RPSBLAST alignment of GI: 254780330 and protein with PDBid: 3ofo

>3ofo_R 30S ribosomal protein S18; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_R* 3iy8_R 2wwl_R 3ofp_R Length = 55
 Score = 81.1 bits (201), Expect = 5e-17
 Identities = 30/52 (57%), Positives = 39/52 (75%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL L+ Y +
Sbjct: 2  IDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTD 53