RPSBLAST alignment for GI: 254780330 and conserved domain: KOG3162

>gnl|CDD|38372 KOG3162, KOG3162, KOG3162, Mitochondrial/chloroplast ribosomal protein S18 [Translation, ribosomal structure and biogenesis]. Length = 159
 Score = 49.6 bits (118), Expect = 2e-07
 Identities = 26/68 (38%), Positives = 42/68 (61%), Gaps = 1/68 (1%)

Query: 17  RRKSCPLSGKGAP-RIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75
               C L  KG   ++ YK++ LL++F+S+ G I+P +I+ +  K QR++ +AIKRAR  
Sbjct: 65  SEPQCILCTKGVDIKLSYKNVLLLSQFVSEDGGILPRKITGLCAKNQRKIERAIKRARAA 124

Query: 76  GLIAYVNL 83
           GL+   N 
Sbjct: 125 GLMPVTNT 132