydia trachomatis 70]
 gi|255503739|ref|ZP_05382129.1| 30S ribosomal protein S18 [Chlamydia trachomatis 70s]
 gi|255507420|ref|ZP_05383059.1| 30S ribosomal protein S18 [Chlamydia trachomatis D(s)2923]
 gi|301335384|ref|ZP_07223628.1| 30S ribosomal protein S18 [Chlamydia trachomatis L2tet1]
 gi|6831541|sp|O84808|RS18_CHLTR RecName: Full=30S ribosomal protein S18
 gi|123606576|sp|Q3KKN9|RS18_CHLTA RecName: Full=30S ribosomal protein S18
 gi|229559975|sp|B0B929|RS18_CHLT2 RecName: Full=30S ribosomal protein S18
 gi|229559976|sp|B0BAQ8|RS18_CHLTB RecName: Full=30S ribosomal protein S18
 gi|3329268|gb|AAC68397.1| S18 Ribosomal Protein [Chlamydia trachomatis D/UW-3/CX]
 gi|76168075|gb|AAX51083.1| SSU ribosomal protein S18P [Chlamydia trachomatis A/HAR-13]
 gi|165930132|emb|CAP03616.1| SSU ribosomal protein S18 [Chlamydia trachomatis 434/Bu]
 gi|165931007|emb|CAP06570.1| SSU ribosomal protein S18 [Chlamydia trachomatis
          L2b/UCH-1/proctitis]
 gi|231273454|emb|CAX10369.1| SSU ribosomal protein S18 [Chlamydia trachomatis B/TZ1A828/OT]
 gi|231274467|emb|CAX11262.1| SSU ribosomal protein S18 [Chlamydia trachomatis B/Jali20/OT]
 gi|289525847|emb|CBJ15328.1| SSU ribosomal protein S18 [Chlamydia trachomatis Sweden2]
 gi|296435429|gb|ADH17607.1| 30S ribosomal protein S18 [Chlamydia trachomatis E/150]
 gi|296436353|gb|ADH18527.1| 30S ribosomal protein S18 [Chlamydia trachomatis G/9768]
 gi|296437284|gb|ADH19454.1| 30S ribosomal protein S18 [Chlamydia trachomatis G/11222]
 gi|296438212|gb|ADH20373.1| 30S ribosomal protein S18 [Chlamydia trachomatis G/11074]
 gi|296439146|gb|ADH21299.1| 30S ribosomal protein S18 [Chlamydia trachomatis E/11023]
 gi|297140713|gb|ADH97471.1| 30S ribosomal protein S18 [Chlamydia trachomatis G/9301]
 gi|297748930|gb|ADI51476.1| SSU ribosomal protein S18P [Chlamydia trachomatis D-EC]
 gi|297749810|gb|ADI52488.1| SSU ribosomal protein S18P [Chlamydia trachomatis D-LC]
          Length = 81

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 45/69 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
                K CP    G   IDYKD+  L RF+++RGKI+P RI+ VS + Q  LA+A+KRA
Sbjct: 10 RRKRFAKKCPFVSAGWKTIDYKDVTTLKRFITERGKILPRRITGVSSRFQALLAQAVKRA 69

Query: 73 RYLGLIAYV 81
          R++GL+ +V
Sbjct: 70 RHVGLLPFV 78


>gi|188997592|ref|YP_001931843.1| ribosomal protein S18 [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932659|gb|ACD67289.1| ribosomal protein S18 [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 79

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A     +     R+K C    +     +YKDI  L  F+S+RGKI PSRIS    K QR
Sbjct: 1  MANVTQNKPYFQKRKKYCKFCAEKKEP-NYKDIETLKEFISERGKITPSRISGTCAKHQR 59

Query: 64 ELAKAIKRARYLGLIAYV 81
          +L+  IK+AR L LI YV
Sbjct: 60 KLSVEIKKARQLALIPYV 77


>gi|256389565|ref|YP_003111129.1| 30S ribosomal protein S18 [Catenulispora acidiphila DSM 44928]
 gi|256355791|gb|ACU69288.1| ribosomal protein S18 [Catenulispora acidiphila DSM 44928]
          Length = 78

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
           P   LR+    ++K C         +DYKD  LL +F+S RGKI   R++    + QR+
Sbjct: 1  MPKAPLRKP---KKKVCGFCKDKVAYVDYKDTTLLRKFISDRGKIRARRVTGNCTQHQRD 57

Query: 65 LAKAIKRARYLGLIAYVN 82
          +A A+K +R + L+ Y +
Sbjct: 58 VAVAVKNSREMALLPYTS 75


>gi|149377616|ref|ZP_01895354.1| ribosomal protein S18 [Marinobacter algicola DG893]
 gi|149358089|gb|EDM46573.1| ribosomal protein S18 [Marinobacter algicola DG893]
 gi|311693517|gb|ADP96390.1| ribosomal protein S18 [marine bacterium HP15]
          Length = 76

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLDTLKGYITETGKIVPSRITGTKARYQRQLATAIKRARYLALLPYSD 72


>gi|170740809|ref|YP_001769464.1| 30S ribosomal protein S18 [Methylobacterium sp. 4-46]
 gi|205558315|sp|B0UL30|RS18_METS4 RecName: Full=30S ribosomal protein S18
 gi|168195083|gb|ACA17030.1| ribosomal protein S18 [Methylobacterium sp. 4-46]
          Length = 83

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 44/63 (69%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD++LL+R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LG +
Sbjct: 19 KTCPFSGPNAPKIDYKDVKLLSRYVSERGKIVPSRITAVSAKKQRELAQAIKRARFLGFL 78

Query: 79 AYV 81
           YV
Sbjct: 79 PYV 81


>gi|54026952|ref|YP_121194.1| 30S ribosomal protein S18 [Nocardia farcinica IFM 10152]
 gi|59798929|sp|Q5YPR1|RS182_NOCFA RecName: Full=30S ribosomal protein S18 2
 gi|54018460|dbj|BAD59830.1| putative ribosomal protein S18 [Nocardia farcinica IFM 10152]
          Length = 84

 Score = 90.0 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 49/80 (61%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          + AP+  +R   + R K  PL   G   +DYKD+ LL  F+S RGKI   R++ ++ ++Q
Sbjct: 4  KRAPSKKVRAEQARRPKKNPLIAAGIETVDYKDVNLLRTFISDRGKIRSRRVTGLTPQQQ 63

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R++A A+K AR + L+ + +
Sbjct: 64 RQVAVAVKNAREMALLPFTS 83


>gi|305667287|ref|YP_003863574.1| 30S ribosomal protein S18 [Maribacter sp. HTCC2170]
 gi|88709334|gb|EAR01567.1| ribosomal protein S18 [Maribacter sp. HTCC2170]
          Length = 98

 Score = 90.0 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 44/65 (67%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          ++K C     G   IDYKD   L + ++++GK++P R++  S K QR++A+A+KRAR+L 
Sbjct: 29 KKKYCRFKKSGIKYIDYKDADFLMKLVNEQGKLLPRRLTGTSLKYQRKVAQAVKRARHLA 88

Query: 77 LIAYV 81
          L+ YV
Sbjct: 89 LMPYV 93


>gi|116490138|ref|YP_809667.1| SSU ribosomal protein S18P [Oenococcus oeni PSU-1]
 gi|290889532|ref|ZP_06552622.1| hypothetical protein AWRIB429_0012 [Oenococcus oeni AWRIB429]
 gi|122277671|sp|Q04HQ5|RS18_OENOB RecName: Full=30S ribosomal protein S18
 gi|116090863|gb|ABJ56017.1| SSU ribosomal protein S18P [Oenococcus oeni PSU-1]
 gi|290480730|gb|EFD89364.1| hypothetical protein AWRIB429_0012 [Oenococcus oeni AWRIB429]
          Length = 106

 Score = 90.0 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 39/62 (62%)

Query: 20  SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
              L+      +DYKD  LL RF++  GKI+P RI+  S K QR++A AIKRAR + L+ 
Sbjct: 42  VDYLAVNHIDYVDYKDTELLQRFIADNGKILPRRITGTSSKNQRKIATAIKRARIMALLP 101

Query: 80  YV 81
           +V
Sbjct: 102 FV 103


>gi|268609247|ref|ZP_06142974.1| 30S ribosomal protein S18 [Ruminococcus flavefaciens FD-1]
          Length = 80

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 44/79 (55%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +      R +   R+K C        RIDYKD+  L + +++R KI+P R++      QR
Sbjct: 1  MEKERNSRPSKKPRKKVCMFCADRIERIDYKDLAKLRKCMTERAKILPRRVTGTCAFHQR 60

Query: 64 ELAKAIKRARYLGLIAYVN 82
          EL  AIKRAR++ L+ Y++
Sbjct: 61 ELTVAIKRARHIALLPYIS 79


>gi|326790180|ref|YP_004308001.1| ribosomal protein S18 [Clostridium lentocellum DSM 5427]
 gi|326540944|gb|ADZ82803.1| ribosomal protein S18 [Clostridium lentocellum DSM 5427]
          Length = 77

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 48/73 (65%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + +R+   RRK    +G    +I+YKDI  L +F+S+RGKI+P RI+  S K QR+L  A
Sbjct: 3  MQKRHNRRRRKINQFAGDNIKKINYKDINTLKKFISERGKILPRRITGNSAKAQRKLTVA 62

Query: 69 IKRARYLGLIAYV 81
          IKRAR++ L+ Y 
Sbjct: 63 IKRARHIALLPYT 75


>gi|319951620|ref|YP_004162887.1| ssu ribosomal protein s18p [Cellulophaga algicola DSM 14237]
 gi|319420280|gb|ADV47389.1| SSU ribosomal protein S18P [Cellulophaga algicola DSM 14237]
          Length = 98

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 42/64 (65%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C     G   +DYKD   L + ++++GK++P R++  S K QR++A A+KRAR+L L
Sbjct: 30 KKYCRFKKSGIKYVDYKDPDFLIKLVNEQGKLLPRRLTGTSLKYQRKVAVAVKRARHLAL 89

Query: 78 IAYV 81
          + YV
Sbjct: 90 MPYV 93


>gi|15834805|ref|NP_296564.1| 30S ribosomal protein S18 [Chlamydia muridarum Nigg]
 gi|270284971|ref|ZP_06194365.1| 30S ribosomal protein S18 [Chlamydia muridarum Nigg]
 gi|270288995|ref|ZP_06195297.1| 30S ribosomal protein S18 [Chlamydia muridarum Weiss]
 gi|301336368|ref|ZP_07224570.1| 30S ribosomal protein S18 [Chlamydia muridarum MopnTet14]
 gi|7404461|sp|P24286|RS18_CHLMU RecName: Full=30S ribosomal protein S18
 gi|7190222|gb|AAF39059.1| ribosomal protein S18 [Chlamydia muridarum Nigg]
          Length = 81

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 45/69 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
                K CP    G   IDYKD+  L RF+++RGKI+P RI+ VS + Q  LA+A+KRA
Sbjct: 10 RRKRFAKKCPFVSAGWKTIDYKDVVTLKRFITERGKILPRRITGVSSRFQALLAQAVKRA 69

Query: 73 RYLGLIAYV 81
          R++GL+ +V
Sbjct: 70 RHVGLLPFV 78


>gi|157964105|ref|YP_001498929.1| 30S ribosomal protein S18 [Rickettsia massiliae MTU5]
 gi|167011193|sp|A8F0E6|RS18_RICM5 RecName: Full=30S ribosomal protein S18
 gi|157843881|gb|ABV84382.1| 30S ribosomal protein S18 [Rickettsia massiliae MTU5]
          Length = 95

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 50/71 (70%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++    RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  A+K
Sbjct: 21 KKVFFRRRKGCPLSVPHAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAVK 80

Query: 71 RARYLGLIAYV 81
           AR L L+ +V
Sbjct: 81 IARILALLPFV 91


>gi|302339368|ref|YP_003804574.1| ribosomal protein S18 [Spirochaeta smaragdinae DSM 11293]
 gi|301636553|gb|ADK81980.1| ribosomal protein S18 [Spirochaeta smaragdinae DSM 11293]
          Length = 103

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 12  RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
           +    ++K C          DYKD   L RF+++RGKI+P RI+    K QR LAK IKR
Sbjct: 33  KRPFFKKKVCRFCTGNM-VADYKDPDALGRFVTERGKILPRRITGTCAKHQRLLAKEIKR 91

Query: 72  ARYLGLIAYV 81
           AR L  + +V
Sbjct: 92  ARVLAYLPFV 101


>gi|91204936|ref|YP_537291.1| 30S ribosomal protein S18 [Rickettsia bellii RML369-C]
 gi|157827736|ref|YP_001496800.1| 30S ribosomal protein S18 [Rickettsia bellii OSU 85-389]
 gi|123084595|sp|Q1RKB2|RS18_RICBR RecName: Full=30S ribosomal protein S18
 gi|166220983|sp|A8GY13|RS18_RICB8 RecName: Full=30S ribosomal protein S18
 gi|91068480|gb|ABE04202.1| 30S ribosomal protein S18 [Rickettsia bellii RML369-C]
 gi|157803040|gb|ABV79763.1| 30S ribosomal protein S18 [Rickettsia bellii OSU 85-389]
          Length = 94

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 36/71 (50%), Positives = 50/71 (70%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++    RRK CPLS   AP IDYK+  LL +F+S+ G+++PSRI++V  KKQR+L  AIK
Sbjct: 20 KKVFFRRRKGCPLSVPNAPVIDYKNPELLIKFVSEGGRMLPSRITNVCAKKQRKLNNAIK 79

Query: 71 RARYLGLIAYV 81
           AR L L+ +V
Sbjct: 80 IARILALLPFV 90


>gi|86133511|ref|ZP_01052093.1| 30S ribosomal protein S18 [Polaribacter sp. MED152]
 gi|85820374|gb|EAQ41521.1| 30S ribosomal protein S18 [Polaribacter sp. MED152]
          Length = 98

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 42/67 (62%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
              K C    KG   IDYKD   L   ++++GKI+P R++  S K QR++A+AIKRAR+
Sbjct: 27 KKEAKYCRFKKKGIKYIDYKDADFLMYLVNEQGKILPRRLTGTSLKYQRKVAQAIKRARH 86

Query: 75 LGLIAYV 81
          L L+ YV
Sbjct: 87 LALMPYV 93


>gi|222474849|ref|YP_002563264.1| small subunit ribosomal protein S18 (rpsR) [Anaplasma marginale
           str. Florida]
 gi|254994706|ref|ZP_05276896.1| 30S ribosomal protein S18 [Anaplasma marginale str. Mississippi]
 gi|255002819|ref|ZP_05277783.1| 30S ribosomal protein S18 [Anaplasma marginale str. Puerto Rico]
 gi|255003952|ref|ZP_05278753.1| 30S ribosomal protein S18 [Anaplasma marginale str. Virginia]
 gi|222418985|gb|ACM49008.1| small subunit ribosomal protein S18 (rpsR) [Anaplasma marginale
           str. Florida]
          Length = 100

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 36/77 (46%), Positives = 55/77 (71%)

Query: 5   APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
           +P   L+R    + +SCPL+      IDYK+  LL++F+S+ G+I+PSRI+SVS +KQ+ 
Sbjct: 24  SPLVYLKRPYFRKSRSCPLAQCPDEDIDYKNRALLSKFVSEYGRILPSRITSVSSRKQKL 83

Query: 65  LAKAIKRARYLGLIAYV 81
           LA+A+KRAR+L L+ Y 
Sbjct: 84  LARAVKRARFLALLPYC 100


>gi|21222315|ref|NP_628094.1| 30S ribosomal protein S18 [Streptomyces coelicolor A3(2)]
 gi|29830830|ref|NP_825464.1| 30S ribosomal protein S18 [Streptomyces avermitilis MA-4680]
 gi|239930204|ref|ZP_04687157.1| 30S ribosomal protein S18 [Streptomyces ghanaensis ATCC 14672]
 gi|239980816|ref|ZP_04703340.1| 30S ribosomal protein S18 [Streptomyces albus J1074]
 gi|256786585|ref|ZP_05525016.1| 30S ribosomal protein S18 [Streptomyces lividans TK24]
 gi|289770476|ref|ZP_06529854.1| 30S ribosomal protein S18 [Streptomyces lividans TK24]
 gi|290959032|ref|YP_003490214.1| 30S ribosomal protein S18 [Streptomyces scabiei 87.22]
 gi|291438548|ref|ZP_06577938.1| 30S ribosomal protein S18 1 [Streptomyces ghanaensis ATCC 14672]
 gi|291452676|ref|ZP_06592066.1| 30S ribosomal protein S18 1 [Streptomyces albus J1074]
 gi|294630308|ref|ZP_06708868.1| 30S ribosomal protein S18 [Streptomyces sp. e14]
 gi|297200910|ref|ZP_06918307.1| ribosomal protein S18 [Streptomyces sviceus ATCC 29083]
 gi|302552665|ref|ZP_07305007.1| ribosomal protein S18 [Streptomyces viridochromogenes DSM 40736]
 gi|329938668|ref|ZP_08288064.1| 30S ribosomal protein S18 [Streptomyces griseoaurantiacus M045]
 gi|54038990|sp|P66471|RS181_STRAW RecName: Full=30S ribosomal protein S18 1
 gi|54041926|sp|P66470|RS181_STRCO RecName: Full=30S ribosomal protein S18 1
 gi|4808404|emb|CAB42736.1| putative 30S ribosomal protein S18 [Streptomyces coelicolor
          A3(2)]
 gi|29607943|dbj|BAC71999.1| putative ribosomal protein S18 [Streptomyces avermitilis MA-4680]
 gi|197716408|gb|EDY60442.1| ribosomal protein S18 [Streptomyces sviceus ATCC 29083]
 gi|260648558|emb|CBG71669.1| putative 30S ribosomal protein S18 [Streptomyces scabiei 87.22]
 gi|289700675|gb|EFD68104.1| 30S ribosomal protein S18 [Streptomyces lividans TK24]
 gi|291341443|gb|EFE68399.1| 30S ribosomal protein S18 1 [Streptomyces ghanaensis ATCC 14672]
 gi|291355625|gb|EFE82527.1| 30S ribosomal protein S18 1 [Streptomyces albus J1074]
 gi|292833641|gb|EFF91990.1| 30S ribosomal protein S18 [Streptomyces sp. e14]
 gi|302470283|gb|EFL33376.1| ribosomal protein S18 [Streptomyces viridochromogenes DSM 40736]
 gi|329302159|gb|EGG46051.1| 30S ribosomal protein S18 [Streptomyces griseoaurantiacus M045]
          Length = 78

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 35/62 (56%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         +DYKD  +L +F+S RGKI   R++    + QR++A A+K +R + L+ Y
Sbjct: 14 CAFCKDKVTYVDYKDTNMLRKFISDRGKIRARRVTGNCTQHQRDVATAVKNSREMALLPY 73

Query: 81 VN 82
           +
Sbjct: 74 TS 75


>gi|325285226|ref|YP_004261016.1| 30S ribosomal protein S18 [Cellulophaga lytica DSM 7489]
 gi|324320680|gb|ADY28145.1| 30S ribosomal protein S18 [Cellulophaga lytica DSM 7489]
          Length = 98

 Score = 90.0 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 43/66 (65%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           ++K C     G   +DYKD   L + ++++GK++P R++  S K QR++A A+KRAR+L
Sbjct: 28 KQKKYCRFKKSGIKYVDYKDPDFLIKLVNEQGKLLPRRLTGTSLKYQRKVAVAVKRARHL 87

Query: 76 GLIAYV 81
           L+ YV
Sbjct: 88 ALMPYV 93


>gi|298208563|ref|YP_003716742.1| ribosomal protein S18 [Croceibacter atlanticus HTCC2559]
 gi|83848486|gb|EAP86355.1| ribosomal protein S18 [Croceibacter atlanticus HTCC2559]
          Length = 100

 Score = 90.0 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 43/68 (63%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S + K C     G   IDYK+   L   ++++GK++P R++  S K QR++A+A+KRAR+
Sbjct: 28 SKKEKYCRFKKNGIKYIDYKNPDFLGMLVNEQGKLLPRRLTGTSLKYQRKVAQAVKRARH 87

Query: 75 LGLIAYVN 82
          + L+ YV 
Sbjct: 88 IALMPYVT 95


>gi|153002998|ref|YP_001377323.1| 30S ribosomal protein S18 [Anaeromyxobacter sp. Fw109-5]
 gi|205556807|sp|A7H6J3|RS18_ANADF RecName: Full=30S ribosomal protein S18
 gi|152026571|gb|ABS24339.1| ribosomal protein S18 [Anaeromyxobacter sp. Fw109-5]
          Length = 143

 Score = 90.0 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 37/63 (58%)

Query: 19  KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
           K C        ++DYKD   +  FL++RGKI+P RIS    K QRE+A A+KR R L ++
Sbjct: 77  KVCRFCADKTLKVDYKDQSQMKYFLTERGKIIPRRISGNCAKHQREVATAVKRGRMLAIL 136

Query: 79  AYV 81
            Y 
Sbjct: 137 PYT 139


>gi|71278137|ref|YP_267175.1| 30S ribosomal protein S18 [Colwellia psychrerythraea 34H]
 gi|123774971|sp|Q489T9|RS18_COLP3 RecName: Full=30S ribosomal protein S18
 gi|71143877|gb|AAZ24350.1| ribosomal protein S18 [Colwellia psychrerythraea 34H]
          Length = 75

 Score = 90.0 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/60 (53%), Positives = 44/60 (73%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          + +GA  IDYKDI  L  ++++ GKIVPSRI+  + K QR+L +AIKRARYL L+ Y +L
Sbjct: 14 TAEGATSIDYKDIATLKNYITESGKIVPSRITGTAAKYQRQLTRAIKRARYLSLLPYTDL 73


>gi|319950955|ref|ZP_08024827.1| 30S ribosomal protein S18 [Dietzia cinnamea P4]
 gi|319435377|gb|EFV90625.1| 30S ribosomal protein S18 [Dietzia cinnamea P4]
          Length = 85

 Score = 90.0 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 46/81 (56%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          A   P+  +R     R K  PL   G   +DYKD+  L  F+S RGKI   R++ ++ ++
Sbjct: 4  ARSTPSKKIRAQEGRRPKKNPLKVAGIETVDYKDVNTLRTFISDRGKIRSRRVTGLTPQQ 63

Query: 62 QRELAKAIKRARYLGLIAYVN 82
          QR++A A+K AR + L+ + +
Sbjct: 64 QRQVAVAVKNAREMALLPFTS 84


>gi|325679786|ref|ZP_08159360.1| ribosomal protein S18 [Ruminococcus albus 8]
 gi|324108601|gb|EGC02843.1| ribosomal protein S18 [Ruminococcus albus 8]
          Length = 83

 Score = 90.0 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 45/81 (55%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA        R     R+K C      A +IDYKDI  L + +++R KI+P R++     
Sbjct: 1  MAMDKERTGGRPVKRGRKKVCMFCVDRAEKIDYKDIAKLRKCMTERAKILPRRVTGTCAY 60

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QREL KAIKRAR++ L+ YV
Sbjct: 61 HQRELTKAIKRARHVALLPYV 81


>gi|307546115|ref|YP_003898594.1| 30S ribosomal protein S18 [Halomonas elongata DSM 2581]
 gi|307218139|emb|CBV43409.1| 30S ribosomal protein S18 [Halomonas elongata DSM 2581]
          Length = 75

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  +IDYKD+  L  ++++ GKIVPSRI+    + QR+L+ AIKRARYL L+ Y +
Sbjct: 14 TAEGVKQIDYKDLDTLKAYVTETGKIVPSRITGTKARYQRQLSTAIKRARYLALLPYTD 72


>gi|303326563|ref|ZP_07357006.1| ribosomal protein S18 [Desulfovibrio sp. 3_1_syn3]
 gi|302864479|gb|EFL87410.1| ribosomal protein S18 [Desulfovibrio sp. 3_1_syn3]
          Length = 87

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 38/72 (52%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++  + RRK C         ++YK   +L  F+++RGKI+  RI+      QR L + I
Sbjct: 3  FKKKFAPRRKFCRFCADKELPLNYKRPDILRDFITERGKIIARRITGTCAHHQRLLTREI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ Y 
Sbjct: 63 KRARQMALLIYT 74


>gi|323703280|ref|ZP_08114931.1| ribosomal protein S18 [Desulfotomaculum nigrificans DSM 574]
 gi|323531745|gb|EGB21633.1| ribosomal protein S18 [Desulfotomaculum nigrificans DSM 574]
          Length = 76

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 35/62 (56%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYKD+  L +++++RGKI+P RIS      QR L  AIKRAR + L+ 
Sbjct: 13 ICSFCVDKMTSIDYKDVPRLKKYITERGKILPRRISGNCAHHQRMLTTAIKRARNICLLP 72

Query: 80 YV 81
          + 
Sbjct: 73 FT 74


>gi|54020444|ref|YP_115817.1| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae 232]
 gi|161611220|ref|YP_279087.2| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae J]
 gi|161611227|ref|YP_287690.2| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae 7448]
 gi|59798622|sp|Q600Z8|RS18_MYCH2 RecName: Full=30S ribosomal protein S18
 gi|166221070|sp|Q4A872|RS18_MYCH7 RecName: Full=30S ribosomal protein S18
 gi|166221071|sp|Q4AA45|RS18_MYCHJ RecName: Full=30S ribosomal protein S18
 gi|53987617|gb|AAV27818.1| 30s ribosomal protein S18 [Mycoplasma hyopneumoniae 232]
 gi|144227556|gb|AAZ44376.2| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae J]
 gi|144575366|gb|AAZ53667.2| 30s ribosomal protein S18 [Mycoplasma hyopneumoniae 7448]
          Length = 87

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 39/62 (62%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYKDI +L RF++  GKI PSRI+    K QR+LA A+KRAR++ L+ 
Sbjct: 13 PCQFCEAKLFYIDYKDIEVLQRFINTFGKIQPSRITGNCAKHQRKLALAVKRARFVALLP 72

Query: 80 YV 81
          ++
Sbjct: 73 FI 74


>gi|160947594|ref|ZP_02094761.1| hypothetical protein PEPMIC_01529 [Parvimonas micra ATCC 33270]
 gi|158446728|gb|EDP23723.1| hypothetical protein PEPMIC_01529 [Parvimonas micra ATCC 33270]
          Length = 74

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 45/71 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          ++R    R+K        +  +DYKD+  L +F+S+RGKI+P R++  + K+QRE+  AI
Sbjct: 1  MQRKFRPRKKVVAYFSDNSKPLDYKDVNTLKKFISERGKILPRRVTGATAKQQREITAAI 60

Query: 70 KRARYLGLIAY 80
          K+AR + L+ Y
Sbjct: 61 KKARQVALLPY 71


>gi|258645631|ref|ZP_05733100.1| ribosomal protein S18 [Dialister invisus DSM 15470]
 gi|260402992|gb|EEW96539.1| ribosomal protein S18 [Dialister invisus DSM 15470]
          Length = 77

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 43/69 (62%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    RRK C         +DYKDI +L RF+S+RGKI+P R++ +  K QR++  AIKR
Sbjct: 6  RVRRPRRKICQGCVDHIENVDYKDIAMLRRFISERGKILPRRVTGICAKHQRKINLAIKR 65

Query: 72 ARYLGLIAY 80
          AR + L+ +
Sbjct: 66 ARAIALLPF 74


>gi|313887171|ref|ZP_07820867.1| ribosomal protein S18 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332300447|ref|YP_004442368.1| 30S ribosomal protein S18 [Porphyromonas asaccharolytica DSM
          20707]
 gi|312923400|gb|EFR34213.1| ribosomal protein S18 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332177510|gb|AEE13200.1| 30S ribosomal protein S18 [Porphyromonas asaccharolytica DSM
          20707]
          Length = 88

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 42/65 (64%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C     G   +DYKD   L +FL+ +GKI+P RI+  S K QR +A+A+KRAR+L L
Sbjct: 20 KKYCRFKKAGIKYVDYKDPEFLKKFLNDQGKILPRRITGNSLKFQRRVAQAVKRARHLAL 79

Query: 78 IAYVN 82
          + +V 
Sbjct: 80 LPFVT 84


>gi|300870579|ref|YP_003785450.1| 30S ribosomal protein S18 [Brachyspira pilosicoli 95/1000]
 gi|300688278|gb|ADK30949.1| 30S ribosomal protein S18 [Brachyspira pilosicoli 95/1000]
          Length = 114

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 41/69 (59%)

Query: 12  RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
           R    ++K C         +DYKDI+LL +++ + GKI+P R++    K QR + KAIKR
Sbjct: 42  RKKFFKKKICYFCKNNIDVLDYKDIKLLKKYVKESGKIIPKRLNGTCSKHQRLVTKAIKR 101

Query: 72  ARYLGLIAY 80
           AR + L+ Y
Sbjct: 102 ARNIALLPY 110


>gi|294340686|emb|CAZ89078.1| putative 30S ribosomal protein S18 RpsR [Thiomonas sp. 3As]
          Length = 96

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 46/77 (59%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
              + ++  R++ C  +     +IDYKD+ +L   +++  +I+P+R++  S   QR+L 
Sbjct: 17 RRNQQSSLFKRKRFCRFTVAKVEQIDYKDVDVLKDLIAENARIIPARLTGTSAHYQRQLN 76

Query: 67 KAIKRARYLGLIAYVNL 83
           AIKRAR+L L+ Y +L
Sbjct: 77 TAIKRARFLALLPYTDL 93


>gi|83319872|ref|YP_424024.1| 30S ribosomal protein S18 [Mycoplasma capricolum subsp.
          capricolum ATCC 27343]
 gi|123726538|sp|Q2ST89|RS18_MYCCT RecName: Full=30S ribosomal protein S18
 gi|83283758|gb|ABC01690.1| 30S ribosomal protein S18 [Mycoplasma capricolum subsp.
          capricolum ATCC 27343]
          Length = 75

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
                     IDYKD+ LL +F+S  G+I+P RI+  S K QR+LA AIKRAR + L+ 
Sbjct: 12 VNFFQKNNIKYIDYKDVELLKKFISPNGQILPRRITGTSLKDQRQLALAIKRARQMALLP 71

Query: 80 YV 81
          YV
Sbjct: 72 YV 73


>gi|326329083|ref|ZP_08195412.1| ribosomal protein S18 [Nocardioidaceae bacterium Broad-1]
 gi|325953165|gb|EGD45176.1| ribosomal protein S18 [Nocardioidaceae bacterium Broad-1]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 40/69 (57%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             ++K C    + A  +DYKD  LL +F+S RGKI   R++    + QR++A A+K AR
Sbjct: 7  RKPKKKVCQFCKEKATGVDYKDATLLRKFISDRGKIRARRVTGNCVQHQRDVAIAVKNAR 66

Query: 74 YLGLIAYVN 82
           + L+ Y +
Sbjct: 67 EVALLPYTS 75


>gi|159903436|ref|YP_001550780.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9211]
 gi|159888612|gb|ABX08826.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9211]
          Length = 73

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 47/67 (70%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           ++K  P+  K    IDYKD+  L +F+++RGKI+P R++ ++ ++QR+L  A+KRAR +
Sbjct: 6  FKKKLSPI--KPGDPIDYKDVETLKKFITERGKILPRRLTGLTAQQQRDLTVAVKRARII 63

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 64 ALLPFVN 70


>gi|300869626|ref|ZP_07114206.1| 30S ribosomal protein S18 [Oscillatoria sp. PCC 6506]
 gi|300332404|emb|CBN59406.1| 30S ribosomal protein S18 [Oscillatoria sp. PCC 6506]
          Length = 71

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RR+  P+  K    IDYKD+ LL +F+++RGKI+P RI+ ++ K+QR+L   IKRAR 
Sbjct: 3  YFRRRVSPI--KPGDPIDYKDVDLLRKFVTERGKILPRRITGLTAKQQRDLTTGIKRARI 60

Query: 75 LGLIAYVN 82
          L L+ +VN
Sbjct: 61 LALMPFVN 68


>gi|94501371|ref|ZP_01307891.1| ribosomal protein S18 [Oceanobacter sp. RED65]
 gi|94426484|gb|EAT11472.1| ribosomal protein S18 [Oceanobacter sp. RED65]
          Length = 75

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  +IDYKD+  L  ++++ GKIVPSRI+    K QR+L+ AIKRARY+ L+ Y +
Sbjct: 14 TAEGVDQIDYKDLDTLKGYITETGKIVPSRITGTKAKYQRQLSSAIKRARYVALLPYTD 72


>gi|33240418|ref|NP_875360.1| 30S ribosomal protein S18 [Prochlorococcus marinus subsp. marinus
          str. CCMP1375]
 gi|59798853|sp|Q7VBX4|RS18_PROMA RecName: Full=30S ribosomal protein S18
 gi|33237945|gb|AAQ00013.1| Ribosomal protein S18 [Prochlorococcus marinus subsp. marinus
          str. CCMP1375]
          Length = 73

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 47/67 (70%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           ++K  P+  K    IDYKD+  L +F+++RGKI+P R++ ++ K+QR+L  A+KRAR +
Sbjct: 6  FKKKLSPI--KPGDPIDYKDVETLKKFITERGKILPRRLTGLTAKQQRDLTTAVKRARII 63

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 64 ALLPFVN 70


>gi|225619963|ref|YP_002721220.1| 30S ribosomal protein S18 [Brachyspira hyodysenteriae WA1]
 gi|254765412|sp|C0R078|RS18_BRAHW RecName: Full=30S ribosomal protein S18
 gi|225214782|gb|ACN83516.1| 30S ribosomal protein S18 [Brachyspira hyodysenteriae WA1]
          Length = 111

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 40/69 (57%)

Query: 12  RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
           R    ++K C         +DYKDI+LL R++   GKI+P R++    K QR + KAIKR
Sbjct: 39  RKKFFKKKVCYFCKNNIDVLDYKDIKLLKRYVKDSGKIIPKRLNGTCSKHQRLVTKAIKR 98

Query: 72  ARYLGLIAY 80
           AR + L+ Y
Sbjct: 99  ARNIALLPY 107


>gi|192362397|ref|YP_001983436.1| 30S ribosomal protein S18 [Cellvibrio japonicus Ueda107]
 gi|229559974|sp|B3PCS1|RS18_CELJU RecName: Full=30S ribosomal protein S18
 gi|190688562|gb|ACE86240.1| ribosomal protein S18 [Cellvibrio japonicus Ueda107]
          Length = 75

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 33/59 (55%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  RIDYKDI  L  ++++ GKIVPSRI+    K QR+LA AIKRARYL LI Y +
Sbjct: 14 TAEGTKRIDYKDIETLKAYITETGKIVPSRITGTKAKYQRQLATAIKRARYLALIPYTD 72


>gi|119474660|ref|ZP_01615013.1| ribosomal protein S18 [marine gamma proteobacterium HTCC2143]
 gi|119450863|gb|EAW32096.1| ribosomal protein S18 [marine gamma proteobacterium HTCC2143]
          Length = 75

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  +IDYKD+  L  ++S+ GKIVPSRI+    K QR+L+  IKRAR+L L+ Y +
Sbjct: 14 TAEGVDQIDYKDLDTLKAYVSETGKIVPSRITGTKAKYQRQLSTCIKRARFLALLPYTD 72


>gi|313664921|ref|YP_004046792.1| ribosomal protein S18 [Mycoplasma leachii PG50]
 gi|312949974|gb|ADR24570.1| ribosomal protein S18 [Mycoplasma leachii PG50]
          Length = 75

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
                     IDYKD+ LL +F+S  G+I+P RI+  S K QR+LA AIKRAR + L+ 
Sbjct: 12 VNFFQKNNIKYIDYKDVELLKKFISPNGQILPRRITGTSPKDQRQLALAIKRARQMALLP 71

Query: 80 YV 81
          YV
Sbjct: 72 YV 73


>gi|310659868|ref|YP_003937589.1| 30S ribosomal protein S18 [Clostridium sticklandii DSM 519]
 gi|308826646|emb|CBH22684.1| 30S ribosomal subunit protein S18 [Clostridium sticklandii]
          Length = 78

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 33/68 (48%), Positives = 46/68 (67%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             R+K  P +GK    IDYKD+ LL +++S+RGKI+P RI+  S K QR+L  AIKR+R
Sbjct: 9  RRRRKKVDPFAGKKINMIDYKDVNLLKKYISERGKILPRRITGTSAKAQRKLTLAIKRSR 68

Query: 74 YLGLIAYV 81
           + L+ YV
Sbjct: 69 NIALLPYV 76


>gi|330836667|ref|YP_004411308.1| 30S ribosomal protein S18P [Spirochaeta coccoides DSM 17374]
 gi|329748570|gb|AEC01926.1| SSU ribosomal protein S18P [Spirochaeta coccoides DSM 17374]
          Length = 95

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    R+K C  +       DYK+  LL RF+++RGKI+P RI+    K QR L  A+K
Sbjct: 24 RRPGGFRKKVCKFTQMNVTP-DYKNPDLLRRFITERGKILPRRITGTCAKNQRALTLAVK 82

Query: 71 RARYLGLIAY 80
          RAR L  + +
Sbjct: 83 RARVLAYLPF 92


>gi|296393674|ref|YP_003658558.1| 30S ribosomal protein S18 [Segniliparus rotundus DSM 44985]
 gi|296180821|gb|ADG97727.1| ribosomal protein S18 [Segniliparus rotundus DSM 44985]
          Length = 83

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 49/82 (59%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA   P   LR     + K  PL  +G  ++DYKD  LL  F+S+RGKI   R++ ++ +
Sbjct: 1  MARKPPVKKLRVAEIRKPKKNPLKAQGVEQVDYKDTNLLRTFISERGKIRSRRVTGLTPR 60

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
          +QR++A A+K AR + L+ + N
Sbjct: 61 QQRDVATAVKNAREMALLPFTN 82


>gi|330752552|emb|CBL87499.1| Ribosomal protein S18 [uncultured Flavobacteria bacterium]
          Length = 89

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 35/78 (44%), Positives = 48/78 (61%), Gaps = 3/78 (3%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          ++P  + +R+ S   K C     G   +DYKD   L RFL+++GKI+P RI+  S K QR
Sbjct: 10 LSPVDIEKRSQS---KYCRFKKMGIKYVDYKDPDFLIRFLNEQGKILPRRITGNSLKFQR 66

Query: 64 ELAKAIKRARYLGLIAYV 81
           +A AIKRAR L L+ YV
Sbjct: 67 RVAVAIKRARQLALLPYV 84


>gi|317057125|ref|YP_004105592.1| 30S ribosomal protein S18 [Ruminococcus albus 7]
 gi|315449394|gb|ADU22958.1| ribosomal protein S18 [Ruminococcus albus 7]
          Length = 81

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 43/71 (60%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          R     R+K C      A +IDYKDI  L + +++R KI+P R++      QREL KAIK
Sbjct: 9  RPVKRGRKKVCMFCVDRAEKIDYKDIAKLRKCMTERAKILPRRVTGTCAYHQRELTKAIK 68

Query: 71 RARYLGLIAYV 81
          RAR++ L+ YV
Sbjct: 69 RARHVALLPYV 79


>gi|212704876|ref|ZP_03313004.1| hypothetical protein DESPIG_02943 [Desulfovibrio piger ATCC
          29098]
 gi|212671718|gb|EEB32201.1| hypothetical protein DESPIG_02943 [Desulfovibrio piger ATCC
          29098]
          Length = 87

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 38/72 (52%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++  + RRK C         ++YK   +L  F+++RGKI+  RI+      QR L + I
Sbjct: 3  FKKKFAPRRKFCRFCADKDLPLNYKRPDILRDFITERGKIIARRITGTCAHHQRLLTREI 62

Query: 70 KRARYLGLIAYV 81
          KRAR + L+ Y 
Sbjct: 63 KRARQMALLIYT 74


>gi|329890142|ref|ZP_08268485.1| ribosomal protein S18 [Brevundimonas diminuta ATCC 11568]
 gi|328845443|gb|EGF95007.1| ribosomal protein S18 [Brevundimonas diminuta ATCC 11568]
          Length = 64

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 45/61 (73%), Positives = 54/61 (88%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          CP SG  AP+IDYKD++LL R++S+RGKIVPSRI++VS KKQRELAKAIKRARYL L+ Y
Sbjct: 2  CPFSGANAPKIDYKDVKLLQRYVSERGKIVPSRITAVSAKKQRELAKAIKRARYLALLPY 61

Query: 81 V 81
          V
Sbjct: 62 V 62


>gi|124112116|ref|YP_001019134.1| ribosomal protein S18 [Chlorokybus atmophyticus]
 gi|205831445|sp|Q19V75|RR18_CHLAT RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|124012224|gb|ABD62248.2| ribosomal protein S18 [Chlorokybus atmophyticus]
          Length = 71

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 50/67 (74%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RR+  P+  K    IDYK+I LL++F++++GKI+P R++ +S K+QR + KAIK+AR+L
Sbjct: 4  SRRRVSPI--KPGETIDYKNIDLLSQFITEQGKILPRRVNGISAKQQRAITKAIKQARFL 61

Query: 76 GLIAYVN 82
           L+ ++N
Sbjct: 62 ALLPFLN 68


>gi|312601294|gb|ADQ90549.1| 30S ribosomal protein S18 [Mycoplasma hyopneumoniae 168]
          Length = 87

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 39/61 (63%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         IDYKDI +L RF++  GKI PSRI+    K QR+LA A+KRAR++ L+ +
Sbjct: 14 CQFCEAKLFYIDYKDIEVLQRFINTFGKIQPSRITGNCAKHQRKLALAVKRARFVALLPF 73

Query: 81 V 81
          +
Sbjct: 74 I 74


>gi|296127398|ref|YP_003634650.1| ribosomal protein S18 [Brachyspira murdochii DSM 12563]
 gi|296019214|gb|ADG72451.1| ribosomal protein S18 [Brachyspira murdochii DSM 12563]
          Length = 112

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 40/69 (57%)

Query: 12  RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
           R    ++K C         +DYKDI+LL R++   GKI+P R++    K QR + KAIKR
Sbjct: 40  RKKFFKKKVCYFCKNNIDVLDYKDIKLLKRYVKDSGKIIPKRLNGTCSKHQRLVTKAIKR 99

Query: 72  ARYLGLIAY 80
           AR + L+ Y
Sbjct: 100 ARNIALLPY 108


>gi|62185391|ref|YP_220176.1| 30S ribosomal protein S18 [Chlamydophila abortus S26/3]
 gi|81312459|sp|Q5L566|RS18_CHLAB RecName: Full=30S ribosomal protein S18
 gi|62148458|emb|CAH64228.1| 30S ribosomal protein S18 [Chlamydophila abortus S26/3]
          Length = 87

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 41/69 (59%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
                K CP    G   IDYKD   L +F++++GKI+P RI+ VS + Q  L  AIKRA
Sbjct: 16 RRKRFNKKCPFVSAGWKTIDYKDTETLKKFITEKGKILPRRITGVSSRFQGILTLAIKRA 75

Query: 73 RYLGLIAYV 81
          R++G + +V
Sbjct: 76 RHIGFLPFV 84


>gi|84517318|ref|ZP_01004672.1| 30S ribosomal protein S18 [Loktanella vestfoldensis SKA53]
 gi|84508798|gb|EAQ05261.1| 30S ribosomal protein S18 [Loktanella vestfoldensis SKA53]
          Length = 75

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 40/72 (55%), Positives = 52/72 (72%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +  +    RRKS P  G  AP+IDYKD R L R++S+RGKIVP+RI++V  K QR LA+A
Sbjct: 1  MATKPFFRRRKSDPFEGTDAPKIDYKDTRTLQRYISERGKIVPARITAVGSKNQRALARA 60

Query: 69 IKRARYLGLIAY 80
          IKRAR+L L+ Y
Sbjct: 61 IKRARFLALLPY 72


>gi|295837785|ref|ZP_06824718.1| ribosomal protein S18 [Streptomyces sp. SPB74]
 gi|302520485|ref|ZP_07272827.1| ribosomal protein S18 [Streptomyces sp. SPB78]
 gi|318058998|ref|ZP_07977721.1| 30S ribosomal protein S18 [Streptomyces sp. SA3_actG]
 gi|318075524|ref|ZP_07982856.1| 30S ribosomal protein S18 [Streptomyces sp. SA3_actF]
 gi|197698943|gb|EDY45876.1| ribosomal protein S18 [Streptomyces sp. SPB74]
 gi|302429380|gb|EFL01196.1| ribosomal protein S18 [Streptomyces sp. SPB78]
          Length = 78

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 35/62 (56%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         +DYKD  +L +++S RGKI   R++    + QR++A A+K +R + L+ Y
Sbjct: 14 CAFCKDKVTYVDYKDTNMLRKYISDRGKIRARRVTGNCTQHQRDVATAVKNSREMALLPY 73

Query: 81 VN 82
           +
Sbjct: 74 TS 75


>gi|317506809|ref|ZP_07964583.1| ribosomal protein S18 [Segniliparus rugosus ATCC BAA-974]
 gi|316254883|gb|EFV14179.1| ribosomal protein S18 [Segniliparus rugosus ATCC BAA-974]
          Length = 83

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 48/82 (58%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA   P   LR     + K  PL  +G   +DYKD  LL  F+S+RGKI   R++ ++ +
Sbjct: 1  MARKPPVKKLRVAEIRKPKKNPLKAQGVEHVDYKDTNLLRTFISERGKIRSRRVTGLTPR 60

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
          +QR++A A+K AR + L+ + N
Sbjct: 61 QQRDVAVAVKNAREMALLPFTN 82


>gi|312141932|ref|YP_004009268.1| 30S ribosomal protein s18 rpsr [Rhodococcus equi 103S]
 gi|325672814|ref|ZP_08152508.1| 30S ribosomal protein S18 [Rhodococcus equi ATCC 33707]
 gi|311891271|emb|CBH50592.1| 30S ribosomal protein S18 RpsR [Rhodococcus equi 103S]
 gi|325556067|gb|EGD25735.1| 30S ribosomal protein S18 [Rhodococcus equi ATCC 33707]
          Length = 80

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
           P P LR  V  ++K C    +   +IDYKD  LL +++S RGKI   R++    + QR+
Sbjct: 1  MPKPPLRDKVM-KKKVCTFCKEKNTQIDYKDTALLRKYVSDRGKIRARRVTGNCVQHQRD 59

Query: 65 LAKAIKRARYLGLIAYVN 82
          +A A+K +R + L+ YV+
Sbjct: 60 IAVAVKNSREVALLPYVS 77


>gi|331007839|ref|ZP_08330938.1| SSU ribosomal protein S18p [gamma proteobacterium IMCC1989]
 gi|330418356|gb|EGG92923.1| SSU ribosomal protein S18p [gamma proteobacterium IMCC1989]
          Length = 76

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/59 (50%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G  +IDYKD+  L  ++S+ GKIVPSRI+    K QR+L+ AIKRARYL L+ Y +
Sbjct: 14 TAEGTKQIDYKDLETLKAYISETGKIVPSRITGTKAKYQRQLSTAIKRARYLALVPYTD 72


>gi|114797845|ref|YP_760859.1| 30S ribosomal protein S18 [Hyphomonas neptunium ATCC 15444]
 gi|123323135|sp|Q0C084|RS18_HYPNA RecName: Full=30S ribosomal protein S18
 gi|114738019|gb|ABI76144.1| ribosomal protein S18 [Hyphomonas neptunium ATCC 15444]
          Length = 85

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/70 (55%), Positives = 54/70 (77%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    RRK  P +G+ A  IDYKD+++L R++S++GKIVPSRI++V+ K QR+LA+AIK
Sbjct: 13 RRPFGRRRKVDPFTGQHAQEIDYKDVKMLQRYISEKGKIVPSRITAVNLKNQRKLAQAIK 72

Query: 71 RARYLGLIAY 80
          RAR L LI +
Sbjct: 73 RARMLALIPF 82


>gi|134301135|ref|YP_001114631.1| 30S ribosomal protein S18 [Desulfotomaculum reducens MI-1]
 gi|205557265|sp|A4J9Q3|RS18_DESRM RecName: Full=30S ribosomal protein S18
 gi|134053835|gb|ABO51806.1| SSU ribosomal protein S18P [Desulfotomaculum reducens MI-1]
          Length = 77

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 35/63 (55%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C      A  IDYK+   L +++++RGKI+P RIS      QR L  AIKR+R + L+ 
Sbjct: 13 VCSFCVDKATSIDYKETSKLRKYVTERGKILPRRISGNCAHHQRMLTTAIKRSRNIALLP 72

Query: 80 YVN 82
          +  
Sbjct: 73 FST 75


>gi|313672482|ref|YP_004050593.1| SSU ribosomal protein s18p [Calditerrivibrio nitroreducens DSM
          19672]
 gi|312939238|gb|ADR18430.1| SSU ribosomal protein S18P [Calditerrivibrio nitroreducens DSM
          19672]
          Length = 76

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    ++KSC         IDYKD  LL +F+++RGKI+P R++    K QR LA AIK 
Sbjct: 5  RKKFQKKKSCRFCTDKIE-IDYKDSVLLRQFVTERGKILPRRLTGTCTKHQRRLATAIKT 63

Query: 72 ARYLGLIAY 80
          AR + L+ +
Sbjct: 64 ARIIALLPF 72


>gi|226226611|ref|YP_002760717.1| 30S ribosomal protein S18 [Gemmatimonas aurantiaca T-27]
 gi|226089802|dbj|BAH38247.1| 30S ribosomal protein S18 [Gemmatimonas aurantiaca T-27]
          Length = 73

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/68 (50%), Positives = 49/68 (72%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          +   +K CP++  G   +DYKD RLL RF++  GKI+PSR+S V  + QR+L+KA+K+AR
Sbjct: 1  MRRPKKPCPITEAGIRYVDYKDDRLLARFITDYGKILPSRLSGVDARHQRQLSKAVKKAR 60

Query: 74 YLGLIAYV 81
          YL L+ YV
Sbjct: 61 YLALLPYV 68


>gi|331700355|ref|YP_004336594.1| 30S ribosomal protein S18 [Pseudonocardia dioxanivorans CB1190]
 gi|326955044|gb|AEA28741.1| 30S ribosomal protein S18 [Pseudonocardia dioxanivorans CB1190]
          Length = 78

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/76 (36%), Positives = 44/76 (57%), Gaps = 3/76 (3%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
           P+LR+    ++K C      A  IDYKD  LL +F+S RGKI   R++    + QR++A
Sbjct: 3  KPVLRKP---KKKVCAFCKDKAQEIDYKDTGLLRKFISDRGKIRARRVTGNCRQHQRDVA 59

Query: 67 KAIKRARYLGLIAYVN 82
           A+K +R + L+ Y +
Sbjct: 60 VAVKNSREVALLPYTS 75


>gi|318041407|ref|ZP_07973363.1| 30S ribosomal protein S18 [Synechococcus sp. CB0101]
          Length = 73

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            +++  P+  K    IDYKD+ LL +F+++RGKI+P R++ ++ K+QR+L  A+KRAR 
Sbjct: 5  FFKKRLSPI--KPGDPIDYKDVDLLKKFITERGKILPRRLTGLTAKQQRDLTNAVKRARI 62

Query: 75 LGLIAYVN 82
          + L+ +VN
Sbjct: 63 VALLPFVN 70


>gi|33865759|ref|NP_897318.1| 30S ribosomal protein S18 [Synechococcus sp. WH 8102]
 gi|78184710|ref|YP_377145.1| 30S ribosomal protein S18 [Synechococcus sp. CC9902]
 gi|78212867|ref|YP_381646.1| 30S ribosomal protein S18 [Synechococcus sp. CC9605]
 gi|87124491|ref|ZP_01080340.1| ribosomal protein S18 [Synechococcus sp. RS9917]
 gi|88808524|ref|ZP_01124034.1| 30S ribosomal protein S18 [Synechococcus sp. WH 7805]
 gi|113953413|ref|YP_730544.1| 30S ribosomal protein S18 [Synechococcus sp. CC9311]
 gi|116070581|ref|ZP_01467850.1| 30S ribosomal protein S18 [Synechococcus sp. BL107]
 gi|148239628|ref|YP_001225015.1| 30S ribosomal protein S18 [Synechococcus sp. WH 7803]
 gi|194476530|ref|YP_002048709.1| 30S ribosomal protein S18 [Paulinella chromatophora]
 gi|254430586|ref|ZP_05044289.1| ribosomal protein S18 [Cyanobium sp. PCC 7001]
 gi|260436039|ref|ZP_05790009.1| ribosomal protein S18 [Synechococcus sp. WH 8109]
 gi|59798843|sp|Q7U6W1|RS18_SYNPX RecName: Full=30S ribosomal protein S18
 gi|123327838|sp|Q0IAH8|RS18_SYNS3 RecName: Full=30S ribosomal protein S18
 gi|123743319|sp|Q3AJZ1|RS18_SYNSC RecName: Full=30S ribosomal protein S18
 gi|123743504|sp|Q3AVJ4|RS18_SYNS9 RecName: Full=30S ribosomal protein S18
 gi|166222251|sp|A5GLA3|RS18_SYNPW RecName: Full=30S ribosomal protein S18
 gi|205831408|sp|B1X3I0|RR18_PAUCH RecName: Full=30S ribosomal protein S18, organellar chromatophore
 gi|33632929|emb|CAE07740.1| 30S ribosomal protein S18 [Synechococcus sp. WH 8102]
 gi|78169004|gb|ABB26101.1| SSU ribosomal protein S18P [Synechococcus sp. CC9902]
 gi|78197326|gb|ABB35091.1| ribosomal protein S18 [Synechococcus sp. CC9605]
 gi|86168063|gb|EAQ69321.1| ribosomal protein S18 [Synechococcus sp. RS9917]
 gi|88787512|gb|EAR18669.1| 30S ribosomal protein S18 [Synechococcus sp. WH 7805]
 gi|113880764|gb|ABI45722.1| ribosomal protein S18 [Synechococcus sp. CC9311]
 gi|116065986|gb|EAU71743.1| 30S ribosomal protein S18 [Synechococcus sp. BL107]
 gi|147848167|emb|CAK23718.1| 30S ribosomal protein S18 [Synechococcus sp. WH 7803]
 gi|171191537|gb|ACB42499.1| 30S ribosomal protein S18 [Paulinella chromatophora]
 gi|197625039|gb|EDY37598.1| ribosomal protein S18 [Cyanobium sp. PCC 7001]
 gi|260413913|gb|EEX07209.1| ribosomal protein S18 [Synechococcus sp. WH 8109]
          Length = 73

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            +++  P+  K    IDYKD+ LL +F+++RGKI+P R++ ++ K+QR+L  A+KRAR 
Sbjct: 5  FFKKRLSPI--KPGDPIDYKDVDLLKKFITERGKILPRRLTGLTAKQQRDLTNAVKRARI 62

Query: 75 LGLIAYVN 82
          + L+ +VN
Sbjct: 63 VALLPFVN 70


>gi|50364897|ref|YP_053322.1| 30S ribosomal protein S18 [Mesoplasma florum L1]
 gi|59798695|sp|Q6F235|RS18_MESFL RecName: Full=30S ribosomal protein S18
 gi|50363453|gb|AAT75438.1| 30S ribosomal protein S18 [Mesoplasma florum L1]
          Length = 76

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 39/59 (66%)

Query: 23 LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
           +      IDYKD+ LL +F+S  G+I+P RI+  S K QR+LA AIKRAR + L+ YV
Sbjct: 16 FAKNKINYIDYKDVELLKKFISGNGQILPRRITGTSPKHQRQLAVAIKRARQMALLPYV 74


>gi|86743195|ref|YP_483595.1| 30S ribosomal protein S18 [Frankia sp. CcI3]
 gi|123723312|sp|Q2J4C6|RS18_FRASC RecName: Full=30S ribosomal protein S18
 gi|86570057|gb|ABD13866.1| SSU ribosomal protein S18P [Frankia sp. CcI3]
          Length = 78

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 37/68 (54%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             ++K C         ID+KD  LL +++S RGKI   R+S    + QR++A A+K +R
Sbjct: 7  RKPKKKVCVFCKDKVDYIDFKDTSLLRKYISDRGKIRARRVSGNCSQHQRDVATAVKNSR 66

Query: 74 YLGLIAYV 81
           + L+ Y 
Sbjct: 67 EMALLPYT 74


>gi|168335183|ref|ZP_02693288.1| 30S ribosomal protein S18 (BS21) [Epulopiscium sp. 'N.t.
          morphotype B']
          Length = 77

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/74 (44%), Positives = 47/74 (63%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
           + +R    RRK    +G    +I+YKDI  L +F+S+RGKI+P RI+  S K QR+L  
Sbjct: 2  SMQKRRGRRRRKVNQFAGDNIKKINYKDINTLKKFISERGKILPRRITGNSAKAQRKLTA 61

Query: 68 AIKRARYLGLIAYV 81
          AIKRAR++ L+ Y 
Sbjct: 62 AIKRARHIALLPYT 75


>gi|146340285|ref|YP_001205333.1| 30S ribosomal protein S18 [Bradyrhizobium sp. ORS278]
 gi|148255212|ref|YP_001239797.1| 30S ribosomal protein S18 [Bradyrhizobium sp. BTAi1]
 gi|166220926|sp|A5EI97|RS18_BRASB RecName: Full=30S ribosomal protein S18
 gi|166220927|sp|A4YT76|RS18_BRASO RecName: Full=30S ribosomal protein S18
 gi|146193091|emb|CAL77102.1| 30S ribosomal subunit protein S18 [Bradyrhizobium sp. ORS278]
 gi|146407385|gb|ABQ35891.1| SSU ribosomal protein S18P [Bradyrhizobium sp. BTAi1]
          Length = 79

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 56/63 (88%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG  AP+IDYKD +LL R++S+RGKIVPSRI++VS KKQRELA+AIKRAR+LGL+
Sbjct: 15 KTCPFSGPNAPKIDYKDSKLLMRYVSERGKIVPSRITAVSAKKQRELARAIKRARFLGLL 74

Query: 79 AYV 81
           YV
Sbjct: 75 PYV 77


>gi|254391458|ref|ZP_05006660.1| 30S ribosomal protein S18 [Streptomyces clavuligerus ATCC 27064]
 gi|294813711|ref|ZP_06772354.1| 30S ribosomal protein S18 2 [Streptomyces clavuligerus ATCC
          27064]
 gi|326442133|ref|ZP_08216867.1| 30S ribosomal protein S18 [Streptomyces clavuligerus ATCC 27064]
 gi|197705147|gb|EDY50959.1| 30S ribosomal protein S18 [Streptomyces clavuligerus ATCC 27064]
 gi|294326310|gb|EFG07953.1| 30S ribosomal protein S18 2 [Streptomyces clavuligerus ATCC
          27064]
          Length = 78

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 35/62 (56%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         +DYKD  +L +F+S RGKI   R++    + QR++A A+K +R + L+ Y
Sbjct: 14 CAFCKDKTVYVDYKDTNMLRKFISDRGKIRARRVTGNCTQHQRDVATAVKNSREMALLPY 73

Query: 81 VN 82
           +
Sbjct: 74 TS 75


>gi|226942913|ref|YP_002797986.1| 30S ribosomal protein S18 [Azotobacter vinelandii DJ]
 gi|259494801|sp|C1DLR3|RS18_AZOVD RecName: Full=30S ribosomal protein S18
 gi|226717840|gb|ACO77011.1| 30S ribosomal protein S18 [Azotobacter vinelandii DJ]
          Length = 76

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   ID+KD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRARYL L+ Y +
Sbjct: 14 TAEGVKEIDFKDLNTLKAYISETGKIVPSRITGTKARYQRQLATAIKRARYLALLPYTD 72


>gi|317969855|ref|ZP_07971245.1| 30S ribosomal protein S18 [Synechococcus sp. CB0205]
          Length = 73

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            +++  P+  K    IDYKD+ LL +F+++RGKI+P R++ ++ K+QR+L  A+KRAR 
Sbjct: 5  FFKKRLSPI--KPGEPIDYKDVDLLKKFITERGKILPRRLTGLTAKQQRDLTNAVKRARI 62

Query: 75 LGLIAYVN 82
          + L+ +VN
Sbjct: 63 VALLPFVN 70


>gi|296136558|ref|YP_003643800.1| ribosomal protein S18 [Thiomonas intermedia K12]
 gi|295796680|gb|ADG31470.1| ribosomal protein S18 [Thiomonas intermedia K12]
          Length = 96

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 46/77 (59%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
              + ++  R++ C  +     RIDYKD+ +L   +++  +I+P+R++  S   QR+L 
Sbjct: 17 RRNQQSSLFKRKRFCRFTVAKVERIDYKDVDVLKDLIAENARIIPARLTGTSAHYQRQLN 76

Query: 67 KAIKRARYLGLIAYVNL 83
           AIKRAR+L L+ Y +L
Sbjct: 77 TAIKRARFLALLPYTDL 93


>gi|72382180|ref|YP_291535.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. NATL2A]
 gi|124025720|ref|YP_001014836.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. NATL1A]
 gi|123759898|sp|Q46KZ6|RS18_PROMT RecName: Full=30S ribosomal protein S18
 gi|166220971|sp|A2C261|RS18_PROM1 RecName: Full=30S ribosomal protein S18
 gi|72002030|gb|AAZ57832.1| SSU ribosomal protein S18P [Prochlorococcus marinus str. NATL2A]
 gi|123960788|gb|ABM75571.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. NATL1A]
          Length = 73

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 47/67 (70%), Gaps = 2/67 (2%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           ++K  P+  K    IDYKD+ LL +F++ RGKI+P R++ ++ K+QR+L  A+KRAR +
Sbjct: 6  FKQKLSPI--KPGDPIDYKDVELLKKFITDRGKILPRRLTGLTAKQQRDLTTAVKRARII 63

Query: 76 GLIAYVN 82
           L+ +VN
Sbjct: 64 ALLPFVN 70


>gi|39938497|ref|NP_950263.1| 30S ribosomal protein S18 [Onion yellows phytoplasma OY-M]
 gi|59798755|sp|Q6YRK3|RS18_ONYPE RecName: Full=30S ribosomal protein S18
 gi|39721606|dbj|BAD04096.1| ribosomal protein S18 [Onion yellows phytoplasma OY-M]
          Length = 79

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 47/72 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +     RRK C  +     +ID+KDI LL RF++ RG+I+  R+++ S K QR+LA AI
Sbjct: 6  KKNTFKKRRKVCFFTENKVTKIDFKDIELLQRFITDRGRILSRRVTNTSAKWQRQLAIAI 65

Query: 70 KRARYLGLIAYV 81
          KRAR++ LI ++
Sbjct: 66 KRARHMALIPFI 77


>gi|254424438|ref|ZP_05038156.1| ribosomal protein S18 [Synechococcus sp. PCC 7335]
 gi|196191927|gb|EDX86891.1| ribosomal protein S18 [Synechococcus sp. PCC 7335]
          Length = 71

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/68 (48%), Positives = 50/68 (73%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RR+  P+  +   +IDYKD+ LL +F+++RGKI+P RI+ ++ K+QR+L KAIKRAR 
Sbjct: 3  YFRRRVSPIKPE--EKIDYKDVDLLRKFVTERGKILPRRITGLTSKQQRDLTKAIKRARV 60

Query: 75 LGLIAYVN 82
          + L+ YVN
Sbjct: 61 VALLPYVN 68


>gi|237809238|ref|YP_002893678.1| 30S ribosomal protein S18 [Tolumonas auensis DSM 9187]
 gi|259494821|sp|C4LAB7|RS18_TOLAT RecName: Full=30S ribosomal protein S18
 gi|237501499|gb|ACQ94092.1| ribosomal protein S18 [Tolumonas auensis DSM 9187]
          Length = 76

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 41/60 (68%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          + +    IDYKD   L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL L+ Y +L
Sbjct: 14 TAERVTEIDYKDTVTLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLALLPYTDL 73


>gi|152997467|ref|YP_001342302.1| 30S ribosomal protein S18 [Marinomonas sp. MWYL1]
 gi|189029680|sp|A6W0Y8|RS18_MARMS RecName: Full=30S ribosomal protein S18
 gi|150838391|gb|ABR72367.1| ribosomal protein S18 [Marinomonas sp. MWYL1]
          Length = 76

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    + QR+LA AIKRARY+ ++ Y +
Sbjct: 14 TAEGVKEIDYKDLDTLKGYITETGKIVPSRITGTKARYQRQLATAIKRARYIAILPYTD 72


>gi|182437465|ref|YP_001825184.1| 30S ribosomal protein S18 [Streptomyces griseus subsp. griseus
          NBRC 13350]
 gi|239942699|ref|ZP_04694636.1| 30S ribosomal protein S18 [Streptomyces roseosporus NRRL 15998]
 gi|239989158|ref|ZP_04709822.1| 30S ribosomal protein S18 [Streptomyces roseosporus NRRL 11379]
 gi|282863347|ref|ZP_06272406.1| ribosomal protein S18 [Streptomyces sp. ACTE]
 gi|291446163|ref|ZP_06585553.1| 30S ribosomal protein S18 1 [Streptomyces roseosporus NRRL 15998]
 gi|326778120|ref|ZP_08237385.1| 30S ribosomal protein S18 [Streptomyces cf. griseus XylebKG-1]
 gi|205556703|sp|B1VPC2|RS182_STRGG RecName: Full=30S ribosomal protein S18 2
 gi|178465981|dbj|BAG20501.1| putative 30S ribosomal protein S18 [Streptomyces griseus subsp.
          griseus NBRC 13350]
 gi|282561682|gb|EFB67225.1| ribosomal protein S18 [Streptomyces sp. ACTE]
 gi|291349110|gb|EFE76014.1| 30S ribosomal protein S18 1 [Streptomyces roseosporus NRRL 15998]
 gi|320009722|gb|ADW04572.1| ribosomal protein S18 [Streptomyces flavogriseus ATCC 33331]
 gi|326658453|gb|EGE43299.1| 30S ribosomal protein S18 [Streptomyces cf. griseus XylebKG-1]
          Length = 78

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 35/62 (56%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         +DYKD  +L +F+S RGKI   R++    + QR++A A+K +R + L+ Y
Sbjct: 14 CAFCKDKTQYVDYKDTNMLRKFISDRGKIRARRVTGNCTQHQRDVATAVKNSREMALLPY 73

Query: 81 VN 82
           +
Sbjct: 74 TS 75


>gi|42560585|ref|NP_975036.1| 30S ribosomal protein S18 [Mycoplasma mycoides subsp. mycoides SC
          str. PG1]
 gi|331703042|ref|YP_004399729.1| 30S ribosomal protein S18 [Mycoplasma mycoides subsp. capri LC
          str. 95010]
 gi|59798739|sp|Q6MUK6|RS18_MYCMS RecName: Full=30S ribosomal protein S18
 gi|42492081|emb|CAE76678.1| 30S ribosomal protein S18 [Mycoplasma mycoides subsp. mycoides SC
          str. PG1]
 gi|256384267|gb|ACU78837.1| ribosomal protein S18 [Mycoplasma mycoides subsp. capri str.
          GM12]
 gi|256385100|gb|ACU79669.1| ribosomal protein S18 [Mycoplasma mycoides subsp. capri str.
          GM12]
 gi|296455226|gb|ADH21461.1| ribosomal protein S18 [synthetic Mycoplasma mycoides JCVI-syn1.0]
 gi|301320649|gb|ADK69292.1| ribosomal protein S18 [Mycoplasma mycoides subsp. mycoides SC
          str. Gladysdale]
 gi|328801597|emb|CBW53750.1| 30S ribosomal protein S18 [Mycoplasma mycoides subsp. capri LC
          str. 95010]
          Length = 75

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 38/62 (61%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
                     IDYKDI LL +F+S  G+I+P RI+  S K QR+LA AIKRAR + L+ 
Sbjct: 12 VNFFQKNNIKYIDYKDIELLKKFISPNGQILPRRITGTSPKDQRQLALAIKRARQMALLP 71

Query: 80 YV 81
          YV
Sbjct: 72 YV 73


>gi|87303683|ref|ZP_01086458.1| 30S ribosomal protein S18 [Synechococcus sp. WH 5701]
 gi|87281788|gb|EAQ73753.1| 30S ribosomal protein S18 [Synechococcus sp. WH 5701]
          Length = 73

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 29/68 (42%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            +++  P+  K    IDYKD+ LL +F+++RGKI+P R+S ++ K+QR+L  A+KRAR 
Sbjct: 5  FFKKRLSPI--KPGDPIDYKDVDLLKKFITERGKILPRRLSGLTAKQQRDLTNAVKRARI 62

Query: 75 LGLIAYVN 82
          + L+ +VN
Sbjct: 63 VALLPFVN 70


>gi|258591291|emb|CBE67588.1| 30S ribosomal subunit protein S18 [NC10 bacterium 'Dutch
          sediment']
          Length = 78

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 40/72 (55%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          L +R    R+K C         +D+KD + L  F++ RGKI+P RIS      QR+L  A
Sbjct: 2  LKKRRSFRRQKVCKWCVDKVETVDFKDAKRLRNFITDRGKIIPRRISGNCAGHQRQLGGA 61

Query: 69 IKRARYLGLIAY 80
          IKRAR + L+ +
Sbjct: 62 IKRARSIALLPF 73


>gi|284993409|ref|YP_003411964.1| 30S ribosomal protein S18 [Geodermatophilus obscurus DSM 43160]
 gi|284066655|gb|ADB77593.1| ribosomal protein S18 [Geodermatophilus obscurus DSM 43160]
          Length = 78

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 36/62 (58%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C      A  IDYKD  LL +F+S RGKI   R+S    + QR++A A+K +R + L+ Y
Sbjct: 14 CQFCKDKATYIDYKDTTLLRKFISDRGKIRARRVSGNCSQHQRDVATAVKNSREMALLPY 73

Query: 81 VN 82
           +
Sbjct: 74 TS 75


>gi|261855980|ref|YP_003263263.1| ribosomal protein S18 [Halothiobacillus neapolitanus c2]
 gi|261836449|gb|ACX96216.1| ribosomal protein S18 [Halothiobacillus neapolitanus c2]
          Length = 74

 Score = 88.5 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +   +IDYKD+  L ++L++ GKIVP+R++  + + QR+L  AIKRAR+L L+ Y +
Sbjct: 14 TAENVKQIDYKDLDTLKQYLTETGKIVPARVTGTAARYQRQLQTAIKRARFLALLPYTD 72


>gi|254384805|ref|ZP_05000142.1| 30S ribosomal protein S18 [Streptomyces sp. Mg1]
 gi|297193324|ref|ZP_06910722.1| 30S ribosomal protein S18 1 [Streptomyces pristinaespiralis ATCC
          25486]
 gi|302535601|ref|ZP_07287943.1| ribosomal protein S18 [Streptomyces sp. C]
 gi|194343687|gb|EDX24653.1| 30S ribosomal protein S18 [Streptomyces sp. Mg1]
 gi|197718358|gb|EDY62266.1| 30S ribosomal protein S18 1 [Streptomyces pristinaespiralis ATCC
          25486]
 gi|302444496|gb|EFL16312.1| ribosomal protein S18 [Streptomyces sp. C]
 gi|328883731|emb|CCA56970.1| SSU ribosomal protein S18p [Streptomyces venezuelae ATCC 10712]
          Length = 78

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 35/62 (56%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         +DYKD  +L +F+S RGKI   R++    + QR++A A+K +R + L+ Y
Sbjct: 14 CAFCKDKTAYVDYKDTNMLRKFISDRGKIRARRVTGNCTQHQRDVATAVKNSREMALLPY 73

Query: 81 VN 82
           +
Sbjct: 74 TS 75


>gi|307326229|ref|ZP_07605426.1| ribosomal protein S18 [Streptomyces violaceusniger Tu 4113]
 gi|306888172|gb|EFN19161.1| ribosomal protein S18 [Streptomyces violaceusniger Tu 4113]
          Length = 80

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 47/77 (61%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          ++     +R    RR+  PL   G   +DYKD  LL +F+S RGKI   R+S V+ ++QR
Sbjct: 1  MSRRIGTKRPDPKRRRVNPLDAAGITYVDYKDTDLLRKFISDRGKIRSRRVSHVTRRQQR 60

Query: 64 ELAKAIKRARYLGLIAY 80
          ++A+AIK AR + L+ Y
Sbjct: 61 QIARAIKNAREMALLPY 77


>gi|86156546|ref|YP_463331.1| 30S ribosomal protein S18 [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123723166|sp|Q2IM64|RS18_ANADE RecName: Full=30S ribosomal protein S18
 gi|85773057|gb|ABC79894.1| SSU ribosomal protein S18P [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 135

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 37/63 (58%)

Query: 19  KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
           K C        ++DYKD   +  FL++RGKI+P RIS    K QRE+A AIKR R L ++
Sbjct: 69  KVCRFCADKTLKVDYKDQGQMKYFLTERGKIIPRRISGNCAKHQREVATAIKRGRMLAIL 128

Query: 79  AYV 81
            Y 
Sbjct: 129 PYT 131


>gi|169832351|ref|YP_001718333.1| 30S ribosomal protein S18 [Candidatus Desulforudis audaxviator
          MP104C]
 gi|205557228|sp|B1I6S9|RS18_DESAP RecName: Full=30S ribosomal protein S18
 gi|169639195|gb|ACA60701.1| ribosomal protein S18 [Candidatus Desulforudis audaxviator
          MP104C]
          Length = 75

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 35/63 (55%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYKD   L +++++RGKI+P RI+      QR L  +IKR+R++ L+ 
Sbjct: 12 ICSFCVDKIAVIDYKDTPRLKKYITERGKILPRRITGNCAHHQRMLTVSIKRSRHMALLP 71

Query: 80 YVN 82
          +  
Sbjct: 72 FST 74


>gi|302870697|ref|YP_003839334.1| 30S ribosomal protein S18 [Micromonospora aurantiaca ATCC 27029]
 gi|315506934|ref|YP_004085821.1| ribosomal protein s18 [Micromonospora sp. L5]
 gi|302573556|gb|ADL49758.1| ribosomal protein S18 [Micromonospora aurantiaca ATCC 27029]
 gi|315413553|gb|ADU11670.1| ribosomal protein S18 [Micromonospora sp. L5]
          Length = 79

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 48/78 (61%), Gaps = 3/78 (3%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A    LR+    ++K  PL   G   IDYKD  LL +F+S RGKI   R++ V+ ++QR
Sbjct: 1  MAKAAALRKP---KKKVNPLDKDGITYIDYKDTALLRKFISDRGKIRARRVTGVTSQQQR 57

Query: 64 ELAKAIKRARYLGLIAYV 81
          ++A+A+K AR + L+ Y 
Sbjct: 58 QIARAVKNAREMALLPYT 75


>gi|83591753|ref|YP_425505.1| 30S ribosomal protein S18 [Rhodospirillum rubrum ATCC 11170]
 gi|123753309|sp|Q2RXC7|RS18_RHORT RecName: Full=30S ribosomal protein S18
 gi|83574667|gb|ABC21218.1| SSU ribosomal protein S18P [Rhodospirillum rubrum ATCC 11170]
          Length = 78

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 47/63 (74%), Positives = 57/63 (90%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K+CP SG GAP+IDYKDI+LL RF+S+RGKIVPSRI++VS KKQRELA+AIKRAR+L L+
Sbjct: 14 KTCPFSGAGAPKIDYKDIKLLLRFVSERGKIVPSRITAVSAKKQRELARAIKRARFLSLL 73

Query: 79 AYV 81
           YV
Sbjct: 74 PYV 76


>gi|59712918|ref|YP_205694.1| 30S ribosomal protein S18 [Vibrio fischeri ES114]
 gi|197335451|ref|YP_002157106.1| ribosomal protein S18 [Vibrio fischeri MJ11]
 gi|209696170|ref|YP_002264100.1| 30S ribosomal protein S18 [Aliivibrio salmonicida LFI1238]
 gi|75506909|sp|Q5E2E0|RS18_VIBF1 RecName: Full=30S ribosomal protein S18
 gi|229470510|sp|B6EMP4|RS18_ALISL RecName: Full=30S ribosomal protein S18
 gi|229560080|sp|B5FBQ1|RS18_VIBFM RecName: Full=30S ribosomal protein S18
 gi|59481019|gb|AAW86806.1| 30S ribosomal subunit protein S18 [Vibrio fischeri ES114]
 gi|197316941|gb|ACH66388.1| ribosomal protein S18 [Vibrio fischeri MJ11]
 gi|208010123|emb|CAQ80448.1| 30S ribosomal subunit protein S18 [Aliivibrio salmonicida
          LFI1238]
          Length = 75

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+LA+AIKR+RYL L+ Y +
Sbjct: 14 TAEGVQEIDYKDVATLKNYITEAGKIVPSRITGTRAKYQRQLARAIKRSRYLALLPYTD 72


>gi|325972886|ref|YP_004249950.1| 30S ribosomal protein S18 [Mycoplasma suis str. Illinois]
 gi|323651488|gb|ADX97570.1| 30S ribosomal protein S18 [Mycoplasma suis str. Illinois]
          Length = 124

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 40/73 (54%)

Query: 9   LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
              R     +K C L  +G   IDYKD   L  +L +  K++  +IS    K Q +L++A
Sbjct: 50  QRTRRNKKFKKVCWLCRRGILTIDYKDTEFLKNYLKRYNKVLIHKISGNCLKHQHQLSQA 109

Query: 69  IKRARYLGLIAYV 81
           IKRARY+ L+ +V
Sbjct: 110 IKRARYIALLPFV 122


>gi|258517417|ref|YP_003193639.1| 30S ribosomal protein S18 [Desulfotomaculum acetoxidans DSM 771]
 gi|257781122|gb|ACV65016.1| ribosomal protein S18 [Desulfotomaculum acetoxidans DSM 771]
          Length = 76

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 36/62 (58%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYK+I  L +++++RGKI+P RIS    K QR L  +IKRAR + L+ 
Sbjct: 13 ICSFCVDKVQSIDYKEIPRLKKYITERGKILPRRISGNCAKHQRMLTVSIKRARNMALLP 72

Query: 80 YV 81
          + 
Sbjct: 73 FT 74


>gi|150387887|ref|YP_001317936.1| ribosomal protein S18 [Alkaliphilus metalliredigens QYMF]
 gi|205556760|sp|A6TJA9|RS18_ALKMQ RecName: Full=30S ribosomal protein S18
 gi|149947749|gb|ABR46277.1| ribosomal protein S18 [Alkaliphilus metalliredigens QYMF]
          Length = 76

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C      + +IDYK++  L +++++RGKI+P RIS      QR++ +AIKR+R++ L+ 
Sbjct: 13 VCTFCADKSSKIDYKEVHKLKKYVTERGKILPRRISGNCAIHQRDITQAIKRSRHIALLP 72

Query: 80 YV 81
          Y 
Sbjct: 73 YT 74


>gi|111226184|ref|YP_716978.1| 30S ribosomal protein S18 [Frankia alni ACN14a]
 gi|123043775|sp|Q0RAR6|RS182_FRAAA RecName: Full=30S ribosomal protein S18 2
 gi|111153716|emb|CAJ65474.1| 30S ribosomal subunit protein S18 [Frankia alni ACN14a]
          Length = 73

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 37/68 (54%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             ++K C         ID+KD  LL +++S RGKI   R+S    + QR++A A+K +R
Sbjct: 2  RKPKKKVCVFCKDKVEYIDFKDTSLLRKYISDRGKIRARRVSGNCSQHQRDVATAVKNSR 61

Query: 74 YLGLIAYV 81
           + L+ Y 
Sbjct: 62 EMALLPYT 69


>gi|159040547|ref|YP_001539800.1| 30S ribosomal protein S18 [Salinispora arenicola CNS-205]
 gi|238061877|ref|ZP_04606586.1| 30S ribosomal protein S18 [Micromonospora sp. ATCC 39149]
 gi|330470800|ref|YP_004408543.1| 30S ribosomal protein S18 [Verrucosispora maris AB-18-032]
 gi|205617156|sp|A8LXG1|RS18_SALAI RecName: Full=30S ribosomal protein S18
 gi|157919382|gb|ABW00810.1| ribosomal protein S18 [Salinispora arenicola CNS-205]
 gi|237883688|gb|EEP72516.1| 30S ribosomal protein S18 [Micromonospora sp. ATCC 39149]
 gi|328813771|gb|AEB47943.1| 30S ribosomal protein S18 [Verrucosispora maris AB-18-032]
          Length = 79

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/78 (39%), Positives = 48/78 (61%), Gaps = 3/78 (3%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A    LR+    ++K  PL   G   IDYKD  LL +F+S RGKI   R++ V+ ++QR
Sbjct: 1  MAKAAALRKP---KKKVNPLDKDGITYIDYKDTALLRKFISDRGKIRARRVTGVTSQQQR 57

Query: 64 ELAKAIKRARYLGLIAYV 81
          ++A+A+K AR + L+ Y 
Sbjct: 58 QIARAVKNAREMALLPYT 75


>gi|282862689|ref|ZP_06271750.1| ribosomal protein S18 [Streptomyces sp. ACTE]
 gi|282562375|gb|EFB67916.1| ribosomal protein S18 [Streptomyces sp. ACTE]
          Length = 78

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 42/71 (59%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + RR    + +  PL   G   IDYKD  LL +F+S RGKI   R++ VS ++QR +A A
Sbjct: 1  MTRRTDPRKPRPNPLDAAGITYIDYKDTDLLRKFVSDRGKIRSRRVTRVSARQQRHIATA 60

Query: 69 IKRARYLGLIA 79
          +K AR + L+ 
Sbjct: 61 VKNAREMALLP 71


>gi|325989379|ref|YP_004249078.1| 30S ribosomal protein S18 [Mycoplasma suis KI3806]
 gi|323574464|emb|CBZ40114.1| 30S ribosomal protein S18 [Mycoplasma suis]
          Length = 124

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 40/73 (54%)

Query: 9   LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
              R     +K C L  +G   IDYKD   L  +L +  K++  +IS    K Q +L++A
Sbjct: 50  QRTRKNKKFKKVCWLCRRGVLTIDYKDTEFLKNYLKRYNKVLIHKISGNCLKHQHQLSQA 109

Query: 69  IKRARYLGLIAYV 81
           IKRARY+ L+ +V
Sbjct: 110 IKRARYIALLPFV 122


>gi|284036033|ref|YP_003385963.1| ribosomal protein S18 [Spirosoma linguale DSM 74]
 gi|283815326|gb|ADB37164.1| ribosomal protein S18 [Spirosoma linguale DSM 74]
          Length = 83

 Score = 88.5 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 44/70 (62%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
              +R+K       G   IDYKD   L + L+++GKI+P R++  S K QR++A+A+KR
Sbjct: 9  SKTENRKKYDRFKKAGIKYIDYKDGNFLLKLLNEQGKILPRRLTGTSLKNQRKVAQAVKR 68

Query: 72 ARYLGLIAYV 81
          AR+L ++ YV
Sbjct: 69 ARHLAILPYV 78


>gi|149907734|ref|ZP_01896481.1| 30S ribosomal protein S18 [Moritella sp. PE36]
 gi|149809404|gb|EDM69333.1| 30S ribosomal protein S18 [Moritella sp. PE36]
          Length = 75

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/60 (51%), Positives = 42/60 (70%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL 83
          + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+L +AIKRARYL L+ Y +L
Sbjct: 14 TSEGVTEIDYKDIATLKNYVTESGKIVPSRITGTRAKYQRQLGRAIKRARYLSLLPYTDL 73


>gi|218264329|ref|ZP_03478186.1| hypothetical protein PRABACTJOHN_03877 [Parabacteroides johnsonii
          DSM 18315]
 gi|218222097|gb|EEC94747.1| hypothetical protein PRABACTJOHN_03877 [Parabacteroides johnsonii
          DSM 18315]
          Length = 89

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/57 (50%), Positives = 40/57 (70%)

Query: 26 KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
           G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 29 NGIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPYVT 85


>gi|220915256|ref|YP_002490560.1| ribosomal protein S18 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|254765404|sp|B8J802|RS18_ANAD2 RecName: Full=30S ribosomal protein S18
 gi|219953110|gb|ACL63494.1| ribosomal protein S18 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 133

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 38/63 (60%)

Query: 19  KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
           K C      A ++DYKD   +  FL++RGKI+P RIS    K QRE+A AIKR R L ++
Sbjct: 67  KVCRFCADKALKVDYKDQGQMKYFLTERGKIIPRRISGNCAKHQREVATAIKRGRMLAIL 126

Query: 79  AYV 81
            Y 
Sbjct: 127 PYT 129


>gi|197120545|ref|YP_002132496.1| 30S ribosomal protein S18 [Anaeromyxobacter sp. K]
 gi|229470520|sp|B4ULC0|RS18_ANASK RecName: Full=30S ribosomal protein S18
 gi|196170394|gb|ACG71367.1| ribosomal protein S18 [Anaeromyxobacter sp. K]
          Length = 135

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 38/63 (60%)

Query: 19  KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
           K C      A ++DYKD   +  FL++RGKI+P RIS    K QRE+A AIKR R L ++
Sbjct: 69  KVCRFCADKALKVDYKDQGQMKYFLTERGKIIPRRISGNCAKHQREVATAIKRGRMLAIL 128

Query: 79  AYV 81
            Y 
Sbjct: 129 PYT 131


>gi|89075972|ref|ZP_01162344.1| 30S ribosomal protein S18 [Photobacterium sp. SKA34]
 gi|90581364|ref|ZP_01237160.1| 30S ribosomal protein S18 [Vibrio angustum S14]
 gi|262275142|ref|ZP_06052953.1| SSU ribosomal protein S18p [Grimontia hollisae CIP 101886]
 gi|269103597|ref|ZP_06156294.1| SSU ribosomal protein S18p [Photobacterium damselae subsp.
          damselae CIP 102761]
 gi|330445015|ref|ZP_08308669.1| ribosomal protein S18 [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
 gi|89048321|gb|EAR53900.1| 30S ribosomal protein S18 [Photobacterium sp. SKA34]
 gi|90437474|gb|EAS62669.1| 30S ribosomal protein S18 [Vibrio angustum S14]
 gi|262221705|gb|EEY73019.1| SSU ribosomal protein S18p [Grimontia hollisae CIP 101886]
 gi|268163495|gb|EEZ41991.1| SSU ribosomal protein S18p [Photobacterium damselae subsp.
          damselae CIP 102761]
 gi|328493133|dbj|GAA03166.1| ribosomal protein S18 [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
          Length = 75

 Score = 88.1 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+LA+AIKR+RYL L+ Y +
Sbjct: 14 TAEGVQEIDYKDVATLKNYITEAGKIVPSRITGTRAKYQRQLARAIKRSRYLALLPYTD 72


>gi|324998552|ref|ZP_08119664.1| 30S ribosomal protein S18 [Pseudonocardia sp. P1]
          Length = 78

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 39/69 (56%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             ++K C      A  IDYKD  LL +F+S RGKI   R++    + QR++A A+K +R
Sbjct: 7  RKPKKKVCAFCKDKAQPIDYKDTGLLRKFISDRGKIRARRVTGNCRQHQRDVAVAVKNSR 66

Query: 74 YLGLIAYVN 82
           + L+ Y +
Sbjct: 67 EVALLPYTS 75


>gi|150010521|ref|YP_001305264.1| 30S ribosomal protein S18 [Parabacteroides distasonis ATCC 8503]
 gi|154491708|ref|ZP_02031334.1| hypothetical protein PARMER_01319 [Parabacteroides merdae ATCC
          43184]
 gi|255016568|ref|ZP_05288694.1| 30S ribosomal protein S18 [Bacteroides sp. 2_1_7]
 gi|256842194|ref|ZP_05547698.1| ribosomal protein S18 [Parabacteroides sp. D13]
 gi|262384879|ref|ZP_06078011.1| 30S ribosomal protein S18 [Bacteroides sp. 2_1_33B]
 gi|298377641|ref|ZP_06987592.1| ribosomal protein S18 [Bacteroides sp. 3_1_19]
 gi|301308939|ref|ZP_07214884.1| ribosomal protein S18 [Bacteroides sp. 20_3]
 gi|205616305|sp|A6LIX8|RS18_PARD8 RecName: Full=30S ribosomal protein S18
 gi|149938945|gb|ABR45642.1| 30S ribosomal protein S18 [Parabacteroides distasonis ATCC 8503]
 gi|154087949|gb|EDN86994.1| hypothetical protein PARMER_01319 [Parabacteroides merdae ATCC
          43184]
 gi|256736078|gb|EEU49408.1| ribosomal protein S18 [Parabacteroides sp. D13]
 gi|262293595|gb|EEY81531.1| 30S ribosomal protein S18 [Bacteroides sp. 2_1_33B]
 gi|298265344|gb|EFI07006.1| ribosomal protein S18 [Bacteroides sp. 3_1_19]
 gi|300832965|gb|EFK63590.1| ribosomal protein S18 [Bacteroides sp. 20_3]
          Length = 89

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 29/57 (50%), Positives = 40/57 (70%)

Query: 26 KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
           G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 29 NGIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVT 85


>gi|220933166|ref|YP_002510074.1| ribosomal protein S18 [Halothermothrix orenii H 168]
 gi|219994476|gb|ACL71079.1| ribosomal protein S18 [Halothermothrix orenii H 168]
          Length = 70

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 44/68 (64%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
          ++ R K C        ++DYK+++ L RFL+ RGKIVP RI+    K QR+L +AIKRAR
Sbjct: 1  MARRNKPCYFCTNKKAKLDYKEVKTLERFLTNRGKIVPRRITGNCAKHQRQLTRAIKRAR 60

Query: 74 YLGLIAYV 81
           + L+ YV
Sbjct: 61 NIALLPYV 68


>gi|182434342|ref|YP_001822061.1| putative 30S ribosomal protein S18 [Streptomyces griseus subsp.
          griseus NBRC 13350]
 gi|205556519|sp|B1VRG0|RS181_STRGG RecName: Full=30S ribosomal protein S18 1
 gi|113208307|dbj|BAF03512.1| putative ribosomal protein S18 [Streptomyces griseus]
 gi|178462858|dbj|BAG17378.1| putative 30S ribosomal protein S18 [Streptomyces griseus subsp.
          griseus NBRC 13350]
          Length = 82

 Score = 88.1 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 40/75 (53%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
                    + +  PL       IDYKD  LL RF+S RGKI   R++ +S ++QR++A
Sbjct: 2  ARQQEPRKPFKSRPNPLDAAEITYIDYKDTDLLRRFVSDRGKIRGRRVTRISARQQRQVA 61

Query: 67 KAIKRARYLGLIAYV 81
           AIK AR + L+ Y 
Sbjct: 62 AAIKNAREMALLPYT 76


>gi|298493170|ref|YP_003723347.1| 30S ribosomal protein S18 ['Nostoc azollae' 0708]
 gi|298235088|gb|ADI66224.1| ribosomal protein S18 ['Nostoc azollae' 0708]
          Length = 71

 Score = 87.7 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 31/66 (46%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR+  P+  K    IDYKD+ LL +F+++RGKI+P RI+ ++ ++QREL  AIKRAR + 
Sbjct: 5  RRRLSPI--KPGEPIDYKDVDLLRKFITERGKILPRRITGLTSQQQRELTLAIKRARIVA 62

Query: 77 LIAYVN 82
          L+ ++N
Sbjct: 63 LLPFIN 68


>gi|13358116|ref|NP_078390.1| ribosomal protein S18 [Ureaplasma parvum serovar 3 str. ATCC
          700970]
 gi|167971294|ref|ZP_02553571.1| ribosomal protein S18 [Ureaplasma parvum serovar 6 str. ATCC
          27818]
 gi|168281884|ref|ZP_02689551.1| ribosomal protein S18 [Ureaplasma parvum serovar 14 str. ATCC
          33697]
 gi|168308033|ref|ZP_02690708.1| ribosomal protein S18 [Ureaplasma parvum serovar 1 str. ATCC
          27813]
 gi|170762263|ref|YP_001752636.1| 30S ribosomal protein S18 [Ureaplasma parvum serovar 3 str. ATCC
          27815]
 gi|11387108|sp|Q9PPT8|RS18_UREPA RecName: Full=30S ribosomal protein S18
 gi|189029695|sp|B1AJJ2|RS18_UREP2 RecName: Full=30S ribosomal protein S18
 gi|11357040|pir||A82875 ribosomal protein S18 UU552 [imported] - Ureaplasma urealyticum
 gi|6899558|gb|AAF30965.1|AE002154_1 ribosomal protein S18 [Ureaplasma parvum serovar 3 str. ATCC
          700970]
 gi|168827840|gb|ACA33102.1| ribosomal protein S18 [Ureaplasma parvum serovar 3 str. ATCC
          27815]
 gi|171902461|gb|EDT48750.1| ribosomal protein S18 [Ureaplasma parvum serovar 1 str. ATCC
          27813]
 gi|182675876|gb|EDT87781.1| ribosomal protein S18 [Ureaplasma parvum serovar 14 str. ATCC
          33697]
 gi|186700896|gb|EDU19178.1| ribosomal protein S18 [Ureaplasma parvum serovar 6 str. ATCC
          27818]
          Length = 79

 Score = 87.7 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 46/70 (65%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          RN   R+K C LS KG   +DYKD+ LL RF++   KI   R++  S + QR +A AIKR
Sbjct: 8  RNRKPRKKVCILSAKGIEHVDYKDVELLQRFINNNNKIASRRVTGASARMQRRIANAIKR 67

Query: 72 ARYLGLIAYV 81
          AR++GL+ YV
Sbjct: 68 ARFVGLLPYV 77


>gi|313679095|ref|YP_004056834.1| SSU ribosomal protein s18p [Oceanithermus profundus DSM 14977]
 gi|313151810|gb|ADR35661.1| SSU ribosomal protein S18P [Oceanithermus profundus DSM 14977]
          Length = 84

 Score = 87.7 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 36/63 (57%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          K C          DYKD ++L RF+S+ GKI+P R + V  K QR LA  IKRAR L +I
Sbjct: 16 KVCQFCTGELEITDYKDAKMLKRFISETGKILPRRRTGVCAKHQRRLATTIKRARILAII 75

Query: 79 AYV 81
           + 
Sbjct: 76 PFT 78


>gi|85057285|ref|YP_456201.1| 30S ribosomal protein S18 [Aster yellows witches'-broom
          phytoplasma AYWB]
 gi|123725354|sp|Q2NKC1|RS18_AYWBP RecName: Full=30S ribosomal protein S18
 gi|84789390|gb|ABC65122.1| SSU ribosomal protein S18P [Aster yellows witches'-broom
          phytoplasma AYWB]
          Length = 79

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 30/72 (41%), Positives = 47/72 (65%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           +     RRK C  +     +ID+KDI LL RF++ RG+I+  R+++ S + QR+LA AI
Sbjct: 6  KKNTFKKRRKVCFFTENKVTKIDFKDIELLQRFITDRGRILSRRVTNTSARWQRQLAIAI 65

Query: 70 KRARYLGLIAYV 81
          KRAR++ LI ++
Sbjct: 66 KRARHMALIPFI 77


>gi|225848304|ref|YP_002728467.1| ribosomal protein S18 [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644141|gb|ACN99191.1| ribosomal protein S18 [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 76

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +     R+K C    +     +YKD+ +L  F+S+RG+I+P RIS    K QR+L+  IK
Sbjct: 5  KPFFQKRKKYCKFCAEKKEP-NYKDVEMLKEFISERGRIIPRRISGTCAKHQRKLSVEIK 63

Query: 71 RARYLGLIAYV 81
          +AR L LI YV
Sbjct: 64 KARQLALIPYV 74


>gi|240047576|ref|YP_002960964.1| 30S ribosomal protein S18 [Mycoplasma conjunctivae HRC/581]
 gi|239985148|emb|CAT05158.1| 30S ribosomal protein S18 [Mycoplasma conjunctivae]
          Length = 87

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYK+  LL + ++  GKI PSR+S    K QR+LA+A+KRAR + L+ 
Sbjct: 13 PCQFCEANLLYIDYKNTELLKKSINVFGKIQPSRVSGSCAKHQRKLAQAVKRARMIALLP 72

Query: 80 YV 81
          ++
Sbjct: 73 FI 74


>gi|302527614|ref|ZP_07279956.1| ribosomal protein S18 [Streptomyces sp. AA4]
 gi|302436509|gb|EFL08325.1| ribosomal protein S18 [Streptomyces sp. AA4]
          Length = 81

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 46/72 (63%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          + + + + RR+       G  R+D+KD+ LL +F+S RGKI   R++ ++ ++Q+++A A
Sbjct: 4  MPKPDRTPRRRPNAFHAAGITRVDWKDVDLLRKFISDRGKIRARRVTGLTPQQQKQVATA 63

Query: 69 IKRARYLGLIAY 80
          IK AR + L+ Y
Sbjct: 64 IKNAREMALLPY 75


>gi|307325551|ref|ZP_07604752.1| ribosomal protein S18 [Streptomyces violaceusniger Tu 4113]
 gi|306888679|gb|EFN19664.1| ribosomal protein S18 [Streptomyces violaceusniger Tu 4113]
          Length = 94

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 30/59 (50%), Positives = 41/59 (69%)

Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          PL   G+  IDYKD  LL +F+S RGKI   R++ VS ++QR+LA+AIK AR + L+ Y
Sbjct: 33 PLDKAGSTYIDYKDTELLRKFISDRGKIRGRRVTRVSAQQQRQLARAIKNAREMALLPY 91


>gi|21221852|ref|NP_627631.1| 30S ribosomal protein S18 [Streptomyces coelicolor A3(2)]
 gi|256786968|ref|ZP_05525399.1| 30S ribosomal protein S18 [Streptomyces lividans TK24]
 gi|7388047|sp|Q9X8K4|RS182_STRCO RecName: Full=30S ribosomal protein S18 2
 gi|4808364|emb|CAB42778.1| putative 30S ribosomal protein S18 [Streptomyces coelicolor
          A3(2)]
          Length = 79

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 45/76 (59%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
           P P        R++  PL   G   +DYKD  LL +F+S RGKI   R++ V+ ++QR+
Sbjct: 1  MPRPRKADRTPARQRPNPLDRDGVTYVDYKDTELLRKFVSDRGKIRSRRVTRVTSQQQRQ 60

Query: 65 LAKAIKRARYLGLIAY 80
          LA+AIK AR + L+ Y
Sbjct: 61 LARAIKNAREMALLPY 76


>gi|256370726|ref|YP_003108551.1| 30S ribosomal protein S18 [Candidatus Sulcia muelleri SMDSEM]
 gi|256009518|gb|ACU52878.1| ribosomal protein S18 [Candidatus Sulcia muelleri SMDSEM]
          Length = 165

 Score = 87.3 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 41/70 (58%)

Query: 13  NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
                +K C         IDYK+ + L +FL++RG+I+P RI+  S K Q+ L KAIKR 
Sbjct: 92  KTKPEKKYCFFLKNKIKYIDYKNPKFLIKFLNERGEILPRRITGTSKKFQKRLTKAIKRC 151

Query: 73  RYLGLIAYVN 82
           + +GL+ Y+ 
Sbjct: 152 KQIGLLPYIT 161


>gi|220906338|ref|YP_002481649.1| 30S ribosomal protein S18 [Cyanothece sp. PCC 7425]
 gi|219862949|gb|ACL43288.1| ribosomal protein S18 [Cyanothece sp. PCC 7425]
          Length = 71

 Score = 87.3 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 50/68 (73%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
           +RR+  P+  +    IDYKD+ LL RF+++RGKI+P RI+ ++ K+QR+L +++KRAR 
Sbjct: 3  FYRRRVSPIKPE--EAIDYKDVDLLRRFITERGKILPRRITGLTAKQQRQLTQSVKRARI 60

Query: 75 LGLIAYVN 82
          L L+ ++N
Sbjct: 61 LALLPFIN 68


>gi|167973255|ref|ZP_02555532.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 5 str. ATCC
          27817]
 gi|167974085|ref|ZP_02556362.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 11 str.
          ATCC 33695]
 gi|167975519|ref|ZP_02557796.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 12 str.
          ATCC 33696]
 gi|167988271|ref|ZP_02569942.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 7 str. ATCC
          27819]
 gi|168362598|ref|ZP_02695777.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 13 str.
          ATCC 33698]
 gi|195867992|ref|ZP_03079988.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 9 str. ATCC
          33175]
 gi|198273409|ref|ZP_03205945.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 4 str. ATCC
          27816]
 gi|209554606|ref|YP_002284999.1| 30S ribosomal protein S18 [Ureaplasma urealyticum serovar 10 str.
          ATCC 33699]
 gi|225550837|ref|ZP_03771786.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 2 str. ATCC
          27814]
 gi|225551101|ref|ZP_03772047.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 8 str. ATCC
          27618]
 gi|229560079|sp|B5ZC59|RS18_UREU1 RecName: Full=30S ribosomal protein S18
 gi|171903293|gb|EDT49582.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 13 str.
          ATCC 33698]
 gi|184209001|gb|EDU06044.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 5 str. ATCC
          27817]
 gi|188019112|gb|EDU57152.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 7 str. ATCC
          27819]
 gi|188998109|gb|EDU67206.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 11 str.
          ATCC 33695]
 gi|195659849|gb|EDX53229.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 12 str.
          ATCC 33696]
 gi|195660326|gb|EDX53587.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 9 str. ATCC
          33175]
 gi|198249929|gb|EDY74709.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 4 str. ATCC
          27816]
 gi|209542107|gb|ACI60336.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 10 str.
          ATCC 33699]
 gi|225378916|gb|EEH01281.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 8 str. ATCC
          27618]
 gi|225379991|gb|EEH02353.1| ribosomal protein S18 [Ureaplasma urealyticum serovar 2 str. ATCC
          27814]
          Length = 79

 Score = 87.3 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 46/70 (65%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          RN   R+K C LS KG   +DYKD+ LL RF++   KI   R++  S + QR +A AIKR
Sbjct: 8  RNRKPRKKVCILSAKGIEHVDYKDVELLQRFINNNNKIASRRVTGASARMQRRIANAIKR 67

Query: 72 ARYLGLIAYV 81
          AR++GL+ YV
Sbjct: 68 ARFVGLLPYV 77


>gi|145597063|ref|YP_001161360.1| 30S ribosomal protein S18 [Salinispora tropica CNB-440]
 gi|205617371|sp|A4XDG6|RS18_SALTO RecName: Full=30S ribosomal protein S18
 gi|145306400|gb|ABP56982.1| SSU ribosomal protein S18P [Salinispora tropica CNB-440]
          Length = 93

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 48/79 (60%), Gaps = 3/79 (3%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
           +A    LR+    ++K  PL   G   IDYKD  LL +F+S RGKI   R++ V+ ++Q
Sbjct: 14 SMAKAAALRKP---KKKVNPLDKDGITYIDYKDTALLRKFISDRGKIRARRVTGVTSQQQ 70

Query: 63 RELAKAIKRARYLGLIAYV 81
          R++A+A+K AR + L+ Y 
Sbjct: 71 RQIARAVKNAREMALLPYT 89


>gi|56750435|ref|YP_171136.1| 30S ribosomal protein S18 [Synechococcus elongatus PCC 6301]
 gi|81299932|ref|YP_400140.1| 30S ribosomal protein S18 [Synechococcus elongatus PCC 7942]
 gi|81676949|sp|Q5N503|RS18_SYNP6 RecName: Full=30S ribosomal protein S18
 gi|123769262|sp|Q31P66|RS18_SYNE7 RecName: Full=30S ribosomal protein S18
 gi|56685394|dbj|BAD78616.1| 30S ribosomal protein S18 [Synechococcus elongatus PCC 6301]
 gi|81168813|gb|ABB57153.1| SSU ribosomal protein S18P [Synechococcus elongatus PCC 7942]
          Length = 71

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 50/68 (73%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RR+  P+  K +  IDYKD+ LL +F+++RGKI+P RI+ ++ ++QR+LA AIKRAR 
Sbjct: 3  YFRRRLSPI--KPSDPIDYKDVDLLRKFITERGKILPRRITGLTARQQRDLAVAIKRARI 60

Query: 75 LGLIAYVN 82
          L L+ ++N
Sbjct: 61 LALLPFLN 68


>gi|332830347|gb|EGK02975.1| 30S ribosomal protein S18 [Dysgonomonas gadei ATCC BAA-286]
 gi|332883573|gb|EGK03856.1| 30S ribosomal protein S18 [Dysgonomonas mossii DSM 22836]
          Length = 88

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 29/57 (50%), Positives = 40/57 (70%)

Query: 26 KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
           G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 28 NGIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVT 84


>gi|77163756|ref|YP_342281.1| ribosomal protein S18 [Nitrosococcus oceani ATCC 19707]
 gi|254435623|ref|ZP_05049130.1| ribosomal protein S18 [Nitrosococcus oceani AFC27]
 gi|300115387|ref|YP_003761962.1| 30S ribosomal protein S18 [Nitrosococcus watsonii C-113]
 gi|123595160|sp|Q3JEJ5|RS18_NITOC RecName: Full=30S ribosomal protein S18
 gi|76882070|gb|ABA56751.1| SSU ribosomal protein S18P [Nitrosococcus oceani ATCC 19707]
 gi|207088734|gb|EDZ66006.1| ribosomal protein S18 [Nitrosococcus oceani AFC27]
 gi|299541324|gb|ADJ29641.1| ribosomal protein S18 [Nitrosococcus watsonii C-113]
          Length = 74

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 42/59 (71%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +G   IDYKD+  L  ++++ GKIVPSRI+    K QR+L++A+KRARYL L+ Y +
Sbjct: 14 TAEGVKEIDYKDLATLKDYITETGKIVPSRITGTKAKYQRQLSRAVKRARYLALLPYCD 72


>gi|146305681|ref|YP_001186146.1| 30S ribosomal protein S18 [Pseudomonas mendocina ymp]
 gi|330501635|ref|YP_004378504.1| 30S ribosomal protein S18 [Pseudomonas mendocina NK-01]
 gi|166220976|sp|A4XPZ8|RS18_PSEMY RecName: Full=30S ribosomal protein S18
 gi|145573882|gb|ABP83414.1| SSU ribosomal protein S18P [Pseudomonas mendocina ymp]
 gi|328915921|gb|AEB56752.1| 30S ribosomal protein S18 [Pseudomonas mendocina NK-01]
          Length = 76

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 40/59 (67%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +    ID+KD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRAR+L L+ Y +
Sbjct: 14 TAEDVKEIDFKDLNTLKAYISETGKIVPSRITGTKARYQRQLATAIKRARFLALLPYTD 72


>gi|158337925|ref|YP_001519101.1| 30S ribosomal protein S18 [Acaryochloris marina MBIC11017]
 gi|189029665|sp|B0C2J3|RS18_ACAM1 RecName: Full=30S ribosomal protein S18
 gi|158308166|gb|ABW29783.1| 30S ribosomal protein S18 [Acaryochloris marina MBIC11017]
          Length = 71

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 31/66 (46%), Positives = 49/66 (74%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR+  P+  K    IDYKD+ LL RF+++RGKI+P RI+ ++ ++QR+L +AIK+AR L 
Sbjct: 5  RRRVSPI--KPGDPIDYKDVDLLRRFITERGKILPRRITGLTARQQRDLTRAIKQARVLA 62

Query: 77 LIAYVN 82
          L+ ++N
Sbjct: 63 LLPFIN 68


>gi|195941851|ref|ZP_03087233.1| 30S ribosomal protein S18 [Borrelia burgdorferi 80a]
 gi|223889129|ref|ZP_03623718.1| ribosomal protein S18 [Borrelia burgdorferi 64b]
 gi|223885378|gb|EEF56479.1| ribosomal protein S18 [Borrelia burgdorferi 64b]
          Length = 96

 Score = 87.3 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             +RKSC     G    DYKD   L +F++++GKI+P RI+  S K QR LA  IKRAR
Sbjct: 28 RFFKRKSCRFCDSGKHP-DYKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRAR 86

Query: 74 YLGLIAYV 81
          Y+ L+ +V
Sbjct: 87 YMALLPFV 94


>gi|15805141|ref|NP_293827.1| 30S ribosomal protein S18 [Deinococcus radiodurans R1]
 gi|11387111|sp|Q9RY50|RS18_DEIRA RecName: Full=30S ribosomal protein S18
 gi|6457767|gb|AAF09693.1|AE001873_3 ribosomal protein S18 [Deinococcus radiodurans R1]
          Length = 92

 Score = 87.3 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 39/69 (56%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              + K  P S       DYKD+++L RF+S  GKI+P R + +S K QR +A+ IK A
Sbjct: 18 KRPRKPKVDPFSIGELEITDYKDVKMLRRFVSDTGKILPRRRTGLSAKHQRRIAQTIKVA 77

Query: 73 RYLGLIAYV 81
          R L L+ Y 
Sbjct: 78 RQLALLPYT 86


>gi|332712187|ref|ZP_08432115.1| SSU ribosomal protein S18P [Lyngbya majuscula 3L]
 gi|332348993|gb|EGJ28605.1| SSU ribosomal protein S18P [Lyngbya majuscula 3L]
          Length = 71

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 49/68 (72%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            R++  P+       IDYKD+ LL +F+++RGKI+P RI++++ ++QR+L  AIKRAR+
Sbjct: 3  YFRKRLSPIKPD--EPIDYKDVELLRKFITERGKILPRRITNLTTQQQRKLTTAIKRARF 60

Query: 75 LGLIAYVN 82
          L L+ Y+N
Sbjct: 61 LALLPYIN 68


>gi|295835236|ref|ZP_06822169.1| ribosomal protein S18 [Streptomyces sp. SPB74]
 gi|197698172|gb|EDY45105.1| ribosomal protein S18 [Streptomyces sp. SPB74]
          Length = 79

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 44/76 (57%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
           P    RR  +   +  PL   G   IDYKD  LL +FLS RGKI   R++ VS ++QR+
Sbjct: 1  MPRTSDRRRDTRAPRPNPLDAAGITYIDYKDTDLLRKFLSDRGKIRSRRVTRVSAQQQRQ 60

Query: 65 LAKAIKRARYLGLIAY 80
          LA AIK AR + L+ Y
Sbjct: 61 LATAIKNAREMALLPY 76


>gi|26991556|ref|NP_746981.1| 30S ribosomal protein S18 [Pseudomonas putida KT2440]
 gi|104783859|ref|YP_610357.1| 30S ribosomal protein S18 [Pseudomonas entomophila L48]
 gi|148549959|ref|YP_001270061.1| 30S ribosomal protein S18 [Pseudomonas putida F1]
 gi|167035922|ref|YP_001671153.1| 30S ribosomal protein S18 [Pseudomonas putida GB-1]
 gi|170723828|ref|YP_001751516.1| 30S ribosomal protein S18 [Pseudomonas putida W619]
 gi|325271216|ref|ZP_08137761.1| 30S ribosomal protein S18 [Pseudomonas sp. TJI-51]
 gi|38258490|sp|Q88DE9|RS18_PSEPK RecName: Full=30S ribosomal protein S18
 gi|122985731|sp|Q1I462|RS18_PSEE4 RecName: Full=30S ribosomal protein S18
 gi|166220977|sp|A5W9R7|RS18_PSEP1 RecName: Full=30S ribosomal protein S18
 gi|189029684|sp|B0KKY2|RS18_PSEPG RecName: Full=30S ribosomal protein S18
 gi|229560054|sp|B1JAH0|RS18_PSEPW RecName: Full=30S ribosomal protein S18
 gi|24986641|gb|AAN70445.1|AE016685_10 ribosomal protein S18 [Pseudomonas putida KT2440]
 gi|95112846|emb|CAK17574.1| 30S ribosomal protein S18 [Pseudomonas entomophila L48]
 gi|148514017|gb|ABQ80877.1| SSU ribosomal protein S18P [Pseudomonas putida F1]
 gi|166862410|gb|ABZ00818.1| ribosomal protein S18 [Pseudomonas putida GB-1]
 gi|169761831|gb|ACA75147.1| ribosomal protein S18 [Pseudomonas putida W619]
 gi|313500860|gb|ADR62226.1| RpsR [Pseudomonas putida BIRD-1]
 gi|324103619|gb|EGC00921.1| 30S ribosomal protein S18 [Pseudomonas sp. TJI-51]
          Length = 76

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 27/59 (45%), Positives = 40/59 (67%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +    ID+KD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRAR+L L+ Y +
Sbjct: 14 TAEDVKEIDFKDLNTLKAYVSETGKIVPSRITGTKARYQRQLATAIKRARFLALLPYTD 72


>gi|256425943|ref|YP_003126596.1| ribosomal protein S18 [Chitinophaga pinensis DSM 2588]
 gi|256040851|gb|ACU64395.1| ribosomal protein S18 [Chitinophaga pinensis DSM 2588]
          Length = 88

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 43/71 (60%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          +     +K C     G   +DYKD   L +FL+ +GK++P RIS  S K QR++A+AIK+
Sbjct: 14 KTEKRAKKYCRFKKLGIRYVDYKDAEFLKKFLNDQGKMLPRRISGNSLKFQRKVAQAIKK 73

Query: 72 ARYLGLIAYVN 82
          AR + L+ YV 
Sbjct: 74 ARQMALLPYVT 84


>gi|71891875|ref|YP_277604.1| 30S ribosomal protein S18 [Candidatus Blochmannia pennsylvanicus
          str. BPEN]
 gi|123761484|sp|Q493V4|RS18_BLOPB RecName: Full=30S ribosomal protein S18
 gi|71795981|gb|AAZ40732.1| 30S ribosomal subunit protein S18 [Candidatus Blochmannia
          pennsylvanicus str. BPEN]
          Length = 79

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 29/70 (41%), Positives = 42/70 (60%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
               RK C  + +    IDYKD+  +   + + GKI+PSRI+    + QR+LA+AIKRA
Sbjct: 7  RFVRHRKFCRFTAEKCINIDYKDLVTIQHSIIESGKIIPSRITGTRARYQRQLARAIKRA 66

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 67 RYLSLLPYTD 76


>gi|302330353|gb|ADL20547.1| 30S ribosomal protein S18 [Corynebacterium pseudotuberculosis
          1002]
          Length = 72

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 43/68 (63%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          S R K  PL   G  ++DYKDI  L +F+S R KI   R++ ++ ++QR++A A+K AR 
Sbjct: 4  SRRPKKNPLKAAGIEKVDYKDINTLRQFISDRHKIRSRRVTGLTPQQQRQVATAVKNARE 63

Query: 75 LGLIAYVN 82
          + L+ + +
Sbjct: 64 MALLPFTS 71


>gi|33863012|ref|NP_894572.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9313]
 gi|124023182|ref|YP_001017489.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9303]
 gi|59798838|sp|Q7TUZ8|RS18_PROMM RecName: Full=30S ribosomal protein S18
 gi|166220972|sp|A2C9R4|RS18_PROM3 RecName: Full=30S ribosomal protein S18
 gi|33634929|emb|CAE20915.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9313]
 gi|123963468|gb|ABM78224.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9303]
          Length = 73

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 47/68 (69%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            +++  P+  K    IDYKD+ LL +F++ RGKI+P R++ ++ K+QR+L  A+KRAR 
Sbjct: 5  FFKKRLSPI--KPGDPIDYKDVDLLKKFITDRGKILPRRLTGLTSKQQRDLTNAVKRARI 62

Query: 75 LGLIAYVN 82
          + L+ +VN
Sbjct: 63 IALLPFVN 70


>gi|304383092|ref|ZP_07365567.1| 30S ribosomal protein S18 [Prevotella marshii DSM 16973]
 gi|304335778|gb|EFM02033.1| 30S ribosomal protein S18 [Prevotella marshii DSM 16973]
          Length = 88

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+AIKRAR + L+ YV 
Sbjct: 29 GIKYIDYKDPDFLKKFLNEQGKILPRRITGTSLKYQRRVAQAIKRARQIALLPYVT 84


>gi|94984272|ref|YP_603636.1| 30S ribosomal protein S18 [Deinococcus geothermalis DSM 11300]
 gi|122986733|sp|Q1J217|RS18_DEIGD RecName: Full=30S ribosomal protein S18
 gi|94554553|gb|ABF44467.1| ribosomal protein S18 [Deinococcus geothermalis DSM 11300]
          Length = 91

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 2  AEVAPTPLLRRNVSHRR-KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          +     P  +     R+ K  P S       DYKD+++L RF+S  GKI+P R + +S K
Sbjct: 5  SNTERKPRAKGPKRPRKPKVDPFSIGELEITDYKDVKMLRRFISDTGKILPRRRTGLSAK 64

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QR +++ IK AR L L+ Y 
Sbjct: 65 HQRRISQTIKIARQLALLPYT 85


>gi|312958664|ref|ZP_07773184.1| 30S ribosomal protein S18 [Pseudomonas fluorescens WH6]
 gi|311287207|gb|EFQ65768.1| 30S ribosomal protein S18 [Pseudomonas fluorescens WH6]
          Length = 76

 Score = 87.0 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +    IDYKD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRAR+L L+AY +
Sbjct: 14 TAEEVKEIDYKDLNTLKAYVSETGKIVPSRITGTKARYQRQLATAIKRARFLALLAYTD 72


>gi|330995927|ref|ZP_08319822.1| ribosomal protein S18 [Paraprevotella xylaniphila YIT 11841]
 gi|332877546|ref|ZP_08445293.1| ribosomal protein S18 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
 gi|329574266|gb|EGG55841.1| ribosomal protein S18 [Paraprevotella xylaniphila YIT 11841]
 gi|332684652|gb|EGJ57502.1| ribosomal protein S18 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
          Length = 88

 Score = 87.0 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ +V 
Sbjct: 29 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARHLALLPFVT 84


>gi|297154862|gb|ADI04574.1| 30S ribosomal protein S18 [Streptomyces bingchenggensis BCW-1]
          Length = 80

 Score = 87.0 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 45/77 (58%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +       R  S R +  PL   G   +DYK+  LL +F+S RGKI   R++ V+ ++QR
Sbjct: 1  MPRRSTTDRRTSKRPRVNPLDAAGITYVDYKNTDLLRKFISDRGKIRSRRVTHVTRQQQR 60

Query: 64 ELAKAIKRARYLGLIAY 80
          ++++AIK AR + L+ Y
Sbjct: 61 QISRAIKNAREMALLPY 77


>gi|291297665|ref|YP_003508943.1| 30S ribosomal protein S18 [Stackebrandtia nassauensis DSM 44728]
 gi|290566885|gb|ADD39850.1| ribosomal protein S18 [Stackebrandtia nassauensis DSM 44728]
          Length = 79

 Score = 87.0 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A    +R+    ++KS PL  +G   ID+KD  LL +F+S RGKI   R++ V+ ++QR
Sbjct: 1  MAKAAPVRKP---KKKSNPLDKEGITYIDFKDTALLRKFISDRGKIRARRVTGVTAQQQR 57

Query: 64 ELAKAIKRARYLGLIAYVN 82
          ++A+A+K AR + L+ Y +
Sbjct: 58 QIARAVKNAREMALLPYTS 76


>gi|34540404|ref|NP_904883.1| 30S ribosomal protein S18 [Porphyromonas gingivalis W83]
 gi|188994504|ref|YP_001928756.1| 30S ribosomal protein S18 [Porphyromonas gingivalis ATCC 33277]
 gi|59798820|sp|Q7MWL2|RS18_PORGI RecName: Full=30S ribosomal protein S18
 gi|229560051|sp|B2RIG4|RS18_PORG3 RecName: Full=30S ribosomal protein S18
 gi|34396717|gb|AAQ65782.1| ribosomal protein S18 [Porphyromonas gingivalis W83]
 gi|188594184|dbj|BAG33159.1| 30S ribosomal protein S18 [Porphyromonas gingivalis ATCC 33277]
          Length = 90

 Score = 87.0 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 31 GIRYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVT 86


>gi|145652240|gb|ABP88170.1| hypothetical protein [Borrelia lonestari]
          Length = 124

 Score = 87.0 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 4/78 (5%)

Query: 4   VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
           +   P  R     ++K+C          DYKD   L +F++ +GKI+P RI+  S K QR
Sbjct: 49  LKKNPNFR---FFKKKTCKFC-DIDKVPDYKDFDFLKKFITDQGKILPRRITGTSAKHQR 104

Query: 64  ELAKAIKRARYLGLIAYV 81
            LA  IK+ARY+ L+ +V
Sbjct: 105 CLALEIKKARYMALLPFV 122


>gi|189463978|ref|ZP_03012763.1| hypothetical protein BACINT_00313 [Bacteroides intestinalis DSM
          17393]
 gi|224536025|ref|ZP_03676564.1| hypothetical protein BACCELL_00889 [Bacteroides cellulosilyticus
          DSM 14838]
 gi|189438551|gb|EDV07536.1| hypothetical protein BACINT_00313 [Bacteroides intestinalis DSM
          17393]
 gi|224522350|gb|EEF91455.1| hypothetical protein BACCELL_00889 [Bacteroides cellulosilyticus
          DSM 14838]
          Length = 89

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVT 85


>gi|160890914|ref|ZP_02071917.1| hypothetical protein BACUNI_03359 [Bacteroides uniformis ATCC
          8492]
 gi|167764865|ref|ZP_02436986.1| hypothetical protein BACSTE_03257 [Bacteroides stercoris ATCC
          43183]
 gi|218128603|ref|ZP_03457407.1| hypothetical protein BACEGG_00173 [Bacteroides eggerthii DSM
          20697]
 gi|270295895|ref|ZP_06202095.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|317475593|ref|ZP_07934855.1| ribosomal protein S18 [Bacteroides eggerthii 1_2_48FAA]
 gi|317479666|ref|ZP_07938790.1| ribosomal protein S18 [Bacteroides sp. 4_1_36]
 gi|319899907|ref|YP_004159635.1| SSU ribosomal protein S18P [Bacteroides helcogenes P 36-108]
 gi|329957654|ref|ZP_08298129.1| ribosomal protein S18 [Bacteroides clarus YIT 12056]
 gi|329960227|ref|ZP_08298669.1| ribosomal protein S18 [Bacteroides fluxus YIT 12057]
 gi|156859913|gb|EDO53344.1| hypothetical protein BACUNI_03359 [Bacteroides uniformis ATCC
          8492]
 gi|167697534|gb|EDS14113.1| hypothetical protein BACSTE_03257 [Bacteroides stercoris ATCC
          43183]
 gi|217989205|gb|EEC55519.1| hypothetical protein BACEGG_00173 [Bacteroides eggerthii DSM
          20697]
 gi|270273299|gb|EFA19161.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|316904167|gb|EFV25997.1| ribosomal protein S18 [Bacteroides sp. 4_1_36]
 gi|316908297|gb|EFV29989.1| ribosomal protein S18 [Bacteroides eggerthii 1_2_48FAA]
 gi|319414938|gb|ADV42049.1| SSU ribosomal protein S18P [Bacteroides helcogenes P 36-108]
 gi|328522531|gb|EGF49640.1| ribosomal protein S18 [Bacteroides clarus YIT 12056]
 gi|328532900|gb|EGF59677.1| ribosomal protein S18 [Bacteroides fluxus YIT 12057]
          Length = 90

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVT 86


>gi|153808732|ref|ZP_01961400.1| hypothetical protein BACCAC_03031 [Bacteroides caccae ATCC 43185]
 gi|255691414|ref|ZP_05415089.1| ribosomal protein S18 [Bacteroides finegoldii DSM 17565]
 gi|293368836|ref|ZP_06615440.1| ribosomal protein S18 [Bacteroides ovatus SD CMC 3f]
 gi|298483612|ref|ZP_07001787.1| ribosomal protein S18 [Bacteroides sp. D22]
 gi|149128558|gb|EDM19776.1| hypothetical protein BACCAC_03031 [Bacteroides caccae ATCC 43185]
 gi|260623060|gb|EEX45931.1| ribosomal protein S18 [Bacteroides finegoldii DSM 17565]
 gi|292636141|gb|EFF54629.1| ribosomal protein S18 [Bacteroides ovatus SD CMC 3f]
 gi|298270182|gb|EFI11768.1| ribosomal protein S18 [Bacteroides sp. D22]
          Length = 90

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPYVT 86


>gi|328949624|ref|YP_004366959.1| 30S ribosomal protein S18 [Marinithermus hydrothermalis DSM
          14884]
 gi|328449948|gb|AEB10849.1| 30S ribosomal protein S18 [Marinithermus hydrothermalis DSM
          14884]
          Length = 84

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 40/78 (51%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          ++     R     + K C          DY++  +L RFLS+ GKI+P R + V  K QR
Sbjct: 1  MSTKRASRPRRFRKPKVCQFCTGELEITDYRNREMLMRFLSETGKILPRRRTGVCAKHQR 60

Query: 64 ELAKAIKRARYLGLIAYV 81
           LA+ IKRAR L ++ + 
Sbjct: 61 RLAQMIKRARILAIVPFT 78


>gi|327399727|ref|YP_004340596.1| 30S ribosomal protein S18 [Hippea maritima DSM 10411]
 gi|327182356|gb|AEA34537.1| 30S ribosomal protein S18 [Hippea maritima DSM 10411]
          Length = 86

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 41/75 (54%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
              R     ++K C         IDYKDI LL+R++++R KIV  + ++   + QR L 
Sbjct: 5  KRKKRFFRYPKKKVCHFCTNKIEEIDYKDIDLLSRYVTERYKIVGRKTTATCARHQRMLT 64

Query: 67 KAIKRARYLGLIAYV 81
          KAIKRAR + L+ + 
Sbjct: 65 KAIKRARVMALMPFT 79


>gi|228469704|ref|ZP_04054672.1| ribosomal protein S18 [Porphyromonas uenonis 60-3]
 gi|228308723|gb|EEK17449.1| ribosomal protein S18 [Porphyromonas uenonis 60-3]
          Length = 88

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          +K C         +DYKD   L +FL+ +GKI+P RI+  S K QR +A+A+KRAR+L L
Sbjct: 20 KKYCRFKKARIKFVDYKDPEFLKKFLNDQGKILPRRITGNSLKFQRRVAQAVKRARHLAL 79

Query: 78 IAYVN 82
          + +V 
Sbjct: 80 LPFVT 84


>gi|238809826|dbj|BAH69616.1| hypothetical protein [Mycoplasma fermentans PG18]
          Length = 97

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 42/70 (60%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++  + RR+ C    +    +DYKD+  L++F++  G+I P   +    K QR++A AIK
Sbjct: 19 KKKNNFRRRRCETCDQKLTYVDYKDVEFLSKFITATGQIKPHSATGACAKDQRKIANAIK 78

Query: 71 RARYLGLIAY 80
          RAR++ LI Y
Sbjct: 79 RARFMALIPY 88


>gi|213966078|ref|ZP_03394266.1| ribosomal protein S18 [Corynebacterium amycolatum SK46]
 gi|213951276|gb|EEB62670.1| ribosomal protein S18 [Corynebacterium amycolatum SK46]
          Length = 83

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 46/72 (63%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          R   S R K  PL   G  ++DYKDI LL +F+S RGKI   R++ ++ ++QR++A A+K
Sbjct: 11 RMEQSRRPKKNPLKAAGVEKVDYKDINLLRQFISDRGKIRSRRVTGLTPQQQRQVATAVK 70

Query: 71 RARYLGLIAYVN 82
           AR + L+ + +
Sbjct: 71 NAREMALLPFTS 82


>gi|260888679|ref|ZP_05899942.1| ribosomal protein S18 [Selenomonas sputigena ATCC 35185]
 gi|260861611|gb|EEX76111.1| ribosomal protein S18 [Selenomonas sputigena ATCC 35185]
          Length = 59

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 36/56 (64%)

Query: 26 KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
               IDYKD+  L RF+++RGKI+P RIS    K QR++  AIKRAR + L+ + 
Sbjct: 2  DKVDVIDYKDVAKLRRFITERGKILPRRISGNCAKHQRQVTLAIKRARNIALLPFT 57


>gi|224534892|ref|ZP_03675461.1| ribosomal protein S18 [Borrelia spielmanii A14S]
 gi|224513832|gb|EEF84157.1| ribosomal protein S18 [Borrelia spielmanii A14S]
          Length = 96

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 4/78 (5%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
              P  R     +RKSC     G    DYKD   L +F++++GKI+P RI+  S K QR
Sbjct: 21 FKKNPNFR---FFKRKSCKFCDSGKHP-DYKDFDFLKKFITEQGKILPKRITGTSAKHQR 76

Query: 64 ELAKAIKRARYLGLIAYV 81
           LA  IKRARY+ L+ +V
Sbjct: 77 RLALEIKRARYMALLPFV 94


>gi|118602663|ref|YP_903878.1| 30S ribosomal protein S18 [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
 gi|205617138|sp|A1AWV0|RS18_RUTMC RecName: Full=30S ribosomal protein S18
 gi|118567602|gb|ABL02407.1| SSU ribosomal protein S18P [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
          Length = 84

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 43/75 (57%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
             RR        C  +  G  RIDYKD+  L + +++ GKI PSR++  S K QR+L  
Sbjct: 6  KRKRRPQIKINTFCRFTAAGITRIDYKDVDTLLKNINESGKITPSRMTGTSAKFQRQLTT 65

Query: 68 AIKRARYLGLIAYVN 82
          AIKRAR+L LI Y +
Sbjct: 66 AIKRARFLALIPYTD 80


>gi|15829080|ref|NP_326440.1| 30S ribosomal protein S18 [Mycoplasma pulmonis UAB CTIP]
 gi|20978725|sp|Q98PW0|RS18_MYCPU RecName: Full=30S ribosomal protein S18
 gi|14090024|emb|CAC13782.1| 30S RIBOSOMAL PROTEIN S18 [Mycoplasma pulmonis]
          Length = 105

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 43/62 (69%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
             L  +G   IDYKD+ LL++F++  GKI+PS+I+ VS K+QR L +AIKRAR + L+ 
Sbjct: 17 VSFLDEQGINYIDYKDVELLSKFINSHGKILPSKITDVSAKRQRMLTRAIKRARNMALLP 76

Query: 80 YV 81
          + 
Sbjct: 77 FT 78


>gi|323345547|ref|ZP_08085770.1| 30S ribosomal protein S18 [Prevotella oralis ATCC 33269]
 gi|323093661|gb|EFZ36239.1| 30S ribosomal protein S18 [Prevotella oralis ATCC 33269]
          Length = 90

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 86


>gi|226365087|ref|YP_002782870.1| 30S ribosomal protein S18 [Rhodococcus opacus B4]
 gi|226243577|dbj|BAH53925.1| 30S ribosomal protein S18 [Rhodococcus opacus B4]
          Length = 84

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (57%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          + AP+   R     + K  PL       +DYKDI LL  F+S RGKI   R++ ++ ++Q
Sbjct: 4  KRAPSKKPRPVEGRKPKKNPLFAAKIEYVDYKDINLLRTFISDRGKIRSRRVTGLTPQQQ 63

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R++A A+K AR + L+ + +
Sbjct: 64 RQVAVAVKNAREMALLPFTS 83


>gi|119509768|ref|ZP_01628913.1| 30S ribosomal protein S18 [Nodularia spumigena CCY9414]
 gi|119465634|gb|EAW46526.1| 30S ribosomal protein S18 [Nodularia spumigena CCY9414]
          Length = 71

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/66 (46%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR+  P+  K    IDYKD+ LL +++++RGKI+P RI+ ++ K+QR+L  AIKRAR + 
Sbjct: 5  RRRLSPI--KPGDPIDYKDVDLLRKYITERGKILPRRITGLTCKQQRDLTLAIKRARIVA 62

Query: 77 LIAYVN 82
          L+ +VN
Sbjct: 63 LLPFVN 68


>gi|297158762|gb|ADI08474.1| 30S ribosomal protein S18 [Streptomyces bingchenggensis BCW-1]
          Length = 64

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 35/60 (58%)

Query: 23 LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
             +    +DYKD  LL +F+S RGKI   R++    + QR++A A+K +R + L+ Y +
Sbjct: 2  FCKEKISYVDYKDTNLLRKFISDRGKIRARRVTGNCTQHQRDVATAVKNSREMALLPYTS 61


>gi|134103769|ref|YP_001109430.1| 30S ribosomal protein S18 [Saccharopolyspora erythraea NRRL 2338]
 gi|291007704|ref|ZP_06565677.1| 30S ribosomal protein S18 [Saccharopolyspora erythraea NRRL 2338]
 gi|205556690|sp|A4FR30|RS182_SACEN RecName: Full=30S ribosomal protein S18 2
 gi|133916392|emb|CAM06505.1| 30S ribosomal subunit protein S18 [Saccharopolyspora erythraea
          NRRL 2338]
          Length = 79

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 45/80 (56%), Gaps = 5/80 (6%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPR-IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          +A  P+ +     ++K C      A + IDYKD  LL +++S RGKI   R++    + Q
Sbjct: 1  MAKAPVRK----PKKKVCVFCKDKAAQSIDYKDTTLLRKYISDRGKIRARRVTGNCSQHQ 56

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R++A A+K AR + L+ Y +
Sbjct: 57 RDVAIAVKNAREMALLPYTS 76


>gi|17231943|ref|NP_488491.1| 30S ribosomal protein S18 [Nostoc sp. PCC 7120]
 gi|75907544|ref|YP_321840.1| 30S ribosomal protein S18 [Anabaena variabilis ATCC 29413]
 gi|20978694|sp|Q8YNW0|RS18_ANASP RecName: Full=30S ribosomal protein S18
 gi|123731561|sp|Q3MDJ1|RS18_ANAVT RecName: Full=30S ribosomal protein S18
 gi|17133587|dbj|BAB76150.1| 30S ribosomal protein S18 [Nostoc sp. PCC 7120]
 gi|75701269|gb|ABA20945.1| SSU ribosomal protein S18P [Anabaena variabilis ATCC 29413]
          Length = 71

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/66 (46%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR+  P+  K    IDYKD+ LL +F+++RGKI+P RI+ ++ K+QREL  AIKR+R + 
Sbjct: 5  RRRLSPI--KPGEPIDYKDVDLLRKFITERGKILPRRITGLTAKQQRELTLAIKRSRLVA 62

Query: 77 LIAYVN 82
          L+ ++N
Sbjct: 63 LLPFIN 68


>gi|53715145|ref|YP_101137.1| 30S ribosomal protein S18 [Bacteroides fragilis YCH46]
 gi|60683081|ref|YP_213225.1| 30S ribosomal protein S18 [Bacteroides fragilis NCTC 9343]
 gi|253566275|ref|ZP_04843729.1| 30S ribosomal protein S18 [Bacteroides sp. 3_2_5]
 gi|265766975|ref|ZP_06094804.1| ribosomal protein S18 [Bacteroides sp. 2_1_16]
 gi|59798649|sp|Q64PH8|RS18_BACFR RecName: Full=30S ribosomal protein S18
 gi|81313865|sp|Q5L9B6|RS18_BACFN RecName: Full=30S ribosomal protein S18
 gi|52218010|dbj|BAD50603.1| 30S ribosomal protein S18 [Bacteroides fragilis YCH46]
 gi|60494515|emb|CAH09312.1| putative 30S ribosomal protein S18 [Bacteroides fragilis NCTC
          9343]
 gi|251945379|gb|EES85817.1| 30S ribosomal protein S18 [Bacteroides sp. 3_2_5]
 gi|263253352|gb|EEZ24828.1| ribosomal protein S18 [Bacteroides sp. 2_1_16]
 gi|301164596|emb|CBW24155.1| putative 30S ribosomal protein S18 [Bacteroides fragilis 638R]
          Length = 90

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ +V 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPFVT 86


>gi|254456332|ref|ZP_05069761.1| ribosomal protein S18 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083334|gb|EDZ60760.1| ribosomal protein S18 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 90

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 41/77 (53%), Positives = 58/77 (75%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          +  A   + + N    +K+CPLS KGAP +DYK+IRLL +++S+ GKI+PSRI++VS KK
Sbjct: 14 SNFAKLSIFQPNKYKFKKNCPLSAKGAPAVDYKNIRLLKKYMSENGKILPSRITNVSQKK 73

Query: 62 QRELAKAIKRARYLGLI 78
          QREL+ +IKRAR L L+
Sbjct: 74 QRELSLSIKRARNLALL 90


>gi|296141832|ref|YP_003649075.1| ribosomal protein S18 [Tsukamurella paurometabola DSM 20162]
 gi|296029966|gb|ADG80736.1| ribosomal protein S18 [Tsukamurella paurometabola DSM 20162]
          Length = 85

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 46/82 (56%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA       +R   + + K+C    +   +IDYKD  LL RFLS+RGKI   R++    +
Sbjct: 1  MAGKGNGRKVRVEKAVKAKACTFCKEKNIKIDYKDTTLLRRFLSERGKIRSRRVTGNCVQ 60

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
           QR++A A+K +R + L+ + +
Sbjct: 61 HQRDVAIAVKNSREVALLPFTS 82


>gi|326774854|ref|ZP_08234119.1| ribosomal protein S18 [Streptomyces cf. griseus XylebKG-1]
 gi|326655187|gb|EGE40033.1| ribosomal protein S18 [Streptomyces cf. griseus XylebKG-1]
          Length = 82

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 40/75 (53%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
                    + +  PL       IDYKD  LL RF+S RGKI   R++ +S ++QR++A
Sbjct: 2  ARQQEPRKPFKSRPNPLDAAENTYIDYKDTDLLRRFVSDRGKIRGRRVTRISARQQRQVA 61

Query: 67 KAIKRARYLGLIAYV 81
           AIK AR + L+ Y 
Sbjct: 62 AAIKNAREMALLPYT 76


>gi|260072537|gb|ACX30437.1| ribosomal protein S18 [uncultured SUP05 cluster bacterium]
 gi|269468495|gb|EEZ80153.1| ribosomal protein S18 [uncultured SUP05 cluster bacterium]
          Length = 84

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 43/75 (57%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
             RR +      C  +  G   IDYKD+ +L + + + GKI PSR++  + K QR+L  
Sbjct: 6  KRKRRPLIKINSFCRFTAAGVKEIDYKDVDVLLKNIDESGKITPSRMTGTTAKFQRQLTT 65

Query: 68 AIKRARYLGLIAYVN 82
          AIKRAR+L LI Y +
Sbjct: 66 AIKRARFLALIPYTD 80


>gi|302546721|ref|ZP_07299063.1| ribosomal protein S18 [Streptomyces hygroscopicus ATCC 53653]
 gi|302464339|gb|EFL27432.1| ribosomal protein S18 [Streptomyces himastatinicus ATCC 53653]
          Length = 80

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/77 (37%), Positives = 46/77 (59%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A      R  + R +  PL   G   +DYK+  LL +F+S RGKI   R++ V+ ++QR
Sbjct: 1  MARRATSDRRGAKRPRVNPLDAAGITYVDYKNTDLLRKFISDRGKIRSPRVTHVTRQQQR 60

Query: 64 ELAKAIKRARYLGLIAY 80
          ++A+AIK AR + L+ Y
Sbjct: 61 QIARAIKNAREMALLPY 77


>gi|268316170|ref|YP_003289889.1| 30S ribosomal protein S18 [Rhodothermus marinus DSM 4252]
 gi|262333704|gb|ACY47501.1| ribosomal protein S18 [Rhodothermus marinus DSM 4252]
          Length = 65

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 43/57 (75%)

Query: 25 GKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
           +    +DYKD+  L +F++++GKI+P RI+ VS K QR++A+AIKRAR+L L+ +V
Sbjct: 4  KRDLEYVDYKDVEFLKQFINEQGKILPRRITGVSAKTQRQIARAIKRARHLALLPFV 60


>gi|166367546|ref|YP_001659819.1| 30S ribosomal protein S18 [Microcystis aeruginosa NIES-843]
 gi|189029681|sp|B0JVN4|RS18_MICAN RecName: Full=30S ribosomal protein S18
 gi|166089919|dbj|BAG04627.1| 30S ribosomal protein S18 [Microcystis aeruginosa NIES-843]
          Length = 71

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++  P+S      IDYKD  LL +F+++RGKI+P RI+ ++ K+QR+L +A+KRAR + 
Sbjct: 5  RKRLSPISPSQ--PIDYKDTELLRKFITERGKILPRRITGLTSKQQRDLTEAVKRARLMA 62

Query: 77 LIAYVN 82
          L+ +VN
Sbjct: 63 LLPFVN 68


>gi|42520621|ref|NP_966536.1| 30S ribosomal protein S18 [Wolbachia endosymbiont of Drosophila
          melanogaster]
 gi|58698590|ref|ZP_00373488.1| ribosomal protein S18 [Wolbachia endosymbiont of Drosophila
          ananassae]
 gi|99034686|ref|ZP_01314626.1| hypothetical protein Wendoof_01000557 [Wolbachia endosymbiont of
          Drosophila willistoni TSC#14030-0811.24]
 gi|225630395|ref|YP_002727186.1| ribosomal protein S18 [Wolbachia sp. wRi]
 gi|59798787|sp|Q73GZ6|RS18_WOLPM RecName: Full=30S ribosomal protein S18
 gi|254812966|sp|C0R3A3|RS18_WOLWR RecName: Full=30S ribosomal protein S18
 gi|42410360|gb|AAS14470.1| ribosomal protein S18 [Wolbachia endosymbiont of Drosophila
          melanogaster]
 gi|58534886|gb|EAL58987.1| ribosomal protein S18 [Wolbachia endosymbiont of Drosophila
          ananassae]
 gi|225592376|gb|ACN95395.1| ribosomal protein S18 [Wolbachia sp. wRi]
          Length = 91

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/71 (47%), Positives = 44/71 (61%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    R K CPL+      IDYK+I LL++F S  G+I+P R++ V  KKQR+L  AI R
Sbjct: 18 RTGFRRSKVCPLAASKDEDIDYKNIDLLSKFTSDYGRILPRRLTGVCAKKQRKLRLAIIR 77

Query: 72 ARYLGLIAYVN 82
          AR+L LI Y  
Sbjct: 78 ARFLALIPYCT 88


>gi|58584758|ref|YP_198331.1| 30S ribosomal protein S18 [Wolbachia endosymbiont strain TRS of
          Brugia malayi]
 gi|75507965|sp|Q5GSD5|RS18_WOLTR RecName: Full=30S ribosomal protein S18
 gi|58419074|gb|AAW71089.1| Ribosomal protein S18 [Wolbachia endosymbiont strain TRS of
          Brugia malayi]
          Length = 91

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 43/71 (60%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    R K CPL+      IDYK+  LL+RF S  G+I+P R++ V  KKQR+L  AI R
Sbjct: 18 RTGFKRSKVCPLATSQDEDIDYKNTDLLSRFTSDYGRILPRRLTGVCAKKQRKLRLAIIR 77

Query: 72 ARYLGLIAYVN 82
          AR+L L+ Y  
Sbjct: 78 ARFLALVPYCT 88


>gi|326383849|ref|ZP_08205533.1| 30S ribosomal protein S18 [Gordonia neofelifaecis NRRL B-59395]
 gi|326197308|gb|EGD54498.1| 30S ribosomal protein S18 [Gordonia neofelifaecis NRRL B-59395]
          Length = 74

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 38/69 (55%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             + K+C         IDYKD  LL RFLS RGKI   R++    + QR++A A+K +R
Sbjct: 3  KVTKAKACTFCKDKKTVIDYKDTALLRRFLSDRGKIRSRRVTGNCVQHQRDVAVAVKNSR 62

Query: 74 YLGLIAYVN 82
           + L+ + +
Sbjct: 63 EVALLPFTS 71


>gi|325298154|ref|YP_004258071.1| 30S ribosomal protein S18 [Bacteroides salanitronis DSM 18170]
 gi|324317707|gb|ADY35598.1| 30S ribosomal protein S18 [Bacteroides salanitronis DSM 18170]
          Length = 89

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPYVT 85


>gi|219684867|ref|ZP_03539809.1| ribosomal protein S18 [Borrelia garinii PBr]
 gi|219685376|ref|ZP_03540195.1| ribosomal protein S18 [Borrelia garinii Far04]
 gi|224532127|ref|ZP_03672759.1| ribosomal protein S18 [Borrelia valaisiana VS116]
 gi|219671812|gb|EED28867.1| ribosomal protein S18 [Borrelia garinii PBr]
 gi|219673149|gb|EED30169.1| ribosomal protein S18 [Borrelia garinii Far04]
 gi|224511592|gb|EEF81998.1| ribosomal protein S18 [Borrelia valaisiana VS116]
          Length = 96

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             +RKSC     G    DYKD   L +F++++GKI+P RI+  S K QR LA  IKRAR
Sbjct: 28 RFFKRKSCKFCDSGKHP-DYKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRAR 86

Query: 74 YLGLIAYV 81
          Y+ L+ +V
Sbjct: 87 YMALLPFV 94


>gi|71083407|ref|YP_266126.1| 30S ribosomal protein S18 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|91762170|ref|ZP_01264135.1| ribosomal protein S18 [Candidatus Pelagibacter ubique HTCC1002]
 gi|123748053|sp|Q4FMR6|RS18_PELUB RecName: Full=30S ribosomal protein S18
 gi|71062520|gb|AAZ21523.1| ribosomal protein S18 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717972|gb|EAS84622.1| ribosomal protein S18 [Candidatus Pelagibacter ubique HTCC1002]
          Length = 92

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 42/77 (54%), Positives = 58/77 (75%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          +  A   + + N    +K+CPLS KGAP +DYK+IRLL +++S+ GKI+PSRI++VS KK
Sbjct: 16 SNFAKLSIFQPNKYKFKKTCPLSAKGAPEVDYKNIRLLKKYMSENGKILPSRITNVSQKK 75

Query: 62 QRELAKAIKRARYLGLI 78
          QREL+ +IKRAR L LI
Sbjct: 76 QRELSLSIKRARNLALI 92


>gi|224534030|ref|ZP_03674614.1| ribosomal protein S18 [Borrelia burgdorferi CA-11.2a]
 gi|225549263|ref|ZP_03770236.1| ribosomal protein S18 [Borrelia burgdorferi 94a]
 gi|224512866|gb|EEF83233.1| ribosomal protein S18 [Borrelia burgdorferi CA-11.2a]
 gi|225370121|gb|EEG99561.1| ribosomal protein S18 [Borrelia burgdorferi 94a]
 gi|312148403|gb|ADQ31062.1| ribosomal protein S18 [Borrelia burgdorferi JD1]
          Length = 96

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             +RKSC     G    DYKD   L +F++++GKI+P RI+  S K QR LA  IKRAR
Sbjct: 28 RFFKRKSCKFCDSGKHP-DYKDFEFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRAR 86

Query: 74 YLGLIAYV 81
          Y+ L+ +V
Sbjct: 87 YMALLPFV 94


>gi|88606855|ref|YP_504776.1| 30S ribosomal protein S18 [Anaplasma phagocytophilum HZ]
 gi|123736454|sp|Q2GLH5|RS18_ANAPZ RecName: Full=30S ribosomal protein S18
 gi|88597918|gb|ABD43388.1| ribosomal protein S18 [Anaplasma phagocytophilum HZ]
          Length = 96

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 54/76 (71%)

Query: 6  PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          P   L+R    + +SCPL+      IDYK+  LL++F+S+ G+I+PSRI+SVS +KQ+ L
Sbjct: 21 PLVYLKRPYFRKSRSCPLAQCPDEDIDYKNKVLLSKFVSEYGRILPSRITSVSARKQKLL 80

Query: 66 AKAIKRARYLGLIAYV 81
          A+AIKRARYL L+ Y 
Sbjct: 81 ARAIKRARYLALLPYC 96


>gi|313678624|ref|YP_004056364.1| 30S ribosomal protein S18 [Mycoplasma bovis PG45]
 gi|312950259|gb|ADR24854.1| ribosomal protein S18 [Mycoplasma bovis PG45]
          Length = 108

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA         +   + R+ C L       +DYK++  + +F+S  G+I P   +    +
Sbjct: 1  MANFKKV----KKGRNLRRKCELCETNIEYVDYKNVEFITKFISGIGQIKPHASTGTCAR 56

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QR++A AIKRAR++ LI Y 
Sbjct: 57 HQRKVANAIKRARFMALIPYT 77


>gi|15594459|ref|NP_212247.1| 30S ribosomal protein S18 [Borrelia burgdorferi B31]
 gi|216264194|ref|ZP_03436186.1| ribosomal protein S18 [Borrelia burgdorferi 156a]
 gi|218249765|ref|YP_002374641.1| ribosomal protein S18 [Borrelia burgdorferi ZS7]
 gi|221217474|ref|ZP_03588945.1| ribosomal protein S18 [Borrelia burgdorferi 72a]
 gi|224532934|ref|ZP_03673544.1| ribosomal protein S18 [Borrelia burgdorferi WI91-23]
 gi|225549865|ref|ZP_03770827.1| ribosomal protein S18 [Borrelia burgdorferi 118a]
 gi|225552003|ref|ZP_03772943.1| ribosomal protein S18 [Borrelia sp. SV1]
 gi|226320695|ref|ZP_03796253.1| ribosomal protein S18 [Borrelia burgdorferi 29805]
 gi|226321976|ref|ZP_03797501.1| ribosomal protein S18 [Borrelia burgdorferi Bol26]
 gi|6226082|sp|O51140|RS18_BORBU RecName: Full=30S ribosomal protein S18
 gi|226735111|sp|B7J146|RS18_BORBZ RecName: Full=30S ribosomal protein S18
 gi|2687990|gb|AAC66493.1| ribosomal protein S18 (rpsR) [Borrelia burgdorferi B31]
 gi|215980667|gb|EEC21474.1| ribosomal protein S18 [Borrelia burgdorferi 156a]
 gi|218164953|gb|ACK75014.1| ribosomal protein S18 [Borrelia burgdorferi ZS7]
 gi|221192752|gb|EEE18968.1| ribosomal protein S18 [Borrelia burgdorferi 72a]
 gi|224512133|gb|EEF82524.1| ribosomal protein S18 [Borrelia burgdorferi WI91-23]
 gi|225369556|gb|EEG99007.1| ribosomal protein S18 [Borrelia burgdorferi 118a]
 gi|225371001|gb|EEH00431.1| ribosomal protein S18 [Borrelia sp. SV1]
 gi|226232566|gb|EEH31320.1| ribosomal protein S18 [Borrelia burgdorferi Bol26]
 gi|226233911|gb|EEH32634.1| ribosomal protein S18 [Borrelia burgdorferi 29805]
 gi|312149769|gb|ADQ29840.1| ribosomal protein S18 [Borrelia burgdorferi N40]
          Length = 96

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             +RKSC     G    DYKD   L +F++++GKI+P RI+  S K QR LA  IKRAR
Sbjct: 28 RFFKRKSCKFCDSGKHP-DYKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRAR 86

Query: 74 YLGLIAYV 81
          Y+ L+ +V
Sbjct: 87 YMALLPFV 94


>gi|160871730|ref|ZP_02061862.1| ribosomal protein S18 [Rickettsiella grylli]
 gi|159120529|gb|EDP45867.1| ribosomal protein S18 [Rickettsiella grylli]
          Length = 78

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          +    + RRK C +S +G   +DYKD+ LL   L++  KIVPSR +  +   QR+L +AI
Sbjct: 1  MNNYQTRRRKHCRISAEGME-VDYKDLALLKSHLTETAKIVPSRTTGTTACVQRKLTQAI 59

Query: 70 KRARYLGLIAYVN 82
          KRAR+LGL+ Y +
Sbjct: 60 KRARFLGLLPYCD 72


>gi|296167064|ref|ZP_06849476.1| 30S ribosomal protein S18 [Mycobacterium parascrofulaceum ATCC
          BAA-614]
 gi|295897621|gb|EFG77215.1| 30S ribosomal protein S18 [Mycobacterium parascrofulaceum ATCC
          BAA-614]
          Length = 84

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA+ +            RK C    K    IDYKD  LL  ++S+RGKI   R++    +
Sbjct: 1  MAKSSKRRPAPEKPVKTRK-CVFCAKNDQSIDYKDTALLRTYISERGKIRARRVTGNCVQ 59

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
           QR++A A+K AR + L+ + +
Sbjct: 60 HQRDIAIAVKNAREVALLPFTS 81


>gi|149918391|ref|ZP_01906881.1| ribosomal protein S18 [Plesiocystis pacifica SIR-1]
 gi|149820691|gb|EDM80101.1| ribosomal protein S18 [Plesiocystis pacifica SIR-1]
          Length = 82

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 40/57 (70%)

Query: 25 GKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
                IDYK+ +LL  FL++RGK++P+RI+ VS ++QR + KAIKRAR L L+ Y 
Sbjct: 24 ADPNVVIDYKNPQLLKHFLTERGKVIPARITGVSARQQRAITKAIKRARQLALLPYT 80


>gi|33861426|ref|NP_892987.1| 30S ribosomal protein S18 [Prochlorococcus marinus subsp.
          pastoris str. CCMP1986]
 gi|78779316|ref|YP_397428.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9312]
 gi|123966183|ref|YP_001011264.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9515]
 gi|123968526|ref|YP_001009384.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. AS9601]
 gi|126696329|ref|YP_001091215.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9301]
 gi|157413359|ref|YP_001484225.1| 30S ribosomal protein S18 [Prochlorococcus marinus str. MIT 9215]
 gi|254525976|ref|ZP_05138028.1| ribosomal protein S18 [Prochlorococcus marinus str. MIT 9202]
 gi|59798835|sp|Q7TUA0|RS18_PROMP RecName: Full=30S ribosomal protein S18
 gi|123741464|sp|Q31AV3|RS18_PROM9 RecName: Full=30S ribosomal protein S18
 gi|166220970|sp|A3PCY9|RS18_PROM0 RecName: Full=30S ribosomal protein S18
 gi|166220973|sp|A2BWJ6|RS18_PROM5 RecName: Full=30S ribosomal protein S18
 gi|166220974|sp|A2BR66|RS18_PROMS RecName: Full=30S ribosomal protein S18
 gi|167011192|sp|A8G4V8|RS18_PROM2 RecName: Full=30S ribosomal protein S18
 gi|33634003|emb|CAE19328.1| 30S Ribosomal protein S18 [Prochlorococcus marinus subsp.
          pastoris str. CCMP1986]
 gi|78712815|gb|ABB49992.1| SSU ribosomal protein S18P [Prochlorococcus marinus str. MIT
          9312]
 gi|123198636|gb|ABM70277.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. AS9601]
 gi|123200549|gb|ABM72157.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9515]
 gi|126543372|gb|ABO17614.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9301]
 gi|157387934|gb|ABV50639.1| 30S Ribosomal protein S18 [Prochlorococcus marinus str. MIT 9215]
 gi|221537400|gb|EEE39853.1| ribosomal protein S18 [Prochlorococcus marinus str. MIT 9202]
          Length = 73

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 49/78 (62%), Gaps = 8/78 (10%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
           P  + ++ +S  +            IDYKD+ LL +F+++RGKI+P R++ ++ K+QR+
Sbjct: 1  MPNSIFKKQLSPIK--------PGDPIDYKDVELLKKFITERGKILPRRMTGLTSKQQRD 52

Query: 65 LAKAIKRARYLGLIAYVN 82
          L  A+KRAR + L+ +VN
Sbjct: 53 LTLAVKRARIVALLPFVN 70


>gi|54310417|ref|YP_131437.1| putative ribosomal protein S18 [Photobacterium profundum SS9]
 gi|90414462|ref|ZP_01222438.1| putative ribosomal protein S18 [Photobacterium profundum 3TCK]
 gi|59798724|sp|Q6LM43|RS18_PHOPR RecName: Full=30S ribosomal protein S18
 gi|46914858|emb|CAG21635.1| putative ribosomal protein S18 [Photobacterium profundum SS9]
 gi|90324467|gb|EAS41026.1| putative ribosomal protein S18 [Photobacterium profundum 3TCK]
          Length = 75

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +    IDYKD+  L  ++++ GKIVPSRI+    K QR+LA+AIKR+RYL L+ Y +
Sbjct: 14 TAEDVQEIDYKDVVTLKNYITEAGKIVPSRITGTRAKYQRQLARAIKRSRYLALLPYTD 72


>gi|186685032|ref|YP_001868228.1| 30S ribosomal protein S18 [Nostoc punctiforme PCC 73102]
 gi|229560047|sp|B2J0D3|RS18_NOSP7 RecName: Full=30S ribosomal protein S18
 gi|186467484|gb|ACC83285.1| ribosomal protein S18 [Nostoc punctiforme PCC 73102]
          Length = 71

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RR+  P+  K    IDYKD+ LL +F+++RGKI+P RI+ ++ ++QREL  AIKR+R 
Sbjct: 3  YFRRRLSPI--KPGEPIDYKDVDLLRKFVTERGKILPRRITGLTSQQQRELTLAIKRSRI 60

Query: 75 LGLIAYVN 82
          + L+ ++N
Sbjct: 61 VALLPFIN 68


>gi|322433963|ref|YP_004216175.1| ribosomal protein S18 [Acidobacterium sp. MP5ACTX9]
 gi|321161690|gb|ADW67395.1| ribosomal protein S18 [Acidobacterium sp. MP5ACTX9]
          Length = 129

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 43/68 (63%)

Query: 13  NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
               R+K C    +    I Y+D+RLL  F+++RGKIVP R++ V  + QR L+ AIK++
Sbjct: 58  KFFRRKKVCKFCTEKIDAISYRDVRLLQGFVAERGKIVPRRLTGVCTRHQRRLSLAIKQS 117

Query: 73  RYLGLIAY 80
           R + L+A+
Sbjct: 118 RNIALLAF 125


>gi|111022580|ref|YP_705552.1| 30S ribosomal protein S18 [Rhodococcus jostii RHA1]
 gi|123045681|sp|Q0S4Z2|RS182_RHOSR RecName: Full=30S ribosomal protein S18 2
 gi|110822110|gb|ABG97394.1| 30S ribosomal protein S18 [Rhodococcus jostii RHA1]
          Length = 84

 Score = 86.2 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (57%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          + AP+   R     + K  PL       +DYKDI LL  F+S RGKI   R++ ++ ++Q
Sbjct: 4  KRAPSKKPRPVEGRKPKKNPLFAAKIEHVDYKDINLLRTFISDRGKIRSRRVTGLTPQQQ 63

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R++A A+K AR + L+ + +
Sbjct: 64 RQVAVAVKNAREMALLPFTS 83


>gi|37522628|ref|NP_926005.1| 30S ribosomal protein S18 [Gloeobacter violaceus PCC 7421]
 gi|59798825|sp|Q7NCC0|RS18_GLOVI RecName: Full=30S ribosomal protein S18
 gi|35213629|dbj|BAC91000.1| 30S ribosomal protein S18 [Gloeobacter violaceus PCC 7421]
          Length = 74

 Score = 86.2 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/65 (44%), Positives = 47/65 (72%), Gaps = 2/65 (3%)

Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          ++  P+      +IDYK++ LL +F+++RGKI+P RI+ ++ K+QR+L  AIKRAR L L
Sbjct: 9  KRVSPI--PPKDKIDYKEVDLLRKFITERGKILPRRITGLTAKQQRDLTVAIKRARLLAL 66

Query: 78 IAYVN 82
          + +VN
Sbjct: 67 LPFVN 71


>gi|256826412|ref|YP_003150372.1| 30S ribosomal protein S18 [Kytococcus sedentarius DSM 20547]
 gi|256689805|gb|ACV07607.1| SSU ribosomal protein S18P [Kytococcus sedentarius DSM 20547]
          Length = 81

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 48/76 (63%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
            ++R     ++K+ PL      +IDYKD  LL +F+S RGKI   R++ VS ++QR++A
Sbjct: 3  KSVVRNPKPVKKKANPLKAAKVEKIDYKDTALLRKFISDRGKIRARRVTGVSVQEQRQIA 62

Query: 67 KAIKRARYLGLIAYVN 82
          KA+K AR + L+ Y +
Sbjct: 63 KAVKNAREMALLPYSS 78


>gi|297192957|ref|ZP_06910355.1| 30S ribosomal protein S18 2 [Streptomyces pristinaespiralis ATCC
          25486]
 gi|197722638|gb|EDY66546.1| 30S ribosomal protein S18 2 [Streptomyces pristinaespiralis ATCC
          25486]
          Length = 82

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 46/77 (59%), Gaps = 1/77 (1%)

Query: 7  TPLLRRNVSH-RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          +P  +   +  + +  PL       IDYKD  LL +F+S RGKI   R++ VS ++QR+L
Sbjct: 2  SPRRKDPRTPLKSRPNPLDRARITYIDYKDTDLLRKFISDRGKIRSRRVTRVSAQQQRQL 61

Query: 66 AKAIKRARYLGLIAYVN 82
          A+AIK AR + L+ Y +
Sbjct: 62 ARAIKNAREMALLPYTS 78


>gi|116074877|ref|ZP_01472138.1| 30S ribosomal protein S18 [Synechococcus sp. RS9916]
 gi|116068099|gb|EAU73852.1| 30S ribosomal protein S18 [Synechococcus sp. RS9916]
          Length = 73

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            +++  P+  K    IDYKD+ LL +F+++RGKI+P R++ ++ K+QR+L  A+KRAR 
Sbjct: 5  FFKKRLSPI--KPGDPIDYKDVDLLKKFITERGKILPRRLTGLTAKQQRDLTNAVKRARI 62

Query: 75 LGLIAYVN 82
          + ++ +VN
Sbjct: 63 VAMLPFVN 70


>gi|294673370|ref|YP_003573986.1| 30S ribosomal protein S18 [Prevotella ruminicola 23]
 gi|294473390|gb|ADE82779.1| ribosomal protein S18 [Prevotella ruminicola 23]
          Length = 88

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 29 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 84


>gi|282895502|ref|ZP_06303639.1| Ribosomal protein S18 [Raphidiopsis brookii D9]
 gi|281199535|gb|EFA74398.1| Ribosomal protein S18 [Raphidiopsis brookii D9]
          Length = 71

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR+  P+  K    IDYKD+ LL +F+++RGKI+P RI+ ++ ++QR+L  AIKRAR L 
Sbjct: 5  RRRLSPI--KPGEPIDYKDVDLLRKFMTERGKILPRRITGLTSQQQRQLTLAIKRARILA 62

Query: 77 LIAYVN 82
           + ++N
Sbjct: 63 FLPFIN 68


>gi|150002620|ref|YP_001297364.1| 30S ribosomal protein S18 [Bacteroides vulgatus ATCC 8482]
 gi|189462618|ref|ZP_03011403.1| hypothetical protein BACCOP_03310 [Bacteroides coprocola DSM
          17136]
 gi|198276875|ref|ZP_03209406.1| hypothetical protein BACPLE_03080 [Bacteroides plebeius DSM
          17135]
 gi|212691069|ref|ZP_03299197.1| hypothetical protein BACDOR_00559 [Bacteroides dorei DSM 17855]
 gi|224026732|ref|ZP_03645098.1| hypothetical protein BACCOPRO_03489 [Bacteroides coprophilus DSM
          18228]
 gi|237712431|ref|ZP_04542912.1| 30S ribosomal protein S18 [Bacteroides sp. 9_1_42FAA]
 gi|237726621|ref|ZP_04557102.1| 30S ribosomal protein S18 [Bacteroides sp. D4]
 gi|254881416|ref|ZP_05254126.1| 30S ribosomal protein S18 [Bacteroides sp. 4_3_47FAA]
 gi|265752133|ref|ZP_06087926.1| 30S ribosomal protein S18 [Bacteroides sp. 3_1_33FAA]
 gi|294776102|ref|ZP_06741595.1| ribosomal protein S18 [Bacteroides vulgatus PC510]
 gi|319642803|ref|ZP_07997441.1| 30S ribosomal protein S18 [Bacteroides sp. 3_1_40A]
 gi|166220923|sp|A6KWD6|RS18_BACV8 RecName: Full=30S ribosomal protein S18
 gi|149931044|gb|ABR37742.1| 30S ribosomal protein S18 [Bacteroides vulgatus ATCC 8482]
 gi|189430779|gb|EDU99763.1| hypothetical protein BACCOP_03310 [Bacteroides coprocola DSM
          17136]
 gi|198270400|gb|EDY94670.1| hypothetical protein BACPLE_03080 [Bacteroides plebeius DSM
          17135]
 gi|212666301|gb|EEB26873.1| hypothetical protein BACDOR_00559 [Bacteroides dorei DSM 17855]
 gi|224019968|gb|EEF77966.1| hypothetical protein BACCOPRO_03489 [Bacteroides coprophilus DSM
          18228]
 gi|229435147|gb|EEO45224.1| 30S ribosomal protein S18 [Bacteroides dorei 5_1_36/D4]
 gi|229453752|gb|EEO59473.1| 30S ribosomal protein S18 [Bacteroides sp. 9_1_42FAA]
 gi|254834209|gb|EET14518.1| 30S ribosomal protein S18 [Bacteroides sp. 4_3_47FAA]
 gi|263236925|gb|EEZ22395.1| 30S ribosomal protein S18 [Bacteroides sp. 3_1_33FAA]
 gi|294450053|gb|EFG18560.1| ribosomal protein S18 [Bacteroides vulgatus PC510]
 gi|317385547|gb|EFV66488.1| 30S ribosomal protein S18 [Bacteroides sp. 3_1_40A]
          Length = 89

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ +V 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPFVT 85


>gi|28872046|ref|NP_794665.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tomato str.
          DC3000]
 gi|66043849|ref|YP_233690.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. syringae
          B728a]
 gi|70734082|ref|YP_257722.1| 30S ribosomal protein S18 [Pseudomonas fluorescens Pf-5]
 gi|71735317|ref|YP_272877.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. phaseolicola
          1448A]
 gi|77456763|ref|YP_346268.1| 30S ribosomal protein S18 [Pseudomonas fluorescens Pf0-1]
 gi|213967934|ref|ZP_03396080.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tomato T1]
 gi|229588087|ref|YP_002870206.1| 30S ribosomal protein S18 [Pseudomonas fluorescens SBW25]
 gi|237798288|ref|ZP_04586749.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. oryzae str.
          1_6]
 gi|257482398|ref|ZP_05636439.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tabaci ATCC
          11528]
 gi|289624607|ref|ZP_06457561.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. aesculi str.
          NCPPB3681]
 gi|289648617|ref|ZP_06479960.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. aesculi str.
          2250]
 gi|298484905|ref|ZP_07003004.1| SSU ribosomal protein S18p [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
 gi|301383749|ref|ZP_07232167.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tomato Max13]
 gi|302059276|ref|ZP_07250817.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tomato K40]
 gi|302132344|ref|ZP_07258334.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tomato NCPPB
          1108]
 gi|302185450|ref|ZP_07262123.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. syringae 642]
 gi|330807241|ref|YP_004351703.1| 30S ribosomal protein S18 [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|38258466|sp|Q87VK4|RS18_PSESM RecName: Full=30S ribosomal protein S18
 gi|81308571|sp|Q4ZYX0|RS18_PSEU2 RecName: Full=30S ribosomal protein S18
 gi|123606171|sp|Q3KIX7|RS18_PSEPF RecName: Full=30S ribosomal protein S18
 gi|123734036|sp|Q48NZ2|RS18_PSE14 RecName: Full=30S ribosomal protein S18
 gi|123748561|sp|Q4KJ61|RS18_PSEF5 RecName: Full=30S ribosomal protein S18
 gi|259494816|sp|C3KE68|RS18_PSEFS RecName: Full=30S ribosomal protein S18
 gi|28855299|gb|AAO58360.1| ribosomal protein S18 [Pseudomonas syringae pv. tomato str.
          DC3000]
 gi|63254556|gb|AAY35652.1| Ribosomal protein S18 [Pseudomonas syringae pv. syringae B728a]
 gi|68348381|gb|AAY95987.1| ribosomal protein S18 [Pseudomonas fluorescens Pf-5]
 gi|71555870|gb|AAZ35081.1| ribosomal protein S18 [Pseudomonas syringae pv. phaseolicola
          1448A]
 gi|77380766|gb|ABA72279.1| 30S ribosomal protein S18 [Pseudomonas fluorescens Pf0-1]
 gi|213927277|gb|EEB60826.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tomato T1]
 gi|229359953|emb|CAY46807.1| 30S ribosomal protein S18 [Pseudomonas fluorescens SBW25]
 gi|298160592|gb|EFI01614.1| SSU ribosomal protein S18p [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
 gi|320321873|gb|EFW77969.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. glycinea str.
          B076]
 gi|320331022|gb|EFW86996.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. glycinea str.
          race 4]
 gi|327375349|gb|AEA66699.1| 30S ribosomal protein S18 [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|330865905|gb|EGH00614.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. aesculi str.
          0893_23]
 gi|330872264|gb|EGH06413.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. glycinea str.
          race 4]
 gi|330873775|gb|EGH07924.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. morsprunorum
          str. M302280PT]
 gi|330886612|gb|EGH20273.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. mori str.
          301020]
 gi|330899906|gb|EGH31325.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. japonica str.
          M301072PT]
 gi|330939890|gb|EGH43112.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. pisi str.
          1704B]
 gi|330951488|gb|EGH51748.1| 30S ribosomal protein S18 [Pseudomonas syringae Cit 7]
 gi|330960078|gb|EGH60338.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. maculicola
          str. ES4326]
 gi|330965992|gb|EGH66252.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. actinidiae
          str. M302091]
 gi|330971571|gb|EGH71637.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. aceris str.
          M302273PT]
 gi|330978936|gb|EGH77995.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. aptata str.
          DSM 50252]
 gi|330984550|gb|EGH82653.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. lachrymans
          str. M301315]
 gi|331009772|gb|EGH89828.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. tabaci ATCC
          11528]
 gi|331014621|gb|EGH94677.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. lachrymans
          str. M302278PT]
 gi|331021140|gb|EGI01197.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. oryzae str.
          1_6]
          Length = 76

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +    IDYKD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRAR+L L+AY +
Sbjct: 14 TAEDVKEIDYKDLNTLKAYVSETGKIVPSRITGTKARYQRQLATAIKRARFLALLAYTD 72


>gi|269114888|ref|YP_003302651.1| 30S ribosomal protein S18 [Mycoplasma hominis]
 gi|268322513|emb|CAX37248.1| 30S ribosomal protein S18 [Mycoplasma hominis ATCC 23114]
          Length = 99

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 48/79 (60%), Gaps = 2/79 (2%)

Query: 7  TPLLRRNVSHRRKSCPLS--GKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
            ++R+    R++ C      +    IDYK+  +L++ ++ +GKI+ SRI+    K QR 
Sbjct: 2  ARIVRKKPFIRKRPCQFCLSKEPVVYIDYKNEEVLSKLVNLQGKILSSRITGTCAKHQRA 61

Query: 65 LAKAIKRARYLGLIAYVNL 83
          +A AIKRAR++G++ Y+ L
Sbjct: 62 VALAIKRARFVGILPYIGL 80


>gi|311742122|ref|ZP_07715932.1| 30S ribosomal protein S18 [Aeromicrobium marinum DSM 15272]
 gi|311314615|gb|EFQ84522.1| 30S ribosomal protein S18 [Aeromicrobium marinum DSM 15272]
          Length = 78

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/76 (44%), Positives = 50/76 (65%), Gaps = 3/76 (3%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
           P++R+    ++KS PL+  G   IDYKD  LL +F+S RGKI   R++ VS ++QR +A
Sbjct: 3  KPVIRKP---KKKSNPLAVAGVTTIDYKDTALLRKFISDRGKIRARRVTGVSVQEQRLIA 59

Query: 67 KAIKRARYLGLIAYVN 82
          KAIK AR + L+ Y +
Sbjct: 60 KAIKNAREMALLPYTS 75


>gi|302543826|ref|ZP_07296168.1| ribosomal protein S18 [Streptomyces hygroscopicus ATCC 53653]
 gi|302461444|gb|EFL24537.1| ribosomal protein S18 [Streptomyces himastatinicus ATCC 53653]
          Length = 80

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/69 (44%), Positives = 45/69 (65%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    RR++ PL   G   +DYKD  LL +F+S RGKI   R++ V+ ++QR++A+AIK 
Sbjct: 9  RPDPRRRRANPLDAAGITYVDYKDTDLLRKFISDRGKIRSRRVTHVTRRQQRQIARAIKN 68

Query: 72 ARYLGLIAY 80
          AR + LI Y
Sbjct: 69 AREMALIPY 77


>gi|160885186|ref|ZP_02066189.1| hypothetical protein BACOVA_03184 [Bacteroides ovatus ATCC 8483]
 gi|237714853|ref|ZP_04545334.1| 30S ribosomal protein S18 [Bacteroides sp. D1]
 gi|237719993|ref|ZP_04550474.1| 30S ribosomal protein S18 [Bacteroides sp. 2_2_4]
 gi|260174162|ref|ZP_05760574.1| 30S ribosomal protein S18 [Bacteroides sp. D2]
 gi|262406876|ref|ZP_06083425.1| ribosomal protein S18 [Bacteroides sp. 2_1_22]
 gi|294647156|ref|ZP_06724755.1| ribosomal protein S18 [Bacteroides ovatus SD CC 2a]
 gi|294809233|ref|ZP_06767949.1| ribosomal protein S18 [Bacteroides xylanisolvens SD CC 1b]
 gi|299147873|ref|ZP_07040936.1| ribosomal protein S18 [Bacteroides sp. 3_1_23]
 gi|315922427|ref|ZP_07918667.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156109536|gb|EDO11281.1| hypothetical protein BACOVA_03184 [Bacteroides ovatus ATCC 8483]
 gi|229445178|gb|EEO50969.1| 30S ribosomal protein S18 [Bacteroides sp. D1]
 gi|229450545|gb|EEO56336.1| 30S ribosomal protein S18 [Bacteroides sp. 2_2_4]
 gi|262355579|gb|EEZ04670.1| ribosomal protein S18 [Bacteroides sp. 2_1_22]
 gi|292637443|gb|EFF55862.1| ribosomal protein S18 [Bacteroides ovatus SD CC 2a]
 gi|294443627|gb|EFG12378.1| ribosomal protein S18 [Bacteroides xylanisolvens SD CC 1b]
 gi|295084750|emb|CBK66273.1| SSU ribosomal protein S18P [Bacteroides xylanisolvens XB1A]
 gi|298514056|gb|EFI37942.1| ribosomal protein S18 [Bacteroides sp. 3_1_23]
 gi|313696302|gb|EFS33137.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 90

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 31 GIRYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPYVT 86


>gi|218246505|ref|YP_002371876.1| 30S ribosomal protein S18 [Cyanothece sp. PCC 8801]
 gi|257059538|ref|YP_003137426.1| 30S ribosomal protein S18 [Cyanothece sp. PCC 8802]
 gi|218166983|gb|ACK65720.1| ribosomal protein S18 [Cyanothece sp. PCC 8801]
 gi|256589704|gb|ACV00591.1| ribosomal protein S18 [Cyanothece sp. PCC 8802]
          Length = 71

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 49/66 (74%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++  P+    +  IDYKD  LL +F+++RGK++P RI+ ++ K+QR+L KA+KRAR+L 
Sbjct: 5  RKRLSPI--APSQPIDYKDTELLRKFITERGKLLPRRITGLTAKQQRDLTKAVKRARFLA 62

Query: 77 LIAYVN 82
          L+ +VN
Sbjct: 63 LLPFVN 68


>gi|226354820|ref|YP_002784560.1| 30S ribosomal protein S18 [Deinococcus deserti VCD115]
 gi|259494805|sp|C1CXK0|RS18_DEIDV RecName: Full=30S ribosomal protein S18
 gi|226316810|gb|ACO44806.1| putative 30S ribosomal protein S18 [Deinococcus deserti VCD115]
          Length = 92

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 39/69 (56%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              + K  P S       DYKD+++L RF+S  GKI+P R + +S K QR +A+ IK A
Sbjct: 18 KRPRKPKVDPFSIGELEITDYKDVKMLRRFVSDTGKILPRRRTGLSAKHQRRIAQTIKVA 77

Query: 73 RYLGLIAYV 81
          R L L+ Y 
Sbjct: 78 RQLALLPYT 86


>gi|333029249|ref|ZP_08457310.1| 30S ribosomal protein S18 [Bacteroides coprosuis DSM 18011]
 gi|332739846|gb|EGJ70328.1| 30S ribosomal protein S18 [Bacteroides coprosuis DSM 18011]
          Length = 90

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/57 (50%), Positives = 40/57 (70%)

Query: 26 KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
           G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 30 NGIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARHLALLPYVT 86


>gi|148377544|ref|YP_001256420.1| 30S ribosomal protein S18 [Mycoplasma agalactiae PG2]
 gi|205558356|sp|A5IY67|RS18_MYCAP RecName: Full=30S ribosomal protein S18
 gi|148291590|emb|CAL58976.1| 30S ribosomal protein S18 [Mycoplasma agalactiae PG2]
          Length = 107

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA         +   + R+ C L       +DYK++  + +F+S  G+I P   +    +
Sbjct: 1  MANFKKV----KKGRNLRRKCELCETNIEYVDYKNVEFITKFISGIGQIKPHVSTGTCAR 56

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QR++A AIKRAR++ LI Y 
Sbjct: 57 HQRKVANAIKRARFMALIPYT 77


>gi|320333138|ref|YP_004169849.1| 30S ribosomal protein S18 [Deinococcus maricopensis DSM 21211]
 gi|319754427|gb|ADV66184.1| 30S ribosomal protein S18 [Deinococcus maricopensis DSM 21211]
          Length = 88

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1  MAEVAPTPLLRRNVSHRR-KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSH 59
          MA     P  +     R+ K  P +       DYKD+++L RF+S  GKI+P R + +S 
Sbjct: 1  MATTERKPRAKGPKRPRKPKVDPFAIGELEITDYKDVKMLRRFISDTGKILPRRRTGLSA 60

Query: 60 KKQRELAKAIKRARYLGLIAYV 81
          K QR +A+ IK AR L L+ Y 
Sbjct: 61 KNQRRIAQTIKIARQLALLPYT 82


>gi|282860311|ref|ZP_06269380.1| ribosomal protein S18 [Prevotella bivia JCVIHMP010]
 gi|282586908|gb|EFB92144.1| ribosomal protein S18 [Prevotella bivia JCVIHMP010]
          Length = 89

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+AIKRAR + L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAIKRARQIALLPYVT 85


>gi|308234045|ref|ZP_07664782.1| ribosomal protein S18 [Atopobium vaginae DSM 15829]
 gi|328943442|ref|ZP_08240907.1| 30S ribosomal protein S18 [Atopobium vaginae DSM 15829]
 gi|327491411|gb|EGF23185.1| 30S ribosomal protein S18 [Atopobium vaginae DSM 15829]
          Length = 90

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/66 (40%), Positives = 39/66 (59%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           RRK   L       +DYKD +LL +F++ RGKI P R++ +  + Q  +A AIKRAR +
Sbjct: 12 PRRKFSQLDKAELDFVDYKDTQLLRKFMTDRGKIKPRRVTGICTQHQHNVAMAIKRAREM 71

Query: 76 GLIAYV 81
           L+ Y 
Sbjct: 72 ALLPYT 77


>gi|29347572|ref|NP_811075.1| 30S ribosomal protein S18 [Bacteroides thetaiotaomicron VPI-5482]
 gi|253572032|ref|ZP_04849436.1| 30S ribosomal protein S18 [Bacteroides sp. 1_1_6]
 gi|298383735|ref|ZP_06993296.1| ribosomal protein S18 [Bacteroides sp. 1_1_14]
 gi|59798897|sp|Q8A5S6|RS18_BACTN RecName: Full=30S ribosomal protein S18
 gi|29339473|gb|AAO77269.1| 30S ribosomal protein S18 [Bacteroides thetaiotaomicron VPI-5482]
 gi|251838212|gb|EES66299.1| 30S ribosomal protein S18 [Bacteroides sp. 1_1_6]
 gi|298263339|gb|EFI06202.1| ribosomal protein S18 [Bacteroides sp. 1_1_14]
          Length = 90

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ YV 
Sbjct: 31 GIRYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPYVT 86


>gi|68536624|ref|YP_251329.1| 30S ribosomal protein S18 [Corynebacterium jeikeium K411]
 gi|260577825|ref|ZP_05845759.1| 30S ribosomal protein S18 [Corynebacterium jeikeium ATCC 43734]
 gi|123734548|sp|Q4JTZ6|RS18_CORJK RecName: Full=30S ribosomal protein S18
 gi|68264223|emb|CAI37711.1| 30S ribosomal protein S18 [Corynebacterium jeikeium K411]
 gi|258604052|gb|EEW17295.1| 30S ribosomal protein S18 [Corynebacterium jeikeium ATCC 43734]
          Length = 82

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 47/79 (59%), Gaps = 3/79 (3%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
            +    + +   S R K  PL  +G   +DYK+  LL +F+S+RGKI   R++ ++ ++
Sbjct: 4  TNMKKARMEQ---SRRPKKNPLKAEGIETVDYKNYDLLRKFISERGKIRSRRVTGLTPQQ 60

Query: 62 QRELAKAIKRARYLGLIAY 80
          QR++A A+K AR + L+ +
Sbjct: 61 QRQVATAVKNAREMALLPF 79


>gi|260911679|ref|ZP_05918259.1| 30S ribosomal protein S18 [Prevotella sp. oral taxon 472 str.
          F0295]
 gi|288927613|ref|ZP_06421460.1| ribosomal protein S18 [Prevotella sp. oral taxon 317 str. F0108]
 gi|260634227|gb|EEX52337.1| 30S ribosomal protein S18 [Prevotella sp. oral taxon 472 str.
          F0295]
 gi|288330447|gb|EFC69031.1| ribosomal protein S18 [Prevotella sp. oral taxon 317 str. F0108]
          Length = 89

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+AIKRAR + L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAIKRARQIALLPYVT 85


>gi|297572323|ref|YP_003698097.1| ribosomal protein S18 [Arcanobacterium haemolyticum DSM 20595]
 gi|296932670|gb|ADH93478.1| ribosomal protein S18 [Arcanobacterium haemolyticum DSM 20595]
          Length = 78

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
           P+LR+    ++KS PL       +DYKD   L +F+S RGKI   R++ V+ ++QR++A
Sbjct: 3  KPVLRKP---KKKSNPLKAAKIEVVDYKDTATLRKFISDRGKIRSRRVTGVTVQEQRQIA 59

Query: 67 KAIKRARYLGLIAYVN 82
          +A+K AR + L+ Y +
Sbjct: 60 RAVKNAREMALLPYTS 75


>gi|237785093|ref|YP_002905798.1| 30S ribosomal protein S18 [Corynebacterium kroppenstedtii DSM
          44385]
 gi|259494804|sp|C4LHF0|RS18_CORK4 RecName: Full=30S ribosomal protein S18
 gi|237758005|gb|ACR17255.1| 30S ribosomal protein S18 [Corynebacterium kroppenstedtii DSM
          44385]
          Length = 82

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 44/68 (64%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
          + R K  PL  +G   +DYKDI  L  F+S+RGKI   R++ ++ ++QR++A A+K AR 
Sbjct: 14 TRRPKKNPLKARGIEAVDYKDIETLRTFISERGKIRSRRVTGLTPQQQRQVATAVKNARE 73

Query: 75 LGLIAYVN 82
          + L+ + +
Sbjct: 74 MALLPFTS 81


>gi|187917991|ref|YP_001883554.1| 30S ribosomal protein S18 [Borrelia hermsii DAH]
 gi|229559964|sp|B2S1U7|RS18_BORHD RecName: Full=30S ribosomal protein S18
 gi|119860839|gb|AAX16634.1| SSU ribosomal protein S18P [Borrelia hermsii DAH]
          Length = 96

 Score = 85.8 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 4/78 (5%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
              P  R     ++K+C          DYK+   L +F++++GKI+P RI+  S K QR
Sbjct: 21 FKKNPNFR---FFKKKTCKFCDMDRVP-DYKEFDFLKKFITEQGKILPRRITGTSAKHQR 76

Query: 64 ELAKAIKRARYLGLIAYV 81
           LA  IK+ARY+ L+ +V
Sbjct: 77 RLALEIKKARYMALLPFV 94


>gi|309390332|gb|ADO78212.1| SSU ribosomal protein S18P [Halanaerobium praevalens DSM 2228]
          Length = 71

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/65 (47%), Positives = 43/65 (66%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R KSC        +IDYKD+R LNR+L+ RGKI+P R++    K Q+ + KA+KRAR + 
Sbjct: 5  RNKSCHFCANENKKIDYKDLRTLNRYLTDRGKIMPRRVTGNCSKHQKLITKAVKRARSVA 64

Query: 77 LIAYV 81
          L+ YV
Sbjct: 65 LLPYV 69


>gi|225677181|ref|ZP_03788177.1| ribosomal protein S18 [Wolbachia endosymbiont of Muscidifurax
          uniraptor]
 gi|225590768|gb|EEH11999.1| ribosomal protein S18 [Wolbachia endosymbiont of Muscidifurax
          uniraptor]
          Length = 91

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/71 (47%), Positives = 45/71 (63%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R  S R K CPL+      +DYK+I LL++F S  G+I+P R++ V  KKQR+L  AI R
Sbjct: 18 RTGSRRSKVCPLAASKDEDVDYKNIDLLSKFTSDYGRILPRRLTGVCAKKQRKLRLAIIR 77

Query: 72 ARYLGLIAYVN 82
          AR+L LI Y  
Sbjct: 78 ARFLALIPYCT 88


>gi|304373311|ref|YP_003856520.1| 30S ribosomal protein S18 [Mycoplasma hyorhinis HUB-1]
 gi|304309502|gb|ADM21982.1| 30S ribosomal protein S18 [Mycoplasma hyorhinis HUB-1]
          Length = 80

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYK++ +L +F++  GKI PSRI+    K QR+++ AIKRAR + L+A
Sbjct: 13 PCHFCETQTVYIDYKNVEVLEKFVNPHGKIQPSRITGSCSKHQRQVSLAIKRARMIALMA 72

Query: 80 YV 81
          +V
Sbjct: 73 FV 74


>gi|289672603|ref|ZP_06493493.1| 30S ribosomal protein S18 [Pseudomonas syringae pv. syringae FF5]
          Length = 76

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 24 SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          + +    IDYKD+  L  ++S+ GKIVPSRI+    + QR+LA AIKRAR+L L+AY +
Sbjct: 14 TAEDVKEIDYKDLNTLKAYVSETGKIVPSRITGTKARYQRQLATAIKRARFLALLAYTD 72


>gi|51598376|ref|YP_072564.1| 30S ribosomal protein S18 [Borrelia garinii PBi]
 gi|59798661|sp|Q662P9|RS18_BORGA RecName: Full=30S ribosomal protein S18
 gi|51572947|gb|AAU06972.1| ribosomal protein S18 [Borrelia garinii PBi]
          Length = 96

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             +RKSC     G    DYKD   L +F++++GKI+P RI+  S K QR LA  +KRAR
Sbjct: 28 RFFKRKSCKFCDSGKHP-DYKDFDFLKKFITEQGKILPKRITGTSAKHQRRLALEVKRAR 86

Query: 74 YLGLIAYV 81
          Y+ L+ +V
Sbjct: 87 YMALLPFV 94


>gi|227504198|ref|ZP_03934247.1| 30S ribosomal protein S18 [Corynebacterium striatum ATCC 6940]
 gi|227199242|gb|EEI79290.1| 30S ribosomal protein S18 [Corynebacterium striatum ATCC 6940]
          Length = 84

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 44/72 (61%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R   + R K  PL  +G   +DYKD++ L  F+S RGKI   R++ ++ ++QR++A A+
Sbjct: 11 FRMEQTRRPKKNPLKAEGIETVDYKDVKTLRLFISDRGKIRSRRVTGLTPQQQRQVATAV 70

Query: 70 KRARYLGLIAYV 81
          K AR + L+ + 
Sbjct: 71 KNAREMALLPFT 82


>gi|145221901|ref|YP_001132579.1| ribosomal protein S18 [Mycobacterium gilvum PYR-GCK]
 gi|145214387|gb|ABP43791.1| SSU ribosomal protein S18P [Mycobacterium gilvum PYR-GCK]
          Length = 63

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 37/58 (63%)

Query: 23 LSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
           +  G  R+DYKD   L +FLS+RGKI    ++ ++ ++QR++  A+K AR + L+ Y
Sbjct: 2  FAQLGIERVDYKDTSTLRQFLSERGKIRSRTVTGLTVQQQRQVTIAVKNAREMALLPY 59


>gi|255011271|ref|ZP_05283397.1| 30S ribosomal protein S18 [Bacteroides fragilis 3_1_12]
 gi|313149083|ref|ZP_07811276.1| 30S ribosomal protein S18 [Bacteroides fragilis 3_1_12]
 gi|313137850|gb|EFR55210.1| 30S ribosomal protein S18 [Bacteroides fragilis 3_1_12]
          Length = 90

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 40/56 (71%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR+L L+ +V 
Sbjct: 31 GIRYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRIAQAVKRARHLALLPFVT 86


>gi|254417640|ref|ZP_05031374.1| ribosomal protein S18 [Microcoleus chthonoplastes PCC 7420]
 gi|196175558|gb|EDX70588.1| ribosomal protein S18 [Microcoleus chthonoplastes PCC 7420]
          Length = 71

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            R++  P+  K    IDYKD+ LL +F+++RGKI+P RI+ ++ ++QR L ++IKRAR 
Sbjct: 3  YFRKRLSPI--KPGEPIDYKDVELLRKFITERGKILPRRITGLTSQQQRALTRSIKRARL 60

Query: 75 LGLIAYVN 82
          L L+ +VN
Sbjct: 61 LALLPFVN 68


>gi|313836466|gb|EFS74180.1| ribosomal protein S18 [Propionibacterium acnes HL037PA2]
 gi|314928921|gb|EFS92752.1| ribosomal protein S18 [Propionibacterium acnes HL044PA1]
 gi|314971088|gb|EFT15186.1| ribosomal protein S18 [Propionibacterium acnes HL037PA3]
 gi|328906632|gb|EGG26407.1| 30S ribosomal protein S18 [Propionibacterium sp. P08]
          Length = 79

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 45/72 (62%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +R   +++K  P+       +DYKD  LL +F+S+RGKI   R++ +S + QR++A AIK
Sbjct: 5  QRKTVNKKKVVPIKTVHIGAVDYKDTALLRKFISERGKIRARRVTGLSVQDQRKVAIAIK 64

Query: 71 RARYLGLIAYVN 82
           AR L L+ Y +
Sbjct: 65 NARELALLPYAS 76


>gi|195536238|ref|ZP_03079245.1| ribosomal protein S18 [Francisella tularensis subsp. novicida
          FTE]
 gi|208779341|ref|ZP_03246687.1| ribosomal protein S18 [Francisella novicida FTG]
 gi|194372715|gb|EDX27426.1| ribosomal protein S18 [Francisella tularensis subsp. novicida
          FTE]
 gi|208745141|gb|EDZ91439.1| ribosomal protein S18 [Francisella novicida FTG]
          Length = 59

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/55 (50%), Positives = 39/55 (70%)

Query: 28 APRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
             IDYKD+  L  ++++ GKIVPSR++  S K QR+LA AIKRAR+L L+ Y +
Sbjct: 1  MKEIDYKDVNKLKAYITETGKIVPSRVTGTSAKYQRQLATAIKRARFLALLPYCD 55


>gi|282880329|ref|ZP_06289043.1| ribosomal protein S18 [Prevotella timonensis CRIS 5C-B1]
 gi|281305831|gb|EFA97877.1| ribosomal protein S18 [Prevotella timonensis CRIS 5C-B1]
          Length = 89

 Score = 85.4 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 85


>gi|313202816|ref|YP_004041473.1| SSU ribosomal protein s18p [Paludibacter propionicigenes WB4]
 gi|312442132|gb|ADQ78488.1| SSU ribosomal protein S18P [Paludibacter propionicigenes WB4]
          Length = 89

 Score = 85.4 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 41/56 (73%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P R++  S K QR++A+A+KRAR++ L+ YV 
Sbjct: 30 GIRYIDYKDPEFLKKFLNEQGKILPRRLTGTSLKFQRKVAQAVKRARHIALLPYVT 85


>gi|288801223|ref|ZP_06406678.1| ribosomal protein S18 [Prevotella sp. oral taxon 299 str. F0039]
 gi|288331834|gb|EFC70317.1| ribosomal protein S18 [Prevotella sp. oral taxon 299 str. F0039]
          Length = 89

 Score = 85.4 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKFQRRVAQAVKRARQIALLPYVT 85


>gi|19552092|ref|NP_600094.1| 30S ribosomal protein S18 [Corynebacterium glutamicum ATCC 13032]
 gi|25027496|ref|NP_737550.1| 30S ribosomal protein S18 [Corynebacterium efficiens YS-314]
 gi|62389755|ref|YP_225157.1| 30S ribosomal protein S18 [Corynebacterium glutamicum ATCC 13032]
 gi|145295036|ref|YP_001137857.1| 30S ribosomal protein S18 [Corynebacterium glutamicum R]
 gi|259507096|ref|ZP_05749996.1| 30S ribosomal protein S18 [Corynebacterium efficiens YS-314]
 gi|54039410|sp|P66456|RS18_COREF RecName: Full=30S ribosomal protein S18
 gi|54042145|sp|P66455|RS18_CORGL RecName: Full=30S ribosomal protein S18
 gi|166220949|sp|A4QCK8|RS18_CORGB RecName: Full=30S ribosomal protein S18
 gi|21323632|dbj|BAB98259.1| Ribosomal protein S18 [Corynebacterium glutamicum ATCC 13032]
 gi|23492778|dbj|BAC17750.1| putative 30S ribosomal protein S18 [Corynebacterium efficiens
          YS-314]
 gi|41325090|emb|CAF19571.1| 30S RIBOSOMAL PROTEIN S18 [Corynebacterium glutamicum ATCC 13032]
 gi|140844956|dbj|BAF53955.1| hypothetical protein [Corynebacterium glutamicum R]
 gi|259165374|gb|EEW49928.1| 30S ribosomal protein S18 [Corynebacterium efficiens YS-314]
          Length = 83

 Score = 85.4 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 47/82 (57%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M +      +R   + R K  PL   G  ++DYKDI  L +F+S R KI   R++ ++ +
Sbjct: 1  MKQRNNAKRVRLEQTRRPKKNPLKAAGIEKVDYKDINTLRQFISDRHKIRSRRVTGLTPQ 60

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
          +QRE+A A+K AR + L+ + +
Sbjct: 61 QQREVATAVKNAREMALLPFTS 82


>gi|15839432|ref|NP_334469.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis CDC1551]
 gi|31791232|ref|NP_853725.1| 30S ribosomal protein S18 [Mycobacterium bovis AF2122/97]
 gi|57116686|ref|YP_177688.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis H37Rv]
 gi|121635965|ref|YP_976188.1| 30S ribosomal protein S18 [Mycobacterium bovis BCG str. Pasteur
          1173P2]
 gi|148659815|ref|YP_001281338.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis H37Ra]
 gi|148821245|ref|YP_001285999.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis F11]
 gi|167970581|ref|ZP_02552858.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis H37Ra]
 gi|215406045|ref|ZP_03418226.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis 02_1987]
 gi|215413916|ref|ZP_03422578.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis 94_M4241A]
 gi|215425250|ref|ZP_03423169.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis T92]
 gi|215432964|ref|ZP_03430883.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis EAS054]
 gi|215448331|ref|ZP_03435083.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis T85]
 gi|218755778|ref|ZP_03534574.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis GM 1503]
 gi|219555834|ref|ZP_03534910.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis T17]
 gi|224988438|ref|YP_002643105.1| 30S ribosomal protein S18 [Mycobacterium bovis BCG str. Tokyo
          172]
 gi|253796970|ref|YP_003029971.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis KZN
          1435]
 gi|254233454|ref|ZP_04926780.1| 30S ribosomal protein S18-1 rpsR1 [Mycobacterium tuberculosis C]
 gi|254366513|ref|ZP_04982557.1| 30S ribosomal protein S18-1 rpsR1 [Mycobacterium tuberculosis
          str. Haarlem]
 gi|254548987|ref|ZP_05139434.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis '98-R604
          INH-RIF-EM']
 gi|260184911|ref|ZP_05762385.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis CPHL_A]
 gi|260199048|ref|ZP_05766539.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis T46]
 gi|260203196|ref|ZP_05770687.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis K85]
 gi|289441422|ref|ZP_06431166.1| SSU ribosomal protein S18 [Mycobacterium tuberculosis T46]
 gi|289445581|ref|ZP_06435325.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis CPHL_A]
 gi|289552304|ref|ZP_06441514.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis KZN 605]
 gi|289567941|ref|ZP_06448168.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis T17]
 gi|289572631|ref|ZP_06452858.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis K85]
 gi|289747824|ref|ZP_06507202.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis 02_1987]
 gi|289748521|ref|ZP_06507899.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis T92]
 gi|289756114|ref|ZP_06515492.1| rpsR [Mycobacterium tuberculosis EAS054]
 gi|289760153|ref|ZP_06519531.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|289764169|ref|ZP_06523547.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis GM 1503]
 gi|294995671|ref|ZP_06801362.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis 210]
 gi|297632526|ref|ZP_06950306.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis KZN 4207]
 gi|297729497|ref|ZP_06958615.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis KZN R506]
 gi|298527453|ref|ZP_07014862.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis
          94_M4241A]
 gi|306778346|ref|ZP_07416683.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu001]
 gi|306778877|ref|ZP_07417214.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu002]
 gi|306782666|ref|ZP_07420988.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu003]
 gi|306787032|ref|ZP_07425354.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu004]
 gi|306791590|ref|ZP_07429892.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu005]
 gi|306795653|ref|ZP_07433955.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu006]
 gi|306801628|ref|ZP_07438296.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu008]
 gi|306805837|ref|ZP_07442505.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu007]
 gi|306970234|ref|ZP_07482895.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu009]
 gi|306974467|ref|ZP_07487128.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu010]
 gi|307082175|ref|ZP_07491345.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu011]
 gi|313656826|ref|ZP_07813706.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis KZN V2475]
 gi|59800210|sp|P69230|RS181_MYCTU RecName: Full=30S ribosomal protein S18 1
 gi|59800211|sp|P69231|RS181_MYCBO RecName: Full=30S ribosomal protein S18 1
 gi|205556364|sp|A1KEM3|RS181_MYCBP RecName: Full=30S ribosomal protein S18 1
 gi|205556406|sp|A5TYC6|RS181_MYCTA RecName: Full=30S ribosomal protein S18 1
 gi|13879104|gb|AAK44283.1| ribosomal protein S18 [Mycobacterium tuberculosis CDC1551]
 gi|31616817|emb|CAD92918.1| PROBABLE 30S RIBOSOMAL PROTEIN S18-1 RPSR1 [Mycobacterium bovis
          AF2122/97]
 gi|41352727|emb|CAE55237.1| PROBABLE 30S RIBOSOMAL PROTEIN S18-1 RPSR1 [Mycobacterium
          tuberculosis H37Rv]
 gi|121491612|emb|CAL70070.1| Probable 30s ribosomal protein s18-1 rpsR1 [Mycobacterium bovis
          BCG str. Pasteur 1173P2]
 gi|124603247|gb|EAY61522.1| 30S ribosomal protein S18-1 rpsR1 [Mycobacterium tuberculosis C]
 gi|134152025|gb|EBA44070.1| 30S ribosomal protein S18-1 rpsR1 [Mycobacterium tuberculosis
          str. Haarlem]
 gi|148503967|gb|ABQ71776.1| 30S ribosomal protein S18 [Mycobacterium tuberculosis H37Ra]
 gi|148719772|gb|ABR04397.1| 30S ribosomal protein S18-1 rpsR1 [Mycobacterium tuberculosis
          F11]
 gi|224771551|dbj|BAH24357.1| 30S ribosomal protein S18 [Mycobacterium bovis BCG str. Tokyo
          172]
 gi|253318473|gb|ACT23076.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis KZN
          1435]
 gi|289414341|gb|EFD11581.1| SSU ribosomal protein S18 [Mycobacterium tuberculosis T46]
 gi|289418539|gb|EFD15740.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis CPHL_A]
 gi|289436936|gb|EFD19429.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis KZN 605]
 gi|289537062|gb|EFD41640.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis K85]
 gi|289541694|gb|EFD45343.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis T17]
 gi|289688352|gb|EFD55840.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis 02_1987]
 gi|289689108|gb|EFD56537.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis T92]
 gi|289696701|gb|EFD64130.1| rpsR [Mycobacterium tuberculosis EAS054]
 gi|289711675|gb|EFD75691.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis GM 1503]
 gi|289715717|gb|EFD79729.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
 gi|298497247|gb|EFI32541.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis
          94_M4241A]
 gi|308213489|gb|EFO72888.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu001]
 gi|308328206|gb|EFP17057.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu002]
 gi|308332512|gb|EFP21363.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu003]
 gi|308336324|gb|EFP25175.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu004]
 gi|308339927|gb|EFP28778.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu005]
 gi|308343943|gb|EFP32794.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu006]
 gi|308347726|gb|EFP36577.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu007]
 gi|308351643|gb|EFP40494.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu008]
 gi|308352350|gb|EFP41201.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu009]
 gi|308356250|gb|EFP45101.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu010]
 gi|308360241|gb|EFP49092.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          SUMu011]
 gi|323717394|gb|EGB26599.1| 30S ribosomal protein S18 rpsR1 [Mycobacterium tuberculosis
          CDC1551A]
 gi|326905815|gb|EGE52748.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis W-148]
 gi|328456760|gb|AEB02183.1| 30S ribosomal protein rpsR1 [Mycobacterium tuberculosis KZN 4207]
          Length = 84

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA+ +            RK C    K    IDYKD  LL  ++S+RGKI   R++    +
Sbjct: 1  MAKSSKRRPAPEKPVKTRK-CVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQ 59

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
           QR++A A+K AR + L+ + +
Sbjct: 60 HQRDIALAVKNAREVALLPFTS 81


>gi|261749385|ref|YP_003257070.1| 30S ribosomal protein S18 [Blattabacterium sp. (Periplaneta
           americana) str. BPLAN]
 gi|261497477|gb|ACX83927.1| ribosomal protein S18 [Blattabacterium sp. (Periplaneta americana)
           str. BPLAN]
          Length = 106

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 43/81 (53%)

Query: 2   AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
           +++     L+      +K C    +    IDYKD   L +FL+ +GKI+P RI+    K 
Sbjct: 22  SDLRYLSPLKIETKIEKKYCYFKQRNIKYIDYKDPIFLIKFLNAQGKILPRRITGTLQKN 81

Query: 62  QRELAKAIKRARYLGLIAYVN 82
           Q +L  AIKR R +GL+ +V 
Sbjct: 82  QNKLNAAIKRCRQIGLLPFVT 102


>gi|328886756|emb|CCA59995.1| SSU ribosomal protein S18p [Streptomyces venezuelae ATCC 10712]
          Length = 78

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 2/79 (2%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +A  P  R+    + +  PL   G   IDYKD  +L +F+S RGKI   R++ V+ ++QR
Sbjct: 1  MARRPEPRKP--TKPRPNPLDAAGITYIDYKDTDVLRKFISDRGKIRSRRVTRVTARQQR 58

Query: 64 ELAKAIKRARYLGLIAYVN 82
           LA AIK AR + L+ Y +
Sbjct: 59 RLAAAIKNAREMALLPYTS 77


>gi|293363239|ref|ZP_06610123.1| ribosomal protein S18 [Mycoplasma alligatoris A21JP2]
 gi|292553098|gb|EFF41847.1| ribosomal protein S18 [Mycoplasma alligatoris A21JP2]
          Length = 85

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 33/63 (52%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          + C         IDYKD+  L R+++  G+I P   S    K QR+++ AIKRAR +  +
Sbjct: 15 RVCEFCENSVLYIDYKDVETLKRYVNATGQIKPKANSGACAKHQRKVSTAIKRARQIAFM 74

Query: 79 AYV 81
           Y 
Sbjct: 75 PYT 77


>gi|300858072|ref|YP_003783055.1| 30S ribosomal protein S18 [Corynebacterium pseudotuberculosis
          FRC41]
 gi|300685526|gb|ADK28448.1| 30S ribosomal protein S18 [Corynebacterium pseudotuberculosis
          FRC41]
          Length = 82

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 46/80 (57%), Gaps = 3/80 (3%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
           +    + +   S R K  PL   G  ++DYKDI  L +F+S R KI   R++ ++ ++Q
Sbjct: 5  NMKKARMEQ---SRRPKKNPLKAAGIEKVDYKDINTLRQFISDRHKIRSRRVTGLTPQQQ 61

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R++A A+K AR + L+ + +
Sbjct: 62 RQVATAVKNAREMALLPFTS 81


>gi|226309316|ref|YP_002769276.1| 30S ribosomal protein S18 [Rhodococcus erythropolis PR4]
 gi|229489899|ref|ZP_04383754.1| ribosomal protein S18 [Rhodococcus erythropolis SK121]
 gi|226188433|dbj|BAH36537.1| probable 30S ribosomal protein S18 [Rhodococcus erythropolis PR4]
 gi|229323195|gb|EEN88961.1| ribosomal protein S18 [Rhodococcus erythropolis SK121]
          Length = 80

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
           P P LR  V  ++K C    +   +I+YKD  LL +++S RGKI   R++    + QR+
Sbjct: 1  MPKPPLRDKVM-KKKVCTFCKEKNTQINYKDTTLLRKYVSDRGKIRARRVTGNCVQHQRD 59

Query: 65 LAKAIKRARYLGLIAYVNL 83
          +A A+K +R + L+ Y  +
Sbjct: 60 VAIAVKNSREVALLPYATV 78


>gi|240168786|ref|ZP_04747445.1| 30S ribosomal protein S18 [Mycobacterium kansasii ATCC 12478]
          Length = 84

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA+ +            RK C    K   +IDYKD  LL  ++S+RGKI   R++    +
Sbjct: 1  MAKSSKRRPAPEKPVKARK-CVFCAKKDQKIDYKDTALLRTYISERGKIRARRVTGNCVQ 59

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
           QR++A A+K AR + L+ + +
Sbjct: 60 HQRDIATAVKNAREVALLPFTS 81


>gi|47459060|ref|YP_015922.1| 30S ribosomal protein S18 [Mycoplasma mobile 163K]
 gi|59798718|sp|Q6KI65|RS18_MYCMO RecName: Full=30S ribosomal protein S18
 gi|47458389|gb|AAT27711.1| 30S ribosomal protein s18 [Mycoplasma mobile 163K]
          Length = 84

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 43/73 (58%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           + N   + K C    +    IDYKD+ L++++++  GKI+ S+I+    K QR ++  I
Sbjct: 7  KKSNRIFKPKPCFFHVEKIKYIDYKDVELVSKYINNHGKILSSKITGNCAKHQRLISNVI 66

Query: 70 KRARYLGLIAYVN 82
          KRAR + LI +++
Sbjct: 67 KRARIMALIPFIS 79


>gi|282877913|ref|ZP_06286722.1| ribosomal protein S18 [Prevotella buccalis ATCC 35310]
 gi|281299914|gb|EFA92274.1| ribosomal protein S18 [Prevotella buccalis ATCC 35310]
          Length = 90

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 86


>gi|302553143|ref|ZP_07305485.1| ribosomal protein S18 [Streptomyces viridochromogenes DSM 40736]
 gi|302470761|gb|EFL33854.1| ribosomal protein S18 [Streptomyces viridochromogenes DSM 40736]
          Length = 77

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 44/75 (58%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P        + +  PL   G   +DYKD  LL +F+S RGKI   R++ VS ++QR+LA+
Sbjct: 2  PRKPDRTPAKNRPNPLDQAGITYVDYKDTDLLRKFVSDRGKIRSRRVTRVSSQQQRQLAR 61

Query: 68 AIKRARYLGLIAYVN 82
          AIK AR + L+ Y +
Sbjct: 62 AIKNAREMALLPYTS 76


>gi|226307893|ref|YP_002767853.1| 30S ribosomal protein S18 [Rhodococcus erythropolis PR4]
 gi|229495114|ref|ZP_04388860.1| ribosomal protein S18 [Rhodococcus erythropolis SK121]
 gi|226187010|dbj|BAH35114.1| 30S ribosomal protein S18 [Rhodococcus erythropolis PR4]
 gi|229318045|gb|EEN83920.1| ribosomal protein S18 [Rhodococcus erythropolis SK121]
          Length = 85

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 45/79 (56%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
          + +P+   R     + K  PL       +DYKDI LL  F+S RGKI   R++ ++ ++Q
Sbjct: 4  KRSPSKKPRPVEGRKPKKNPLFAAKITHVDYKDINLLRTFISDRGKIRSRRVTGLTPQQQ 63

Query: 63 RELAKAIKRARYLGLIAYV 81
          R++A A+K AR + L+ + 
Sbjct: 64 RQVAVAVKNAREMALLPFT 82


>gi|307566431|ref|ZP_07628866.1| 30S ribosomal protein S18 [Prevotella amnii CRIS 21A-A]
 gi|307344856|gb|EFN90258.1| 30S ribosomal protein S18 [Prevotella amnii CRIS 21A-A]
          Length = 89

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 30 GIKYIDYKDPNFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 85


>gi|40062773|gb|AAR37667.1| ribosomal protein S18 [uncultured marine bacterium 439]
          Length = 85

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 32/81 (39%), Positives = 45/81 (55%), Gaps = 2/81 (2%)

Query: 4  VAPTPLLRRNVSHRR--KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          +A   + +R        + C  +  G   IDYKD+ +L + +   GKI PSRI+  S K 
Sbjct: 1  MAKKQVTKRRKFQIPINRFCRFTKAGFKEIDYKDVDILLKNIDDSGKITPSRITGTSAKF 60

Query: 62 QRELAKAIKRARYLGLIAYVN 82
          QR+L  AIKRAR+L LI Y +
Sbjct: 61 QRQLTTAIKRARFLALIPYTD 81


>gi|227487780|ref|ZP_03918096.1| 30S ribosomal protein S18 [Corynebacterium glucuronolyticum ATCC
          51867]
 gi|227542421|ref|ZP_03972470.1| 30S ribosomal protein S18 [Corynebacterium glucuronolyticum ATCC
          51866]
 gi|227092282|gb|EEI27594.1| 30S ribosomal protein S18 [Corynebacterium glucuronolyticum ATCC
          51867]
 gi|227181619|gb|EEI62591.1| 30S ribosomal protein S18 [Corynebacterium glucuronolyticum ATCC
          51866]
          Length = 82

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 46/81 (56%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
           +       R   S R K  PL   G  ++DYKD+  L +F+S RGKI   R++ ++ ++
Sbjct: 1  MKRNNAKRARIEQSRRPKKNPLKAAGIEKVDYKDLNTLRQFISDRGKIRSRRVTGLTPRQ 60

Query: 62 QRELAKAIKRARYLGLIAYVN 82
          QR++A A+K AR + L+ + +
Sbjct: 61 QRQVATAVKNAREMALLPFTS 81


>gi|71894545|ref|YP_278653.1| 30S ribosomal protein S18 [Mycoplasma synoviae 53]
 gi|123775422|sp|Q4A5M9|RS18_MYCS5 RecName: Full=30S ribosomal protein S18
 gi|71851333|gb|AAZ43942.1| 30S ribosomal protein S18 [Mycoplasma synoviae 53]
          Length = 111

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 38/71 (53%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           ++   +++++C         +DYK++  L +F++  G I P   +    K QR++  A+
Sbjct: 6  RKKGYHNKKRTCHFCDNKLTYVDYKNVEDLKKFVNAVGSIKPKVATGNCAKHQRKVTLAV 65

Query: 70 KRARYLGLIAY 80
          KRAR + L+ +
Sbjct: 66 KRARLMALLPF 76


>gi|330723815|gb|AEC46185.1| 30S ribosomal protein S18 [Mycoplasma hyorhinis MCLD]
          Length = 80

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C         IDYK++ +L +F++  GKI PSRI+    K QR+++ AIKRAR + L+A
Sbjct: 13 PCHFCETQTVYIDYKNVEVLEKFVNPHGKIQPSRITGSCSKHQRQVSLAIKRARMIALMA 72

Query: 80 YV 81
          +V
Sbjct: 73 FV 74


>gi|11467346|ref|NP_043203.1| ribosomal protein S18 [Cyanophora paradoxa]
 gi|133835|sp|P15760|RR18_CYAPA RecName: Full=Cyanelle 30S ribosomal protein S18
 gi|11400|emb|CAA35533.1| S18 ribosomal protein [Cyanophora paradoxa]
 gi|1016147|gb|AAA81234.1| ribosomal protein S18 [Cyanophora paradoxa]
          Length = 71

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 29/66 (43%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR+  PL       IDY+D+ LL  F++ +GKI+P R++ ++ K+QR + KAIK+AR L 
Sbjct: 5  RRRLSPLKPNQV--IDYQDVELLRTFITDQGKILPRRVTGLTAKQQRAVTKAIKQARVLA 62

Query: 77 LIAYVN 82
          L+ +VN
Sbjct: 63 LLPFVN 68


>gi|159027933|emb|CAO87096.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 71

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 29/66 (43%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++  P+S      IDYKD  LL +F+++RGK++P RI+ ++ K+QR+L +A+KRAR + 
Sbjct: 5  RKRLSPISPSQ--PIDYKDTELLRKFITERGKLLPRRITGLTSKQQRDLTEAVKRARLMA 62

Query: 77 LIAYVN 82
          L+ +VN
Sbjct: 63 LLPFVN 68


>gi|262341104|ref|YP_003283959.1| 30S ribosomal protein S18 [Blattabacterium sp. (Blattella
          germanica) str. Bge]
 gi|262272441|gb|ACY40349.1| 30S ribosomal protein S18 [Blattabacterium sp. (Blattella
          germanica) str. Bge]
          Length = 101

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 43/81 (53%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
          +++     ++      +K C    +    IDYKD   L +FL+ +GKI+P RI+    K 
Sbjct: 17 SDLRYLSPIKIETKVEKKYCYFEQRNIKYIDYKDPIFLIKFLNAQGKILPRRITGTLQKN 76

Query: 62 QRELAKAIKRARYLGLIAYVN 82
          Q +L  AIKR R +GL+ +V 
Sbjct: 77 QNKLNAAIKRCRQIGLLPFVT 97


>gi|50843663|ref|YP_056890.1| 30S ribosomal protein S18 [Propionibacterium acnes KPA171202]
 gi|282854508|ref|ZP_06263844.1| ribosomal protein S18 [Propionibacterium acnes J139]
 gi|289425919|ref|ZP_06427671.1| ribosomal protein S18 [Propionibacterium acnes SK187]
 gi|289428173|ref|ZP_06429872.1| ribosomal protein S18 [Propionibacterium acnes J165]
 gi|295131751|ref|YP_003582414.1| ribosomal protein S18 [Propionibacterium acnes SK137]
 gi|59798675|sp|Q6A5N1|RS18_PROAC RecName: Full=30S ribosomal protein S18
 gi|50841265|gb|AAT83932.1| 30S ribosomal protein S18-1 [Propionibacterium acnes KPA171202]
 gi|282582369|gb|EFB87750.1| ribosomal protein S18 [Propionibacterium acnes J139]
 gi|289153695|gb|EFD02404.1| ribosomal protein S18 [Propionibacterium acnes SK187]
 gi|289158653|gb|EFD06857.1| ribosomal protein S18 [Propionibacterium acnes J165]
 gi|291375799|gb|ADD99653.1| ribosomal protein S18 [Propionibacterium acnes SK137]
 gi|313765165|gb|EFS36529.1| ribosomal protein S18 [Propionibacterium acnes HL013PA1]
 gi|313771567|gb|EFS37533.1| ribosomal protein S18 [Propionibacterium acnes HL074PA1]
 gi|313794143|gb|EFS42163.1| ribosomal protein S18 [Propionibacterium acnes HL110PA1]
 gi|313808599|gb|EFS47059.1| ribosomal protein S18 [Propionibacterium acnes HL087PA2]
 gi|313811965|gb|EFS49679.1| ribosomal protein S18 [Propionibacterium acnes HL083PA1]
 gi|313813951|gb|EFS51665.1| ribosomal protein S18 [Propionibacterium acnes HL025PA1]
 gi|313817111|gb|EFS54825.1| ribosomal protein S18 [Propionibacterium acnes HL059PA1]
 gi|313819056|gb|EFS56770.1| ribosomal protein S18 [Propionibacterium acnes HL046PA2]
 gi|313821665|gb|EFS59379.1| ribosomal protein S18 [Propionibacterium acnes HL036PA1]
 gi|313823801|gb|EFS61515.1| ribosomal protein S18 [Propionibacterium acnes HL036PA2]
 gi|313826905|gb|EFS64619.1| ribosomal protein S18 [Propionibacterium acnes HL063PA1]
 gi|313829276|gb|EFS66990.1| ribosomal protein S18 [Propionibacterium acnes HL063PA2]
 gi|313832398|gb|EFS70112.1| ribosomal protein S18 [Propionibacterium acnes HL007PA1]
 gi|313834169|gb|EFS71883.1| ribosomal protein S18 [Propionibacterium acnes HL056PA1]
 gi|313839203|gb|EFS76917.1| ribosomal protein S18 [Propionibacterium acnes HL086PA1]
 gi|314916830|gb|EFS80661.1| ribosomal protein S18 [Propionibacterium acnes HL005PA4]
 gi|314919007|gb|EFS82838.1| ribosomal protein S18 [Propionibacterium acnes HL050PA1]
 gi|314921162|gb|EFS84993.1| ribosomal protein S18 [Propionibacterium acnes HL050PA3]
 gi|314921990|gb|EFS85821.1| ribosomal protein S18 [Propionibacterium acnes HL001PA1]
 gi|314926141|gb|EFS89972.1| ribosomal protein S18 [Propionibacterium acnes HL036PA3]
 gi|314932491|gb|EFS96322.1| ribosomal protein S18 [Propionibacterium acnes HL067PA1]
 gi|314956280|gb|EFT00652.1| ribosomal protein S18 [Propionibacterium acnes HL027PA1]
 gi|314958674|gb|EFT02776.1| ribosomal protein S18 [Propionibacterium acnes HL002PA1]
 gi|314960980|gb|EFT05081.1| ribosomal protein S18 [Propionibacterium acnes HL002PA2]
 gi|314965947|gb|EFT10046.1| ribosomal protein S18 [Propionibacterium acnes HL082PA2]
 gi|314968804|gb|EFT12902.1| ribosomal protein S18 [Propionibacterium acnes HL037PA1]
 gi|314975064|gb|EFT19159.1| ribosomal protein S18 [Propionibacterium acnes HL053PA1]
 gi|314977475|gb|EFT21570.1| ribosomal protein S18 [Propionibacterium acnes HL045PA1]
 gi|314979063|gb|EFT23157.1| ribosomal protein S18 [Propionibacterium acnes HL072PA2]
 gi|314980730|gb|EFT24824.1| ribosomal protein S18 [Propionibacterium acnes HL110PA3]
 gi|314985853|gb|EFT29945.1| ribosomal protein S18 [Propionibacterium acnes HL005PA1]
 gi|314985957|gb|EFT30049.1| ribosomal protein S18 [Propionibacterium acnes HL005PA2]
 gi|314989266|gb|EFT33357.1| ribosomal protein S18 [Propionibacterium acnes HL005PA3]
 gi|315078286|gb|EFT50325.1| ribosomal protein S18 [Propionibacterium acnes HL053PA2]
 gi|315081408|gb|EFT53384.1| ribosomal protein S18 [Propionibacterium acnes HL078PA1]
 gi|315084952|gb|EFT56928.1| ribosomal protein S18 [Propionibacterium acnes HL027PA2]
 gi|315087482|gb|EFT59458.1| ribosomal protein S18 [Propionibacterium acnes HL002PA3]
 gi|315089610|gb|EFT61586.1| ribosomal protein S18 [Propionibacterium acnes HL072PA1]
 gi|315090951|gb|EFT62927.1| ribosomal protein S18 [Propionibacterium acnes HL110PA4]
 gi|315095174|gb|EFT67150.1| ribosomal protein S18 [Propionibacterium acnes HL060PA1]
 gi|315096895|gb|EFT68871.1| ribosomal protein S18 [Propionibacterium acnes HL038PA1]
 gi|315100045|gb|EFT72021.1| ribosomal protein S18 [Propionibacterium acnes HL059PA2]
 gi|315102795|gb|EFT74771.1| ribosomal protein S18 [Propionibacterium acnes HL046PA1]
 gi|315105293|gb|EFT77269.1| ribosomal protein S18 [Propionibacterium acnes HL050PA2]
 gi|315107349|gb|EFT79325.1| ribosomal protein S18 [Propionibacterium acnes HL030PA1]
 gi|315110503|gb|EFT82479.1| ribosomal protein S18 [Propionibacterium acnes HL030PA2]
 gi|327328803|gb|EGE70563.1| ribosomal protein S18 [Propionibacterium acnes HL103PA1]
 gi|327332994|gb|EGE74726.1| ribosomal protein S18 [Propionibacterium acnes HL096PA2]
 gi|327333986|gb|EGE75701.1| ribosomal protein S18 [Propionibacterium acnes HL096PA3]
 gi|327334405|gb|EGE76116.1| ribosomal protein S18 [Propionibacterium acnes HL097PA1]
 gi|327448702|gb|EGE95356.1| ribosomal protein S18 [Propionibacterium acnes HL043PA1]
 gi|327449106|gb|EGE95760.1| ribosomal protein S18 [Propionibacterium acnes HL043PA2]
 gi|327450359|gb|EGE97013.1| ribosomal protein S18 [Propionibacterium acnes HL013PA2]
 gi|327455518|gb|EGF02173.1| ribosomal protein S18 [Propionibacterium acnes HL087PA3]
 gi|327456173|gb|EGF02828.1| ribosomal protein S18 [Propionibacterium acnes HL083PA2]
 gi|327457576|gb|EGF04231.1| ribosomal protein S18 [Propionibacterium acnes HL092PA1]
 gi|328756818|gb|EGF70434.1| ribosomal protein S18 [Propionibacterium acnes HL087PA1]
 gi|328757706|gb|EGF71322.1| ribosomal protein S18 [Propionibacterium acnes HL020PA1]
 gi|328759101|gb|EGF72717.1| ribosomal protein S18 [Propionibacterium acnes HL025PA2]
 gi|328762210|gb|EGF75706.1| ribosomal protein S18 [Propionibacterium acnes HL099PA1]
 gi|332676615|gb|AEE73431.1| 30S ribosomal protein S18 [Propionibacterium acnes 266]
          Length = 79

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/72 (38%), Positives = 45/72 (62%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +R   +++K  P+       +DYKD  LL +F+S+RGKI   R++ +S + QR++A AIK
Sbjct: 5  QRKSVNKKKVVPIKTVHIGAVDYKDTALLRKFISERGKIRARRVTGLSVQDQRKVAIAIK 64

Query: 71 RARYLGLIAYVN 82
           AR L L+ Y +
Sbjct: 65 NARELALLPYAS 76


>gi|325282628|ref|YP_004255169.1| 30S ribosomal protein S18 [Deinococcus proteolyticus MRP]
 gi|324314437|gb|ADY25552.1| 30S ribosomal protein S18 [Deinococcus proteolyticus MRP]
          Length = 88

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 1  MAEVAPTPLLRRNVSHRR-KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSH 59
          M +    P  +     R+ K  P S       DYKD+++L RF+S  GKI+P R + +S 
Sbjct: 1  MTKPDRKPRGKGPKRPRKPKVDPFSIGELEITDYKDVKMLRRFVSDTGKILPRRRTGLSA 60

Query: 60 KKQRELAKAIKRARYLGLIAYV 81
          K QR +++ IK AR + L+ Y 
Sbjct: 61 KHQRRISQTIKVARQMALLPYT 82


>gi|256381019|ref|YP_003104679.1| 30S ribosomal protein S18 [Actinosynnema mirum DSM 43827]
 gi|255925322|gb|ACU40833.1| ribosomal protein S18 [Actinosynnema mirum DSM 43827]
          Length = 79

 Score = 84.7 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 21 CPLSGKGA-PRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
          C          IDYKD  LL +++S RGKI   R++    + QR++A A+K AR + L+ 
Sbjct: 14 CAFCKDKNANLIDYKDTTLLRKYISDRGKIRARRVTGNCSQHQRDVAVAVKNAREMALLP 73

Query: 80 YVN 82
          Y +
Sbjct: 74 YTS 76


>gi|325270188|ref|ZP_08136795.1| 30S ribosomal protein S18 [Prevotella multiformis DSM 16608]
 gi|324987489|gb|EGC19465.1| 30S ribosomal protein S18 [Prevotella multiformis DSM 16608]
          Length = 89

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+AIKRAR + L+ YV 
Sbjct: 30 GIKYIDYKDGEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAIKRARQIALLPYVT 85


>gi|325971036|ref|YP_004247227.1| 30S ribosomal protein S18 [Spirochaeta sp. Buddy]
 gi|324026274|gb|ADY13033.1| 30S ribosomal protein S18 [Spirochaeta sp. Buddy]
          Length = 96

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R  + R+K C    +     DYK+  +L R++++RGKI+P+RI+    K QR +   IK+
Sbjct: 26 RKPAFRKKVCKFCTQNLTP-DYKNPEMLRRYITERGKILPARITGCCAKHQRAVTNEIKK 84

Query: 72 ARYLGLIAY 80
          AR L  + +
Sbjct: 85 ARVLAYLPF 93


>gi|15828448|ref|NP_302711.1| 30S ribosomal protein S18 [Mycobacterium leprae TN]
 gi|221230925|ref|YP_002504341.1| 30S ribosomal protein S18 [Mycobacterium leprae Br4923]
 gi|6226084|sp|O53125|RS18_MYCLE RecName: Full=30S ribosomal protein S18
 gi|254812949|sp|B8ZTL5|RS18_MYCLB RecName: Full=30S ribosomal protein S18
 gi|2959410|emb|CAA17952.1| 30s ribosomal protein s18 [Mycobacterium leprae]
 gi|13093878|emb|CAC32215.1| 30S ribosomal protein S18 [Mycobacterium leprae]
 gi|219934032|emb|CAR72783.1| 30S ribosomal protein S18 [Mycobacterium leprae Br4923]
          Length = 84

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 7  TPLLRRNVSHRR---KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
              RR    +    + C    K   +IDYKD  LL  ++S+RGKI   R++    + QR
Sbjct: 3  KSTKRRPAPEKPAKARKCVFCAKKNQQIDYKDTTLLRTYISERGKIRARRVTGNCVQHQR 62

Query: 64 ELAKAIKRARYLGLIAYVN 82
          ++A A+K AR + L+ + +
Sbjct: 63 DIAIAVKNAREVALLPFTS 81


>gi|224117578|ref|XP_002331671.1| predicted protein [Populus trichocarpa]
 gi|222874090|gb|EEF11221.1| predicted protein [Populus trichocarpa]
          Length = 264

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 7   TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
            P +RR    R + C  + +   + D++++R L  F++  G I+  R + +S K QR++A
Sbjct: 155 KPFVRR--ERRDEFCVTTAEVLSKADFRNVRFLANFITDAGIIIKRRQTGISAKAQRKVA 212

Query: 67  KAIKRARYLGLIAYVNL 83
           + IK AR  GL+ +  +
Sbjct: 213 REIKTARAFGLMPFTTM 229


>gi|282901219|ref|ZP_06309148.1| Ribosomal protein S18 [Cylindrospermopsis raciborskii CS-505]
 gi|281193919|gb|EFA68887.1| Ribosomal protein S18 [Cylindrospermopsis raciborskii CS-505]
          Length = 71

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RR+  P+  K    IDYKD+ LL +F+++RGKI+P RI+ ++ ++QR+L  AIKRAR L 
Sbjct: 5  RRRLSPI--KPGEPIDYKDVELLRKFMTERGKILPRRITGLTSQQQRQLTLAIKRARILA 62

Query: 77 LIAYVN 82
          ++ ++N
Sbjct: 63 MLPFIN 68


>gi|281420810|ref|ZP_06251809.1| ribosomal protein S18 [Prevotella copri DSM 18205]
 gi|281405102|gb|EFB35782.1| ribosomal protein S18 [Prevotella copri DSM 18205]
          Length = 89

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 30 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 85


>gi|262204542|ref|YP_003275750.1| 30S ribosomal protein S18 [Gordonia bronchialis DSM 43247]
 gi|262087889|gb|ACY23857.1| ribosomal protein S18 [Gordonia bronchialis DSM 43247]
          Length = 85

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 43/82 (52%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA+   +   R     + K+C         IDYKD  LL RFLS RGKI   R++    +
Sbjct: 1  MAKAKASRKPRVEKVTKTKACSFCKDKKAVIDYKDTALLRRFLSDRGKIRSRRVTGNCVQ 60

Query: 61 KQRELAKAIKRARYLGLIAYVN 82
           QR++A A+K +R + L+ + +
Sbjct: 61 HQRDVAVAVKNSREVALLPFTS 82


>gi|319442737|ref|ZP_07991893.1| 30S ribosomal protein S18 [Corynebacterium variabile DSM 44702]
          Length = 83

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 45/80 (56%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          M         R   S R K  PL  +G   +DYKD  LL +F+S RGKI   R++ ++ +
Sbjct: 1  MKARTNHKKARIEQSRRPKKNPLKAEGIETVDYKDYALLRKFISDRGKIRGRRVTGLTPQ 60

Query: 61 KQRELAKAIKRARYLGLIAY 80
          +QR++A A+K AR + L+ +
Sbjct: 61 QQRQVATAVKNAREMALLPF 80


>gi|119952915|ref|YP_945124.1| 30S ribosomal protein S18 [Borrelia turicatae 91E135]
 gi|254765411|sp|A1QYR2|RS18_BORT9 RecName: Full=30S ribosomal protein S18
 gi|119861686|gb|AAX17454.1| SSU ribosomal protein S18P [Borrelia turicatae 91E135]
          Length = 97

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 4/78 (5%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
              P  R     ++K+C          DYK+   L +F++++GKI+P RI+  S K QR
Sbjct: 21 FKKNPNFR---FFKKKTCRFCDMDRVP-DYKEFDFLKKFVTEQGKILPRRITGTSAKHQR 76

Query: 64 ELAKAIKRARYLGLIAYV 81
           LA  +K+ARY+ L+ +V
Sbjct: 77 RLALEVKKARYMALLPFV 94


>gi|256370867|ref|YP_003108691.1| ribosomal protein S18 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256007451|gb|ACU53018.1| ribosomal protein S18 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 135

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 8/86 (9%)

Query: 4  VAPTPLLRRNVSH--------RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRIS 55
          +  T   R+            ++K C    +    +DYKD+ LL RF S+R KI   R++
Sbjct: 1  MPKTATKRKRRGREAPETKRIKKKPCVFCQQHVDWVDYKDVDLLRRFTSERAKIRARRVT 60

Query: 56 SVSHKKQRELAKAIKRARYLGLIAYV 81
              + Q ++A AIK AR L L+ YV
Sbjct: 61 GNCAQHQADVANAIKVARELALLPYV 86


>gi|308189828|ref|YP_003922759.1| 30S ribosomal protein S18 [Mycoplasma fermentans JER]
 gi|319777043|ref|YP_004136694.1| 30S ribosomal protein s18 [Mycoplasma fermentans M64]
 gi|307624570|gb|ADN68875.1| 30S ribosomal protein S18 [Mycoplasma fermentans JER]
 gi|318038118|gb|ADV34317.1| 30S ribosomal protein S18 [Mycoplasma fermentans M64]
          Length = 84

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 42/70 (60%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          ++  + RR+ C    +    +DYKD+  L++F++  G+I P   +    K QR++A AIK
Sbjct: 6  KKKNNFRRRRCETCDQKLTYVDYKDVEFLSKFITATGQIKPHSATGACAKDQRKIANAIK 65

Query: 71 RARYLGLIAY 80
          RAR++ LI Y
Sbjct: 66 RARFMALIPY 75


>gi|296118271|ref|ZP_06836852.1| ribosomal protein S18 [Corynebacterium ammoniagenes DSM 20306]
 gi|295968829|gb|EFG82073.1| ribosomal protein S18 [Corynebacterium ammoniagenes DSM 20306]
          Length = 82

 Score = 84.3 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 44/73 (60%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R   + R K  PL  +G  ++DYKD + L  F+S RGKI   R++ ++ ++QR++A A+
Sbjct: 9  FRMEQTRRPKKNPLKAEGIEKVDYKDTKTLRLFISDRGKIRSRRVTGLTPQQQRQVATAV 68

Query: 70 KRARYLGLIAYVN 82
          K AR + L+ +  
Sbjct: 69 KNAREMALLPFTT 81


>gi|298243927|ref|ZP_06967734.1| ribosomal protein S18 [Ktedonobacter racemifer DSM 44963]
 gi|297556981|gb|EFH90845.1| ribosomal protein S18 [Ktedonobacter racemifer DSM 44963]
          Length = 97

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 19 KSCPLSGKGAPRIDYKDIR-LLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77
          K C         IDYKD    + R++S RGKI P R +    K QR L+ +IK+ARY+ L
Sbjct: 27 KICQFCHDHVREIDYKDASRFMKRYISDRGKIEPRRKTGTCAKHQRGLSTSIKQARYMAL 86

Query: 78 IAYV 81
          + Y 
Sbjct: 87 LPYT 90


>gi|24214377|ref|NP_711858.1| 30S ribosomal protein S18 [Leptospira interrogans serovar Lai str.
           56601]
 gi|304570496|ref|YP_002045.2| 30S ribosomal protein S18 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|24195312|gb|AAN48876.1| 30S ribosomal protein S18 [Leptospira interrogans serovar Lai str.
           56601]
          Length = 103

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 33/81 (40%), Positives = 52/81 (64%), Gaps = 3/81 (3%)

Query: 2   AEVAPTPLLRRNVSHRRKSCPLSGKG--APRIDYKDIRLLNRFLSQRGKIVPSRISSVSH 59
           AE+   P  R+   +++K C  +     A +I+YK+I LL RF++ RGKI+P RI+  S 
Sbjct: 21  AEMEGKPQ-RKQNKYKKKVCRFTADPELAKQINYKNIELLERFITNRGKIIPRRITGTSA 79

Query: 60  KKQRELAKAIKRARYLGLIAY 80
           + QR LA+ I++AR +GL+ Y
Sbjct: 80  RYQRVLAREIRKARSIGLLPY 100


>gi|116672660|ref|YP_833593.1| 30S ribosomal protein S18 [Arthrobacter sp. FB24]
 gi|119961039|ref|YP_949830.1| 30S ribosomal protein S18 [Arthrobacter aurescens TC1]
 gi|220914622|ref|YP_002489931.1| 30S ribosomal protein S18 [Arthrobacter chlorophenolicus A6]
 gi|325965247|ref|YP_004243153.1| 30S ribosomal protein S18P [Arthrobacter phenanthrenivorans
          Sphe3]
 gi|205556877|sp|A1RC68|RS18_ARTAT RecName: Full=30S ribosomal protein S18
 gi|205556887|sp|A0K2H3|RS18_ARTS2 RecName: Full=30S ribosomal protein S18
 gi|254765405|sp|B8H839|RS18_ARTCA RecName: Full=30S ribosomal protein S18
 gi|116612769|gb|ABK05493.1| SSU ribosomal protein S18P [Arthrobacter sp. FB24]
 gi|119947898|gb|ABM06809.1| ribosomal protein S18 [Arthrobacter aurescens TC1]
 gi|219861500|gb|ACL41842.1| ribosomal protein S18 [Arthrobacter chlorophenolicus A6]
 gi|323471334|gb|ADX75019.1| SSU ribosomal protein S18P [Arthrobacter phenanthrenivorans
          Sphe3]
          Length = 79

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 43/67 (64%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             + KS PL       IDYKD+ LL +F+S RGKI   R++ V+ ++QR++A+AIK AR
Sbjct: 7  RKPKPKSNPLKAADITVIDYKDVALLRKFISDRGKIRARRVTGVTVQEQRKIAQAIKNAR 66

Query: 74 YLGLIAY 80
           + L+ Y
Sbjct: 67 EVALLPY 73


>gi|203284038|ref|YP_002221778.1| 30S ribosomal protein S18 [Borrelia duttonii Ly]
 gi|203287580|ref|YP_002222595.1| 30S ribosomal protein S18 [Borrelia recurrentis A1]
 gi|229559963|sp|B5RLI7|RS18_BORDL RecName: Full=30S ribosomal protein S18
 gi|229559966|sp|B5RQU0|RS18_BORRA RecName: Full=30S ribosomal protein S18
 gi|201083481|gb|ACH93072.1| 30S ribosomal protein S18 [Borrelia duttonii Ly]
 gi|201084800|gb|ACH94374.1| 30S ribosomal protein S18 [Borrelia recurrentis A1]
          Length = 96

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 4/78 (5%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
              P  R     ++K+C          DYK+   L +F++++GKI+P RI+  S K QR
Sbjct: 21 FKKNPNFR---FFKKKTCKFCDMDRVP-DYKEFDFLKKFITEQGKILPRRITGTSAKHQR 76

Query: 64 ELAKAIKRARYLGLIAYV 81
           LA  IK+ARY+ L+ +V
Sbjct: 77 RLALEIKKARYMALLPFV 94


>gi|111114935|ref|YP_709553.1| 30S ribosomal protein S18 [Borrelia afzelii PKo]
 gi|216263818|ref|ZP_03435812.1| ribosomal protein S18 [Borrelia afzelii ACA-1]
 gi|123047064|sp|Q0SP51|RS18_BORAP RecName: Full=30S ribosomal protein S18
 gi|110890209|gb|ABH01377.1| ribosomal protein S18 [Borrelia afzelii PKo]
 gi|215979862|gb|EEC20684.1| ribosomal protein S18 [Borrelia afzelii ACA-1]
          Length = 96

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             +RKSC     G    DYK+   L +F++++GKI+P RI+  S K QR LA  IKRAR
Sbjct: 28 RFFKRKSCKFCDSGKHP-DYKEFDFLKKFITEQGKILPKRITGTSAKHQRRLALEIKRAR 86

Query: 74 YLGLIAYV 81
          Y+ L+ +V
Sbjct: 87 YMALLPFV 94


>gi|56416480|ref|YP_153554.1| 30S ribosomal protein S18 [Anaplasma marginale str. St. Maries]
 gi|81677669|sp|Q5PBN0|RS18_ANAMM RecName: Full=30S ribosomal protein S18
 gi|56387712|gb|AAV86299.1| small subunit ribosomal protein S18 [Anaplasma marginale str. St.
          Maries]
          Length = 75

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 35/72 (48%), Positives = 53/72 (73%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
          L+R    + +SCPL+      IDYK+  LL++F+S+ G+I+PSRI+SVS +KQ+ LA+A+
Sbjct: 4  LKRPYFRKSRSCPLAQCPDEDIDYKNRALLSKFVSEYGRILPSRITSVSSRKQKLLARAV 63

Query: 70 KRARYLGLIAYV 81
          KRAR+L L+ Y 
Sbjct: 64 KRARFLALLPYC 75


>gi|150020533|ref|YP_001305887.1| 30S ribosomal protein S18 [Thermosipho melanesiensis BI429]
 gi|166222253|sp|A6LKQ1|RS18_THEM4 RecName: Full=30S ribosomal protein S18
 gi|149793054|gb|ABR30502.1| ribosomal protein S18 [Thermosipho melanesiensis BI429]
          Length = 75

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/73 (36%), Positives = 43/73 (58%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          +++     + K C L       +DYKD++LL  FL+++ KI+P R++    K QR +  A
Sbjct: 1  MMKYRRKKKPKVCKLCQSKIDYVDYKDVKLLREFLTEKEKIIPRRVTGNCAKHQRMVKIA 60

Query: 69 IKRARYLGLIAYV 81
          IKRAR + L+ YV
Sbjct: 61 IKRARQMALLPYV 73


>gi|302205794|gb|ADL10136.1| 30S ribosomal protein S18 [Corynebacterium pseudotuberculosis
          C231]
 gi|308276029|gb|ADO25928.1| 30S ribosomal protein S18 [Corynebacterium pseudotuberculosis
          I19]
          Length = 77

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +    + +   S R K  PL   G  ++DYKDI  L +F+S R KI   R++ ++ ++QR
Sbjct: 1  MKKARMEQ---SRRPKKNPLKAAGIEKVDYKDINTLRQFISDRHKIRSRRVTGLTPQQQR 57

Query: 64 ELAKAIKRARYLGLIAYVN 82
          ++A A+K AR + L+ + +
Sbjct: 58 QVATAVKNAREMALLPFTS 76


>gi|118615985|ref|YP_904317.1| 30S ribosomal protein S18 [Mycobacterium ulcerans Agy99]
 gi|183980109|ref|YP_001848400.1| 30S ribosomal protein S18-1 RpsR1 [Mycobacterium marinum M]
 gi|205556387|sp|B2HIB9|RS181_MYCMM RecName: Full=30S ribosomal protein S18 1
 gi|205556430|sp|A0PKH7|RS181_MYCUA RecName: Full=30S ribosomal protein S18 1
 gi|118568095|gb|ABL02846.1| 30S ribosomal protein S18-1 RpsR1 [Mycobacterium ulcerans Agy99]
 gi|183173435|gb|ACC38545.1| 30S ribosomal protein S18-1 RpsR1 [Mycobacterium marinum M]
          Length = 84

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 7  TPLLRRNVSHRR---KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
              RR    +    + C    K    IDYKD  LL  ++S+RGKI   R++    + QR
Sbjct: 3  KSNKRRPAPEKPVKTRKCVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQHQR 62

Query: 64 ELAKAIKRARYLGLIAYVN 82
          ++A A+K AR + L+ + +
Sbjct: 63 DIALAVKNAREVALLPFTS 81


>gi|94502360|ref|ZP_01308826.1| ribosomal protein S18 [Candidatus Sulcia muelleri str. Hc
           (Homalodisca coagulata)]
 gi|161833772|ref|YP_001597968.1| 30S ribosomal subunit protein S18 [Candidatus Sulcia muelleri GWSS]
 gi|205617784|sp|A8Z621|RS18_SULMW RecName: Full=30S ribosomal protein S18
 gi|94451085|gb|EAT14044.1| ribosomal protein S18 [Candidatus Sulcia muelleri str. Hc
           (Homalodisca coagulata)]
 gi|152206262|gb|ABS30572.1| 30S ribosomal subunit protein S18 [Candidatus Sulcia muelleri GWSS]
          Length = 180

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 41/68 (60%)

Query: 15  SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
               K C         ID+K+   L +FL++RG+I+P RI+  S K Q++L +AIK+ ++
Sbjct: 109 KPENKYCFFKKNNIKYIDFKNPSFLMKFLNERGEILPRRITGTSKKFQKKLKRAIKKCKH 168

Query: 75  LGLIAYVN 82
           +GL+ Y+ 
Sbjct: 169 IGLLPYLT 176


>gi|303249180|ref|ZP_07335418.1| ribosomal protein S18 [Desulfovibrio fructosovorans JJ]
 gi|302489403|gb|EFL49352.1| ribosomal protein S18 [Desulfovibrio fructosovorans JJ]
          Length = 85

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 31/61 (50%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         +DYK   +L  F++ RGKI+  RI+    K QR L   IKRAR + L+ Y
Sbjct: 14 CRFCANKNLPVDYKRPDILKDFVTDRGKIIARRITGTCAKCQRRLTVEIKRARQMALLYY 73

Query: 81 V 81
           
Sbjct: 74 T 74


>gi|225434578|ref|XP_002279055.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 1200

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 7   TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
            P +R++   R +    + +   + D++++R L  F+++ G I+    + +S K QR++A
Sbjct: 107 KPGIRKSY-KRPEFEVTTEEVLRKADFRNVRFLAHFITEAGIIIKRSKTGISAKAQRKVA 165

Query: 67  KAIKRARYLGLIAYVNL 83
           + IK AR  GL+ +  +
Sbjct: 166 REIKTARAFGLMPFTTM 182


>gi|118486185|gb|ABK94935.1| unknown [Populus trichocarpa]
          Length = 266

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 7   TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
            P +RR    R + C  + +   + D++++R L  F++  G I+  R + +S K QR++A
Sbjct: 157 KPFVRR--ERRDEFCVTTAEVLSKADFRNVRFLANFITDAGIIIKRRQTGISAKAQRKVA 214

Query: 67  KAIKRARYLGLIAYVNL 83
           + IK AR  GL+ +  +
Sbjct: 215 REIKTARAFGLMPFTTM 231


>gi|284929339|ref|YP_003421861.1| 30S ribosomal protein S18P [cyanobacterium UCYN-A]
 gi|284809783|gb|ADB95480.1| SSU ribosomal protein S18P [cyanobacterium UCYN-A]
          Length = 71

 Score = 84.3 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 31/66 (46%), Positives = 46/66 (69%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++  P+  K    IDYKD  LL +F+++RGKI+P RI+ ++ K+QR L  A+KRAR L 
Sbjct: 5  RKRLSPIPPKQ--PIDYKDTELLRKFITERGKILPRRITGLTAKQQRALTTAVKRARILA 62

Query: 77 LIAYVN 82
          L+ +VN
Sbjct: 63 LLPFVN 68


>gi|313803266|gb|EFS44462.1| ribosomal protein S18 [Propionibacterium acnes HL110PA2]
 gi|314964040|gb|EFT08140.1| ribosomal protein S18 [Propionibacterium acnes HL082PA1]
          Length = 79

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 45/72 (62%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          +R   +++K  P+       +DYKD  LL +F+S+RGK+   R++ +S + QR++A AIK
Sbjct: 5  QRKSVNKKKVVPIKTVHIGAVDYKDTALLRKFISERGKVRARRVTGLSVQDQRKVAIAIK 64

Query: 71 RARYLGLIAYVN 82
           AR L L+ Y +
Sbjct: 65 NARELALLPYAS 76


>gi|260592153|ref|ZP_05857611.1| ribosomal protein S18 [Prevotella veroralis F0319]
 gi|288802528|ref|ZP_06407967.1| ribosomal protein S18 [Prevotella melaninogenica D18]
 gi|302346422|ref|YP_003814720.1| ribosomal protein S18 [Prevotella melaninogenica ATCC 25845]
 gi|325857451|ref|ZP_08172506.1| ribosomal protein S18 [Prevotella denticola CRIS 18C-A]
 gi|327314149|ref|YP_004329586.1| 30S ribosomal protein S18 [Prevotella denticola F0289]
 gi|260535787|gb|EEX18404.1| ribosomal protein S18 [Prevotella veroralis F0319]
 gi|288335056|gb|EFC73492.1| ribosomal protein S18 [Prevotella melaninogenica D18]
 gi|302150343|gb|ADK96604.1| ribosomal protein S18 [Prevotella melaninogenica ATCC 25845]
 gi|325483161|gb|EGC86141.1| ribosomal protein S18 [Prevotella denticola CRIS 18C-A]
 gi|326944059|gb|AEA19944.1| ribosomal protein S18 [Prevotella denticola F0289]
          Length = 89

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 30 GIKYIDYKDGEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 85


>gi|302562722|ref|ZP_07315064.1| 30S ribosomal protein S18 [Streptomyces griseoflavus Tu4000]
 gi|302480340|gb|EFL43433.1| 30S ribosomal protein S18 [Streptomyces griseoflavus Tu4000]
          Length = 78

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 45/79 (56%), Gaps = 2/79 (2%)

Query: 4  VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
          +AP    R+ +  R    PL   G   IDYK+  LL +F+S R KI    ++ V+ ++QR
Sbjct: 1  MAPRQGPRKPLKSRP--NPLDAAGITYIDYKNTDLLRKFISDRSKIRSRHVTRVTAQQQR 58

Query: 64 ELAKAIKRARYLGLIAYVN 82
          ELA AIK AR + L+ Y +
Sbjct: 59 ELATAIKNAREMALLPYSS 77


>gi|11466410|ref|NP_038414.1| ribosomal protein S18 [Mesostigma viride]
 gi|12230596|sp|Q9MUP6|RR18_MESVI RecName: Full=30S ribosomal protein S18, chloroplastic
 gi|7259553|gb|AAF43854.1|AF166114_66 ribosomal protein S18 [Mesostigma viride]
          Length = 71

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 52/68 (76%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RR++ P+  K    IDYK+I LL++F++++GKI+P R++++S K+QR + KAIK+AR+
Sbjct: 3  FSRRRTSPI--KPTDSIDYKNIDLLSQFITEQGKILPRRVNNISAKQQRAITKAIKQARF 60

Query: 75 LGLIAYVN 82
          L L+ ++N
Sbjct: 61 LTLLPFLN 68


>gi|111020419|ref|YP_703391.1| 30S ribosomal protein S18 [Rhodococcus jostii RHA1]
 gi|226362637|ref|YP_002780415.1| 30S ribosomal protein S18 [Rhodococcus opacus B4]
 gi|123340397|sp|Q0SB53|RS181_RHOSR RecName: Full=30S ribosomal protein S18 1
 gi|110819949|gb|ABG95233.1| 30S ribosomal protein S18 [Rhodococcus jostii RHA1]
 gi|226241122|dbj|BAH51470.1| 30S ribosomal protein S18 [Rhodococcus opacus B4]
          Length = 80

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
           P P LR  V  ++K C    +   +I+YKD  LL +++S RGKI   R++    + QR+
Sbjct: 1  MPKPPLRDKVM-KKKICIFCKEKNTQINYKDTTLLRKYVSDRGKIRARRVTGNCVQHQRD 59

Query: 65 LAKAIKRARYLGLIAYVNL 83
          +A A+K +R + L+ Y  +
Sbjct: 60 VAIAVKNSREVALLPYATV 78


>gi|163842243|ref|YP_001626648.1| 30S ribosomal protein S18 [Renibacterium salmoninarum ATCC 33209]
 gi|205616911|sp|A9WVL3|RS18_RENSM RecName: Full=30S ribosomal protein S18
 gi|162955719|gb|ABY25234.1| SSU ribosomal protein S18P [Renibacterium salmoninarum ATCC
          33209]
          Length = 79

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 43/67 (64%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             + KS PL       IDYKD+ LL +F+S RGKI   R++ V+ ++QR++A+AIK AR
Sbjct: 7  RKPKPKSNPLKAADITVIDYKDVALLRKFISDRGKIRARRVTGVTVQEQRKIAQAIKNAR 66

Query: 74 YLGLIAY 80
           + L+ Y
Sbjct: 67 EVALLPY 73


>gi|41406167|ref|NP_959003.1| 30S ribosomal protein S18 [Mycobacterium avium subsp.
          paratuberculosis K-10]
 gi|118466677|ref|YP_879375.1| 30S ribosomal protein S18 [Mycobacterium avium 104]
 gi|254773122|ref|ZP_05214638.1| 30S ribosomal protein S18 [Mycobacterium avium subsp. avium ATCC
          25291]
 gi|254818591|ref|ZP_05223592.1| 30S ribosomal protein S18 [Mycobacterium intracellulare ATCC
          13950]
 gi|59798951|sp|Q744X6|RS181_MYCPA RecName: Full=30S ribosomal protein S18 1
 gi|166220960|sp|A0Q8Y7|RS18_MYCA1 RecName: Full=30S ribosomal protein S18
 gi|41394515|gb|AAS02386.1| RpsR [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|118167964|gb|ABK68861.1| ribosomal protein S18 [Mycobacterium avium 104]
          Length = 84

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 7  TPLLRRNVSHRR---KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
              RR    +    + C    K    IDYKD  LL  ++S+RGKI   R++    + QR
Sbjct: 3  KSNKRRPAPEKPVKARKCVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQHQR 62

Query: 64 ELAKAIKRARYLGLIAYVN 82
          ++A A+K AR + L+ + +
Sbjct: 63 DIAIAVKNAREVALLPFTS 81


>gi|239907339|ref|YP_002954080.1| 30S ribosomal protein S18 [Desulfovibrio magneticus RS-1]
 gi|259494807|sp|C4XGN6|RS18_DESMR RecName: Full=30S ribosomal protein S18
 gi|239797205|dbj|BAH76194.1| 30S ribosomal protein S18 [Desulfovibrio magneticus RS-1]
          Length = 85

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 31/61 (50%)

Query: 21 CPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAY 80
          C         +DYK   +L  F++ RGKI+  RI+    K QR L   IKRAR + L+ Y
Sbjct: 14 CRFCANKNLPVDYKRPDILKDFITDRGKIIARRITGTCAKCQRRLTLEIKRARQMALLYY 73

Query: 81 V 81
           
Sbjct: 74 T 74


>gi|194246576|ref|YP_002004215.1| 30S ribosomal protein S18 [Candidatus Phytoplasma mali]
 gi|193806933|emb|CAP18365.1| SSU ribosomal protein S18P [Candidatus Phytoplasma mali]
          Length = 78

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 27/62 (43%), Positives = 42/62 (67%)

Query: 20 SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIA 79
           C  +     +ID+KDI LL +F++++GKI+P RI+  S   QR LA AIKRAR++ L+ 
Sbjct: 15 VCYFTDNKITKIDFKDIELLKKFITEQGKIIPKRITGTSAIWQRRLAIAIKRARHMALLP 74

Query: 80 YV 81
          ++
Sbjct: 75 FI 76


>gi|239918783|ref|YP_002958341.1| SSU ribosomal protein S18P [Micrococcus luteus NCTC 2665]
 gi|281414991|ref|ZP_06246733.1| 30S ribosomal protein S18 [Micrococcus luteus NCTC 2665]
 gi|289706693|ref|ZP_06503041.1| ribosomal protein S18 [Micrococcus luteus SK58]
 gi|259494814|sp|C5C7U9|RS18_MICLC RecName: Full=30S ribosomal protein S18
 gi|239839990|gb|ACS31787.1| SSU ribosomal protein S18P [Micrococcus luteus NCTC 2665]
 gi|289556613|gb|EFD49956.1| ribosomal protein S18 [Micrococcus luteus SK58]
          Length = 79

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 43/67 (64%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             + KS PL       IDYKD+ LL +F+S RGKI   R++ V+ ++QR++A+A+K AR
Sbjct: 7  RKPKPKSNPLKAAKITEIDYKDVALLRKFISDRGKIRARRVTGVTVQEQRKIAQAVKNAR 66

Query: 74 YLGLIAY 80
           + L+ Y
Sbjct: 67 EVALLPY 73


>gi|313891893|ref|ZP_07825495.1| ribosomal protein S18 [Dialister microaerophilus UPII 345-E]
 gi|313119668|gb|EFR42858.1| ribosomal protein S18 [Dialister microaerophilus UPII 345-E]
          Length = 77

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 41/69 (59%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          ++   R+K   + G     +DYKD+  L  F+S+RGKI+P R++    K QR +  A+KR
Sbjct: 6  KSRKPRKKISQIFGDKLDNLDYKDVATLRHFISERGKILPRRVTGACAKHQRNINLAVKR 65

Query: 72 ARYLGLIAY 80
          AR + L+ +
Sbjct: 66 ARAIALLPF 74


>gi|261880412|ref|ZP_06006839.1| 30S ribosomal protein S18 [Prevotella bergensis DSM 17361]
 gi|270332881|gb|EFA43667.1| 30S ribosomal protein S18 [Prevotella bergensis DSM 17361]
          Length = 90

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+AIKRAR + L+ YV 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAIKRARQIALLPYVT 86


>gi|172040219|ref|YP_001799933.1| 30S ribosomal protein S18 [Corynebacterium urealyticum DSM 7109]
 gi|229559980|sp|B1VFG0|RS18_CORU7 RecName: Full=30S ribosomal protein S18
 gi|171851523|emb|CAQ04499.1| 30S ribosomal protein S18 [Corynebacterium urealyticum DSM 7109]
          Length = 82

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 48/80 (60%), Gaps = 3/80 (3%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
           +    + +   S R K  PL  +G  ++DYK+  LL +F+S RGKI   R++ ++ ++Q
Sbjct: 5  NMKRARMEQ---SRRPKKNPLKAEGIEQVDYKNYALLRKFISDRGKIRSRRVTGLTPQQQ 61

Query: 63 RELAKAIKRARYLGLIAYVN 82
          RE+A AIK AR + L+ + +
Sbjct: 62 REVATAIKNAREMALLPFNS 81


>gi|227832647|ref|YP_002834354.1| 30S ribosomal protein S18 [Corynebacterium aurimucosum ATCC
          700975]
 gi|262182868|ref|ZP_06042289.1| 30S ribosomal protein S18 [Corynebacterium aurimucosum ATCC
          700975]
 gi|227453663|gb|ACP32416.1| 30S ribosomal protein S18 [Corynebacterium aurimucosum ATCC
          700975]
          Length = 84

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 46/73 (63%)

Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69
           R   + R K  PL  +G  ++DYK+I+ L  F+S RGKI   R++ ++ ++QR++A A+
Sbjct: 11 FRMEQTRRPKKNPLKAEGIEKVDYKEIKTLRLFISDRGKIRSRRVTGLTPQQQRQVATAV 70

Query: 70 KRARYLGLIAYVN 82
          K AR + L+ + +
Sbjct: 71 KNAREMALLPFTS 83


>gi|190571062|ref|YP_001975420.1| ribosomal protein S18 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
 gi|190357334|emb|CAQ54764.1| ribosomal protein S18 [Wolbachia endosymbiont of Culex
          quinquefasciatus Pel]
          Length = 91

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 43/71 (60%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R    R K CPL+      IDYK+I LL++F S  G+I+P R++ V  +KQR+L  AI R
Sbjct: 17 RTGFRRPKVCPLAASKDEDIDYKNIDLLSKFTSDYGRILPRRLTGVCARKQRKLRLAIIR 76

Query: 72 ARYLGLIAYVN 82
          AR+L L  Y  
Sbjct: 77 ARFLALAPYCT 87


>gi|148284318|ref|YP_001248408.1| 30S ribosomal protein S18 [Orientia tsutsugamushi str. Boryong]
 gi|205616184|sp|A5CCY6|RS18_ORITB RecName: Full=30S ribosomal protein S18
 gi|146739757|emb|CAM79615.1| 30S ribosomal protein S18 [Orientia tsutsugamushi str. Boryong]
          Length = 102

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 48/70 (68%), Gaps = 2/70 (2%)

Query: 14 VSHRRKSCPLSGKG--APRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
             RRK CPLS     AP I YKD  LL++F+S+ G+++P+R+++V   KQREL KAIK 
Sbjct: 30 FFRRRKGCPLSAPDGTAPIITYKDPDLLSKFISECGRVLPARVTNVCRSKQRELTKAIKI 89

Query: 72 ARYLGLIAYV 81
          AR L L+ +V
Sbjct: 90 ARELALLPFV 99


>gi|290487250|gb|ADD30009.1| ribosomal protein S18 [Nerium oleander]
          Length = 101

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 54/81 (66%), Gaps = 2/81 (2%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
           + +  P L+   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+
Sbjct: 1  MDKSKRPFLKSKRSFRRRLPPI--ESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQ 58

Query: 62 QRELAKAIKRARYLGLIAYVN 82
          QR +  AIK+AR L L+ ++N
Sbjct: 59 QRLITIAIKQARILSLLPFLN 79


>gi|302538024|ref|ZP_07290366.1| ribosomal protein S18 [Streptomyces sp. C]
 gi|302446919|gb|EFL18735.1| ribosomal protein S18 [Streptomyces sp. C]
          Length = 78

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 3/75 (4%)

Query: 9  LLRRNVSHRR---KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
          + RR    +    +  PL   G   IDYKD  LL +F+S RGKI   R++ V+ ++QR L
Sbjct: 1  MARRPSPSKPLKSRPNPLDTAGITYIDYKDTDLLRKFISDRGKIRSRRVTRVTAQQQRRL 60

Query: 66 AKAIKRARYLGLIAY 80
          A AIK AR + L+ Y
Sbjct: 61 ALAIKNAREMALLPY 75


>gi|126660661|ref|ZP_01731762.1| 30S ribosomal protein S18 [Cyanothece sp. CCY0110]
 gi|126618054|gb|EAZ88822.1| 30S ribosomal protein S18 [Cyanothece sp. CCY0110]
          Length = 71

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 31/66 (46%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++  P+  K    IDYKD  LL +F+++RGKI+P RI+ ++ K+QR L  A+KRAR+L 
Sbjct: 5  RKRLSPIPPKQ--PIDYKDTELLRKFITERGKILPRRITGLTAKQQRALTAAVKRARFLA 62

Query: 77 LIAYVN 82
          L+ +VN
Sbjct: 63 LLPFVN 68


>gi|148242324|ref|YP_001227481.1| 30S ribosomal protein S18 [Synechococcus sp. RCC307]
 gi|166222252|sp|A5GTB9|RS18_SYNR3 RecName: Full=30S ribosomal protein S18
 gi|147850634|emb|CAK28128.1| 30S ribosomal protein S18 [Synechococcus sp. RCC307]
          Length = 73

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 25/70 (35%), Positives = 47/70 (67%), Gaps = 2/70 (2%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              +++  P+  K    IDYKD  LL +F+++RGK++P R++ ++ ++QR+L  ++KRA
Sbjct: 3  PSFFKKRLSPI--KPGDPIDYKDTDLLKKFITERGKLLPRRMTGLTARQQRDLTNSVKRA 60

Query: 73 RYLGLIAYVN 82
          R + L+ +VN
Sbjct: 61 RIVALLPFVN 70


>gi|300727908|ref|ZP_07061286.1| ribosomal protein S18 [Prevotella bryantii B14]
 gi|299774750|gb|EFI71364.1| ribosomal protein S18 [Prevotella bryantii B14]
          Length = 90

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 86


>gi|225023067|ref|ZP_03712259.1| hypothetical protein CORMATOL_03115 [Corynebacterium matruchotii
          ATCC 33806]
 gi|305681805|ref|ZP_07404609.1| ribosomal protein S18 [Corynebacterium matruchotii ATCC 14266]
 gi|224944290|gb|EEG25499.1| hypothetical protein CORMATOL_03115 [Corynebacterium matruchotii
          ATCC 33806]
 gi|305658278|gb|EFM47781.1| ribosomal protein S18 [Corynebacterium matruchotii ATCC 14266]
          Length = 82

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 44/72 (61%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          R   S R K  PL   G  ++DYKDI  L +F+S R KI   R++ ++ ++QR++A A+K
Sbjct: 10 RMEQSRRPKKNPLKAAGIEKVDYKDINTLRQFISDRHKIRSRRVTGLTPQQQRQVATAVK 69

Query: 71 RARYLGLIAYVN 82
           AR + L+ + +
Sbjct: 70 NAREMALLPFTS 81


>gi|172038260|ref|YP_001804761.1| 30S ribosomal protein S18 [Cyanothece sp. ATCC 51142]
 gi|171699714|gb|ACB52695.1| 30S ribosomal protein S18 [Cyanothece sp. ATCC 51142]
          Length = 71

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 31/66 (46%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++  P+  K    IDYKD  LL +F+++RGKI+P RI+ ++ K+QR L  A+KRAR+L 
Sbjct: 5  RKRLSPIPPKQ--PIDYKDTELLRKFITERGKILPRRITGLTAKQQRALTSAVKRARFLA 62

Query: 77 LIAYVN 82
          L+ +VN
Sbjct: 63 LLPFVN 68


>gi|330813905|ref|YP_004358144.1| ribosomal protein S6 [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487000|gb|AEA81405.1| ribosomal protein S6 [Candidatus Pelagibacter sp. IMCC9063]
          Length = 93

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 40/73 (54%), Positives = 55/73 (75%)

Query: 9  LLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKA 68
          L  ++ +   KSCPLSGKGAP I+YK+I+LL +++S   KI+PSRI++VS  KQR L+K 
Sbjct: 19 LFNKSTAKPNKSCPLSGKGAPEINYKNIKLLKKYVSDTAKILPSRITNVSFGKQRALSKE 78

Query: 69 IKRARYLGLIAYV 81
          IK+AR L L+ YV
Sbjct: 79 IKKARVLALMPYV 91


>gi|290958445|ref|YP_003489627.1| 30S ribosomal protein S18 [Streptomyces scabiei 87.22]
 gi|260647971|emb|CBG71076.1| putative 30S ribosomal protein S18 [Streptomyces scabiei 87.22]
          Length = 77

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 44/75 (58%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P        + +  PL       IDYKD  LL RF+S RGKI   R++ VS ++QR+LA+
Sbjct: 2  PRKPERKPAKSRPNPLDQAKITYIDYKDTDLLRRFISDRGKIRSRRVTRVSAQQQRQLAR 61

Query: 68 AIKRARYLGLIAYVN 82
          AIK AR + L+ YV+
Sbjct: 62 AIKNAREMALLPYVS 76


>gi|189183704|ref|YP_001937489.1| 30S ribosomal protein S18 [Orientia tsutsugamushi str. Ikeda]
 gi|229560049|sp|B3CRZ8|RS18_ORITI RecName: Full=30S ribosomal protein S18
 gi|189180475|dbj|BAG40255.1| 30S ribosomal protein S18 [Orientia tsutsugamushi str. Ikeda]
          Length = 102

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 48/70 (68%), Gaps = 2/70 (2%)

Query: 14 VSHRRKSCPLSGKG--APRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
             RRK CPLS     AP I YKD  LL++F+S+ G+++P+R+++V   KQREL KAIK 
Sbjct: 30 FFRRRKGCPLSAPDGTAPIITYKDPDLLSKFISECGRVLPARVTNVCRSKQRELTKAIKI 89

Query: 72 ARYLGLIAYV 81
          AR L L+ +V
Sbjct: 90 ARELALLPFV 99


>gi|113477197|ref|YP_723258.1| 30S ribosomal protein S18 [Trichodesmium erythraeum IMS101]
 gi|122964596|sp|Q10Y89|RS18_TRIEI RecName: Full=30S ribosomal protein S18
 gi|110168245|gb|ABG52785.1| SSU ribosomal protein S18P [Trichodesmium erythraeum IMS101]
          Length = 72

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 31/66 (46%), Positives = 49/66 (74%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++  P+  K    IDYKD+ LL +++++RGKI+P RI+ ++ K+QR+L K+IKRAR + 
Sbjct: 6  RKRVSPI--KPGDPIDYKDVELLKKYITERGKIMPRRITGLTSKQQRDLTKSIKRARLVA 63

Query: 77 LIAYVN 82
          L+ YVN
Sbjct: 64 LLPYVN 69


>gi|300932564|ref|ZP_07147820.1| 30S ribosomal protein S18 [Corynebacterium resistens DSM 45100]
          Length = 82

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 46/78 (58%), Gaps = 3/78 (3%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
           +    + +   S R K  PL  +G   +DYK+  LL +F+S RGKI   R++ ++ ++Q
Sbjct: 5  NIKKARMEQ---SRRPKKNPLKAEGIETVDYKNYALLRKFISDRGKIRSRRVTGLTPQQQ 61

Query: 63 RELAKAIKRARYLGLIAY 80
          R++A A+K AR + L+ +
Sbjct: 62 RQVATAVKNAREMALLPF 79


>gi|148244753|ref|YP_001219447.1| 30S ribosomal protein S18 [Candidatus Vesicomyosocius okutanii
          HA]
 gi|205618817|sp|A5CWE0|RS18_VESOH RecName: Full=30S ribosomal protein S18
 gi|146326580|dbj|BAF61723.1| 30S ribosomal protein S18 [Candidatus Vesicomyosocius okutanii
          HA]
          Length = 84

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 32/75 (42%), Positives = 43/75 (57%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
             RR        C  +  G  +IDYKDI +L + + + GKI PSR++  S K QR+L  
Sbjct: 6  KRKRRPQIKINTFCRFTAAGVTKIDYKDIDILLKNIDESGKITPSRMTGTSAKFQRKLTT 65

Query: 68 AIKRARYLGLIAYVN 82
          AIKRAR+L LI Y +
Sbjct: 66 AIKRARFLALIPYTD 80


>gi|118470101|ref|YP_891095.1| 30S ribosomal protein S18 [Mycobacterium smegmatis str. MC2 155]
 gi|205556579|sp|A0R7F7|RS182_MYCS2 RecName: Full=30S ribosomal protein S18 2
 gi|118171388|gb|ABK72284.1| ribosomal protein S18 [Mycobacterium smegmatis str. MC2 155]
          Length = 84

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 7  TPLLRRNVSHRR---KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
              RR    +    + C    K    IDYKD  LL  ++S+RGKI   R++    + QR
Sbjct: 3  KSNKRRPAPEKPVKTRKCVFCSKKGQTIDYKDTALLRTYISERGKIRARRVTGNCVQHQR 62

Query: 64 ELAKAIKRARYLGLIAY 80
          ++A A+K AR + L+ +
Sbjct: 63 DIAVAVKNAREVALLPF 79


>gi|38233445|ref|NP_939212.1| 30S ribosomal protein S18 [Corynebacterium diphtheriae NCTC
          13129]
 gi|59798749|sp|Q6NIC9|RS18_CORDI RecName: Full=30S ribosomal protein S18
 gi|38199705|emb|CAE49364.1| 30S ribosomal protein S18-2 [Corynebacterium diphtheriae]
          Length = 82

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 46/80 (57%), Gaps = 3/80 (3%)

Query: 3  EVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQ 62
           +    + +   S R K  PL   G  ++DYKDI  L +F+S R KI   R++ ++ ++Q
Sbjct: 5  NIKKARMEQ---SRRPKKNPLKAAGIEKVDYKDINTLRQFISDRHKIRSRRVTGLTPQQQ 61

Query: 63 RELAKAIKRARYLGLIAYVN 82
          R++A A+K AR + L+ + +
Sbjct: 62 RQVATAVKNAREMALLPFTS 81


>gi|308179152|ref|YP_003918558.1| 30S ribosomal protein S18 [Arthrobacter arilaitensis Re117]
 gi|307746615|emb|CBT77587.1| 30S ribosomal protein S18 [Arthrobacter arilaitensis Re117]
          Length = 79

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/67 (44%), Positives = 42/67 (62%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             + KS PL       IDYKD  LL +F+S RGKI   R++ VS ++QR++A+AIK AR
Sbjct: 7  RKPKPKSNPLKAADITVIDYKDTALLRKFISDRGKIRARRVTGVSVQEQRKIAQAIKNAR 66

Query: 74 YLGLIAY 80
           + L+ Y
Sbjct: 67 EVALLPY 73


>gi|195952827|ref|YP_002121117.1| ribosomal protein S18 [Hydrogenobaculum sp. Y04AAS1]
 gi|195932439|gb|ACG57139.1| ribosomal protein S18 [Hydrogenobaculum sp. Y04AAS1]
          Length = 73

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             + K C    +     +YK+   L  F+S+ GKI+P R++ V  K QR+LA  IKRAR
Sbjct: 5  KMKKAKVCKFCMEKRDP-NYKNYNELREFMSEHGKILPRRMTFVCAKHQRKLANEIKRAR 63

Query: 74 YLGLIAYV 81
           L L+ YV
Sbjct: 64 QLALLPYV 71


>gi|298345837|ref|YP_003718524.1| putative 30S ribosomal protein S18 [Mobiluncus curtisii ATCC
          43063]
 gi|304390460|ref|ZP_07372413.1| 30S ribosomal protein S18 [Mobiluncus curtisii subsp. curtisii
          ATCC 35241]
 gi|315654410|ref|ZP_07907318.1| ribosomal protein S18 [Mobiluncus curtisii ATCC 51333]
 gi|315657668|ref|ZP_07910550.1| ribosomal protein S18 [Mobiluncus curtisii subsp. holmesii ATCC
          35242]
 gi|298235898|gb|ADI67030.1| possible 30S ribosomal protein S18 [Mobiluncus curtisii ATCC
          43063]
 gi|304326216|gb|EFL93461.1| 30S ribosomal protein S18 [Mobiluncus curtisii subsp. curtisii
          ATCC 35241]
 gi|315491445|gb|EFU81062.1| ribosomal protein S18 [Mobiluncus curtisii ATCC 51333]
 gi|315492140|gb|EFU81749.1| ribosomal protein S18 [Mobiluncus curtisii subsp. holmesii ATCC
          35242]
          Length = 81

 Score = 83.5 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 45/74 (60%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
            +       ++K+ PL  +    IDYKD  LL +F+S RGKI   R++ VS ++QR++A
Sbjct: 3  KQMRNNTKPIKKKTNPLKAQKVGNIDYKDTALLRKFISDRGKIRARRVTGVSVQEQRQIA 62

Query: 67 KAIKRARYLGLIAY 80
          KA+K AR + L+ Y
Sbjct: 63 KAVKNAREMALLPY 76


>gi|197294287|ref|YP_001798828.1| 30S ribosomal protein S18 [Candidatus Phytoplasma australiense]
 gi|171853614|emb|CAM11485.1| 30S ribosomal protein S18 [Candidatus Phytoplasma australiense]
          Length = 78

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/75 (44%), Positives = 49/75 (65%)

Query: 7  TPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELA 66
              R     RRK C  +     +ID+KDI LL +F+++RGKI+  RI++ S K QR+LA
Sbjct: 2  KKNKRHVFKKRRKVCYFTENKFSKIDFKDIELLKKFITERGKIISRRITNTSAKWQRQLA 61

Query: 67 KAIKRARYLGLIAYV 81
           AIKRAR++ LI+++
Sbjct: 62 VAIKRARHMALISFI 76


>gi|29831189|ref|NP_825823.1| 30S ribosomal protein S18 [Streptomyces avermitilis MA-4680]
 gi|59798959|sp|Q82EG9|RS182_STRAW RecName: Full=30S ribosomal protein S18 2
 gi|29608303|dbj|BAC72358.1| putative ribosomal protein S18 [Streptomyces avermitilis MA-4680]
          Length = 78

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/71 (43%), Positives = 44/71 (61%)

Query: 12 RNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR 71
          R V+   +  PL   G   IDYKD  LL +FLS RGKI   R++ V+ ++QR LA+A+K 
Sbjct: 7  RKVASTPRPNPLDQNGITYIDYKDTDLLRKFLSDRGKIRSRRVTRVTAQQQRLLARAVKN 66

Query: 72 ARYLGLIAYVN 82
          AR + L+ Y +
Sbjct: 67 AREMALLPYSS 77


>gi|294155691|ref|YP_003560075.1| 30S ribosomal protein S18 [Mycoplasma crocodyli MP145]
 gi|291600476|gb|ADE19972.1| 30S ribosomal protein S18 [Mycoplasma crocodyli MP145]
          Length = 85

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 35/63 (55%)

Query: 19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78
          ++C         IDYKD+  L ++++  G+I P   S    K QR++A AIKRARY+  +
Sbjct: 15 RACEFCENHVQYIDYKDVETLKKYINATGQIKPKANSGACAKHQRKIASAIKRARYIAFL 74

Query: 79 AYV 81
           Y 
Sbjct: 75 PYT 77


>gi|108802327|ref|YP_642524.1| 30S ribosomal protein S18 [Mycobacterium sp. MCS]
 gi|119871480|ref|YP_941432.1| 30S ribosomal protein S18 [Mycobacterium sp. KMS]
 gi|126438307|ref|YP_001073998.1| 30S ribosomal protein S18 [Mycobacterium sp. JLS]
 gi|123177801|sp|Q1B0W6|RS18_MYCSS RecName: Full=30S ribosomal protein S18
 gi|166220961|sp|A3Q8N0|RS18_MYCSJ RecName: Full=30S ribosomal protein S18
 gi|166220962|sp|A1UP84|RS18_MYCSK RecName: Full=30S ribosomal protein S18
 gi|108772746|gb|ABG11468.1| SSU ribosomal protein S18P [Mycobacterium sp. MCS]
 gi|119697569|gb|ABL94642.1| SSU ribosomal protein S18P [Mycobacterium sp. KMS]
 gi|126238107|gb|ABO01508.1| SSU ribosomal protein S18P [Mycobacterium sp. JLS]
          Length = 84

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 7  TPLLRRNVSHRR---KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
              RR    +    + C    K    IDYKD  LL  ++S+RGKI   R++    + QR
Sbjct: 3  KSNKRRPAPEKPVKTRKCVFCSKKGQDIDYKDTALLRTYISERGKIRARRVTGNCVQHQR 62

Query: 64 ELAKAIKRARYLGLIAY 80
          ++A A+K AR + L+ +
Sbjct: 63 DIAVAVKNAREVALLPF 79


>gi|167754091|ref|ZP_02426218.1| hypothetical protein ALIPUT_02379 [Alistipes putredinis DSM
          17216]
 gi|167658716|gb|EDS02846.1| hypothetical protein ALIPUT_02379 [Alistipes putredinis DSM
          17216]
          Length = 92

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 41/56 (73%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   +DYKD   L +FL+++GKI+P R++  S K Q+++A+A+KRAR+L ++ +V 
Sbjct: 33 GIKYVDYKDGEFLKKFLNEQGKILPRRLTGTSQKFQKKVAQAVKRARHLAILPFVT 88


>gi|291320202|ref|YP_003515463.1| 30S ribosomal protein S18 [Mycoplasma agalactiae]
 gi|290752534|emb|CBH40506.1| 30S ribosomal protein S18 [Mycoplasma agalactiae]
          Length = 107

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 1  MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60
          MA         +   + R+ C L       +DYK++  + +F+S  G+I P   +    +
Sbjct: 1  MANFKKV----KKGRNLRRKCELCETNIEYVDYKNVEFITKFISGIGQIKPHVSTGTCAR 56

Query: 61 KQRELAKAIKRARYLGLIAYV 81
           QR++A AIKRAR++ LI Y 
Sbjct: 57 HQRKVANAIKRARFMALIPYT 77


>gi|257057878|ref|YP_003135710.1| 30S ribosomal protein S18P [Saccharomonospora viridis DSM 43017]
 gi|256587750|gb|ACU98883.1| SSU ribosomal protein S18P [Saccharomonospora viridis DSM 43017]
          Length = 82

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 21 CPLSGKGA----PRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          C             IDYKD  +L +++S RGKI   R++    + QR++A A+K +R + 
Sbjct: 14 CVFCKAEKAGHPEPIDYKDTNMLRKYISDRGKIRARRVTGNCSQHQRDIAIAVKNSREMA 73

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 74 LLPYTS 79


>gi|290487240|gb|ADD30004.1| ribosomal protein S18 [Ehretia acuminata]
          Length = 101

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 54/81 (66%), Gaps = 2/81 (2%)

Query: 2  AEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKK 61
           + +  P L+   S R++  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+
Sbjct: 1  MDKSKRPFLKSKRSFRKRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQ 58

Query: 62 QRELAKAIKRARYLGLIAYVN 82
          QR +  AIK+AR L L+ ++N
Sbjct: 59 QRLITIAIKQARILSLLPFLN 79


>gi|288926386|ref|ZP_06420308.1| ribosomal protein S18 [Prevotella buccae D17]
 gi|315608713|ref|ZP_07883691.1| 30S ribosomal protein S18 [Prevotella buccae ATCC 33574]
 gi|288336839|gb|EFC75203.1| ribosomal protein S18 [Prevotella buccae D17]
 gi|315249563|gb|EFU29574.1| 30S ribosomal protein S18 [Prevotella buccae ATCC 33574]
          Length = 90

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/55 (50%), Positives = 39/55 (70%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV
Sbjct: 31 GIKYIDYKDPEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYV 85


>gi|303235604|ref|ZP_07322211.1| ribosomal protein S18 [Prevotella disiens FB035-09AN]
 gi|302484051|gb|EFL47039.1| ribosomal protein S18 [Prevotella disiens FB035-09AN]
          Length = 90

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          G   IDYKD   L +FL+++GKI+P RI+  S K QR +A+A+KRAR + L+ YV 
Sbjct: 31 GIKYIDYKDGEFLKKFLNEQGKILPRRITGTSLKYQRRVAQAVKRARQIALLPYVT 86


>gi|327403002|ref|YP_004343840.1| 30S ribosomal protein S18P [Fluviicola taffensis DSM 16823]
 gi|327318510|gb|AEA43002.1| SSU ribosomal protein S18P [Fluviicola taffensis DSM 16823]
          Length = 87

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 41/66 (62%)

Query: 16 HRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
           + K C     G   ID+KD   L R ++++GKI+P RI+  S K Q+ + KAIKRAR+L
Sbjct: 17 KKDKYCRFKKSGIKFIDFKDATFLLRLVNEQGKILPRRITGTSAKYQKRVNKAIKRARHL 76

Query: 76 GLIAYV 81
           ++ YV
Sbjct: 77 AILPYV 82


>gi|169631970|ref|YP_001705619.1| 30S ribosomal protein S18 [Mycobacterium abscessus ATCC 19977]
 gi|169243937|emb|CAM64965.1| 30S ribosomal protein S18 [Mycobacterium abscessus]
          Length = 84

 Score = 83.1 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 7  TPLLRRNVSHRR---KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQR 63
              RR    +    + C    K A  IDYKD  LL  ++S+RGKI   R++    + QR
Sbjct: 3  KTTKRRPAPEKPVKTRKCAFCTKKALNIDYKDTNLLRTYISERGKIRARRVTGNCVQHQR 62

Query: 64 ELAKAIKRARYLGLIAYVN 82
          ++A A+K AR + L+ + +
Sbjct: 63 DIAIAVKNAREVALLPFSS 81


>gi|184201983|ref|YP_001856190.1| 30S ribosomal protein S18 [Kocuria rhizophila DC2201]
 gi|205558187|sp|B2GJD6|RS18_KOCRD RecName: Full=30S ribosomal protein S18
 gi|183582213|dbj|BAG30684.1| 30S ribosomal protein S18 [Kocuria rhizophila DC2201]
          Length = 78

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 42/67 (62%)

Query: 14 VSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRAR 73
             + K  PL       IDYKD+ LL +F+S RGKI   R++ VS ++QR++A+AIK AR
Sbjct: 7  RKPKPKQNPLKAADVTEIDYKDVALLRKFISDRGKIRARRVTGVSVQEQRKIAQAIKNAR 66

Query: 74 YLGLIAY 80
           + L+ Y
Sbjct: 67 EVALLPY 73


>gi|134097357|ref|YP_001103018.1| 30S ribosomal protein S18 [Saccharopolyspora erythraea NRRL 2338]
 gi|291009084|ref|ZP_06567057.1| 30S ribosomal protein S18 [Saccharopolyspora erythraea NRRL 2338]
 gi|205556498|sp|A4F7R8|RS181_SACEN RecName: Full=30S ribosomal protein S18 1
 gi|133909980|emb|CAM00092.1| 30S ribosomal protein S18 [Saccharopolyspora erythraea NRRL 2338]
          Length = 81

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/70 (42%), Positives = 43/70 (61%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    R K   L   G  ++D+KD  LL RF+S RGKI   R++ ++ ++QRE+A AIK
Sbjct: 6  RRGGQRRGKPNLLQRAGVVQVDWKDTDLLRRFISDRGKIRSRRVTGLTMQEQREVATAIK 65

Query: 71 RARYLGLIAY 80
           AR + L+ Y
Sbjct: 66 NAREMALLPY 75


>gi|183221480|ref|YP_001839476.1| 30S ribosomal protein S18 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
 gi|189911567|ref|YP_001963122.1| 30S ribosomal protein S18 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Ames)']
 gi|205558218|sp|B0SB38|RS18_LEPBA RecName: Full=30S ribosomal protein S18
 gi|205558230|sp|B0SSW0|RS18_LEPBP RecName: Full=30S ribosomal protein S18
 gi|167776243|gb|ABZ94544.1| 30S Ribosomal protein S18 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Ames)']
 gi|167779902|gb|ABZ98200.1| 30S ribosomal protein S18 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
          Length = 94

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPR--IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQREL 65
             R+N  +++K C      A    +DYK + +L RF++ RGKI+P RI+    K QR L
Sbjct: 17 KFGRKNAKYKKKVCKFCADKALLAGLDYKRVDILERFVTNRGKIIPRRITGTCGKHQRAL 76

Query: 66 AKAIKRARYLGLIAY 80
          A+ I+++R +GL+ +
Sbjct: 77 AREIRKSRSIGLLPF 91


>gi|67924091|ref|ZP_00517538.1| Ribosomal protein S18 [Crocosphaera watsonii WH 8501]
 gi|67854052|gb|EAM49364.1| Ribosomal protein S18 [Crocosphaera watsonii WH 8501]
          Length = 71

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++  P+  K    I+YKD  LL +F+++RGKI+P RI+ ++ K+QR L  A+KRAR+L 
Sbjct: 5  RKRLSPIPPKQ--PINYKDTELLRKFITERGKILPRRITGLTAKQQRALTTAVKRARFLA 62

Query: 77 LIAYVN 82
          L+ +VN
Sbjct: 63 LLPFVN 68


>gi|170077198|ref|YP_001733836.1| 30S ribosomal protein S18 [Synechococcus sp. PCC 7002]
 gi|169884867|gb|ACA98580.1| ribosomal protein S18 [Synechococcus sp. PCC 7002]
          Length = 71

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          R++  P+    +  IDYKD+ LL +F+++RGKI+P RI+ ++ ++QR++  AIKRAR L 
Sbjct: 5  RKRLSPI--PPSQPIDYKDVELLRKFITERGKILPRRITGLTARQQRDVNTAIKRARMLA 62

Query: 77 LIAYVN 82
          L+ ++N
Sbjct: 63 LLPFIN 68


>gi|126331100|ref|XP_001371066.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 171

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 6   PTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQ-RGKIVPSRISSVSHKKQRE 64
           P P+         K C L G    R+DYK+++LL++F+S   G I    I+ +  KKQ+E
Sbjct: 82  PVPM-ENPYKESLKKCILCG---KRVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKE 137

Query: 65  LAKAIKRARYLGLIAYV 81
           + KAIKRA+ +G +   
Sbjct: 138 ITKAIKRAQIMGFMPVT 154


>gi|119488089|ref|ZP_01621533.1| 30S ribosomal protein S18 [Lyngbya sp. PCC 8106]
 gi|119455378|gb|EAW36517.1| 30S ribosomal protein S18 [Lyngbya sp. PCC 8106]
          Length = 71

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74
            RR+  P+       IDYK+I LL +F+++RGKI+P RI+ ++ K+QR+L KAIK+AR 
Sbjct: 3  YFRRQVSPI--DPKTPIDYKNIELLRKFVTERGKILPRRITGLTCKQQRDLTKAIKQARI 60

Query: 75 LGLIAYVN 82
          L ++ +VN
Sbjct: 61 LAMLPFVN 68


>gi|120406438|ref|YP_956267.1| 30S ribosomal protein S18 [Mycobacterium vanbaalenii PYR-1]
 gi|205556439|sp|A1TGG1|RS181_MYCVP RecName: Full=30S ribosomal protein S18 1
 gi|119959256|gb|ABM16261.1| SSU ribosomal protein S18P [Mycobacterium vanbaalenii PYR-1]
          Length = 83

 Score = 82.3 bits (203), Expect = 2e-14,   Method: C