RPSBLAST alignment for GI: 254780330 and conserved domain: PRK00391

>gnl|CDD|178997 PRK00391, rpsR, 30S ribosomal protein S18; Reviewed. Length = 79
 Score = 94.9 bits (237), Expect = 4e-21
 Identities = 37/72 (51%), Positives = 49/72 (68%)

Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70
          RR    R+K C    +    IDYKD+ LL +F+S+RGKI+P RI+  S K QR+LA AIK
Sbjct: 7  RRRFFRRKKVCRFCAEKIEYIDYKDVELLKKFISERGKILPRRITGTSAKHQRQLATAIK 66

Query: 71 RARYLGLIAYVN 82
          RAR+L L+ YV+
Sbjct: 67 RARFLALLPYVD 78