RPSBLAST alignment of GI: 254780330 and protein with PDBid: 3bbn

>3bbn_R Ribosomal protein S18; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 103
 Score = 80.2 bits (198), Expect = 1e-16
 Identities = 28/75 (37%), Positives = 52/75 (69%), Gaps = 2/75 (2%)

Query: 8  PLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAK 67
          P ++   S RR+  P+  +   RIDY+++ L++RF+S++GKI+  R++ ++ K+QR +  
Sbjct: 7  PFIKSKRSFRRRLPPI--QSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITS 64

Query: 68 AIKRARYLGLIAYVN 82
          AIK+AR L L+ ++N
Sbjct: 65 AIKQARILSLLPFLN 79