RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780330|ref|YP_003064743.1| 30S ribosomal protein S18 [Candidatus Liberibacter asiaticus str. psy62] (83 letters) >gnl|CDD|30587 COG0238, RpsR, Ribosomal protein S18 [Translation, ribosomal structure and biogenesis]. Length = 75 Score = 77.6 bits (191), Expect = 8e-16 Identities = 38/68 (55%), Positives = 47/68 (69%) Query: 11 RRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIK 70 R RRK C + +G IDYKD+ LL RF+S+RGKI+P RI+ S K QR LA+AIK Sbjct: 8 RAPFFRRRKVCRFTAEGIEEIDYKDVELLKRFISERGKILPRRITGTSAKHQRRLARAIK 67 Query: 71 RARYLGLI 78 RARYL L+ Sbjct: 68 RARYLALL 75 >gnl|CDD|144612 pfam01084, Ribosomal_S18, Ribosomal protein S18. Length = 54 Score = 75.6 bits (187), Expect = 3e-15 Identities = 31/53 (58%), Positives = 40/53 (75%) Query: 26 KGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLI 78 IDYKD+ LL RF+S+RGKI+P RI+ + K+QR+LAKAIKRAR L L+ Sbjct: 2 DKIEYIDYKDVELLRRFISERGKILPRRITGLCAKQQRKLAKAIKRARILALL 54 >gnl|CDD|177016 CHL00077, rps18, ribosomal protein S18. Length = 86 Score = 65.4 bits (160), Expect = 3e-12 Identities = 31/75 (41%), Positives = 52/75 (69%), Gaps = 2/75 (2%) Query: 8 PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67 P + S RR+ P+ + RIDYK++ LL+RF+S++GKI+ R++ ++ K+QR + K Sbjct: 7 PFRKSKRSFRRRLPPI--QSGDRIDYKNMSLLSRFISEQGKILSRRVTRLTLKQQRLITK 64 Query: 68 AIKRARYLGLIAYVN 82 AIK+AR L L+ ++N Sbjct: 65 AIKQARILSLLPFLN 79 >gnl|CDD|38372 KOG3162, KOG3162, KOG3162, Mitochondrial/chloroplast ribosomal protein S18 [Translation, ribosomal structure and biogenesis]. Length = 159 Score = 49.6 bits (118), Expect = 2e-07 Identities = 26/68 (38%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Query: 17 RRKSCPLSGKGAP-RIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYL 75 C L KG ++ YK++ LL++F+S+ G I+P +I+ + K QR++ +AIKRAR Sbjct: 65 SEPQCILCTKGVDIKLSYKNVLLLSQFVSEDGGILPRKITGLCAKNQRKIERAIKRARAA 124 Query: 76 GLIAYVNL 83 GL+ N Sbjct: 125 GLMPVTNT 132 >gnl|CDD|39224 KOG4021, KOG4021, KOG4021, Mitochondrial ribosomal protein S18b [Translation, ribosomal structure and biogenesis]. Length = 239 Score = 30.0 bits (67), Expect = 0.16 Identities = 18/72 (25%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Query: 10 LRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLS-QRGKIVPSRISSVSHKKQRELAKA 68 +R+N CP+ DY++ LL +FL+ G+ + + + K+ L A Sbjct: 100 IRKNGRFLGNPCPICRDEYLYFDYRNPGLLEQFLADHTGQPIDYLKTGLCRKQHTRLRAA 159 Query: 69 IKRARYLGLIAY 80 +++AR G + Y Sbjct: 160 LQKARDHGTLTY 171 >gnl|CDD|29457 cd02761, MopB_FmdB-FwdB, The MopB_FmdB-FwdB CD contains the molybdenum/tungsten formylmethanofuran dehydrogenases, subunit B (FmdB/FwdB), and other related proteins. Formylmethanofuran dehydrogenase catalyzes the first step in methane formation from CO2 in methanogenic archaea and some eubacteria. Members of this CD belong to the molybdopterin_binding (MopB) superfamily of proteins.. Length = 415 Score = 26.0 bits (57), Expect = 2.1 Identities = 15/60 (25%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Query: 15 SHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74 S K + + P DY+ + L R L + +VP ++ + + ELA+ +K A++ Sbjct: 179 SDTAKLADIHLQIDPGSDYELLAAL-RALLRGAGLVPDEVAGIPAETILELAERLKNAKF 237 >gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play a role in regulating mitochondrial function in neurons. Length = 309 Score = 26.1 bits (57), Expect = 2.3 Identities = 15/42 (35%), Positives = 20/42 (47%) Query: 28 APRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAI 69 APR+D + I LL +FL K S ++ H R L I Sbjct: 255 APRLDTEGIELLTKFLQYESKKRISAEEAMKHAYFRSLGTRI 296 >gnl|CDD|145922 pfam03031, NIF, NLI interacting factor-like phosphatase. This family contains a number of NLI interacting factor isoforms and also an N-terminal regions of RNA polymerase II CTC phosphatase and FCP1 serine phosphatase. This region has been identified as the minimal phosphatase domain. Length = 151 Score = 25.3 bits (56), Expect = 3.9 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 5/37 (13%) Query: 11 RRNVSHR--RKSCPLSGKGAPRIDYKDIRLLNRFLSQ 45 ++ HR R+SC L+G KD+ LL R LS+ Sbjct: 68 KKYFKHRLYRESCTLTGGNYYV---KDLSLLGRDLSR 101 >gnl|CDD|146045 pfam03219, TLC, TLC ATP/ADP transporter. Length = 491 Score = 25.3 bits (56), Expect = 3.9 Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Query: 37 RLLNRFLSQRGKIVPSRISSVSHKKQR----ELAKAIKRARYLGLIA 79 R +N+ + ++ S KK + E K + +RYL LIA Sbjct: 241 RWINKNVLTDPRLYAS-AKKKKKKKPKMSLKESFKYLLSSRYLLLIA 286 >gnl|CDD|33015 COG3202, COG3202, ATP/ADP translocase [Energy production and conversion]. Length = 509 Score = 24.8 bits (54), Expect = 5.2 Identities = 14/47 (29%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Query: 37 RLLNRFLSQRGKIVPSRISSVSHKKQR----ELAKAIKRARYLGLIA 79 R +NR + KK + E K I R++YLG IA Sbjct: 242 RYINRNVLTDPLFYLRAKKKKKKKKLKLGLIESFKMILRSKYLGAIA 288 >gnl|CDD|132871 cd07044, CofD_YvcK, Family of CofD-like proteins and proteins related to YvcK. CofD is a 2-phospho-L-lactate transferase that catalyzes the last step in the biosynthesis of coenzyme F(420)-0 (F(420) without polyglutamate) by transferring the lactyl phosphate moiety of lactyl(2)diphospho-(5')guanosine (LPPG) to 7,8-didemethyl-8-hydroxy-5-deazariboflavin ribitol (F0). F420 is a hydride carrier, important for energy metabolism of methanogenic archaea, as well as for the biosynthesis of other natural products, like tetracycline in Streptomyces. F420 and some of its precursors are also utilized as cofactors for enzymes, like DNA photolyase in Mycobacterium tuberculosis. YvcK from Bacillus subtilis is a member of a family of mostly uncharacterized proteins and has been proposed to play a role in carbon metabolism, since its function is essential for growth on intermediates of the Krebs cycle and pentose phosphate pathway. Both families appear to have a conserved phosphate binding site, but have different substrate binding residues conserved within each family. Length = 309 Score = 24.5 bits (53), Expect = 7.5 Identities = 8/27 (29%), Positives = 13/27 (48%) Query: 32 DYKDIRLLNRFLSQRGKIVPSRISSVS 58 I L++ + +G I+PS VS Sbjct: 101 FTDAIVELSKVFNIKGNILPSSDDPVS 127 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.136 0.386 Gapped Lambda K H 0.267 0.0684 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 986,251 Number of extensions: 42358 Number of successful extensions: 132 Number of sequences better than 10.0: 1 Number of HSP's gapped: 132 Number of HSP's successfully gapped: 18 Length of query: 83 Length of database: 6,263,737 Length adjustment: 53 Effective length of query: 30 Effective length of database: 5,118,460 Effective search space: 153553800 Effective search space used: 153553800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (23.5 bits)