BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780331|ref|YP_003064744.1| 50S ribosomal protein L9 [Candidatus Liberibacter asiaticus str. psy62] (179 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780331|ref|YP_003064744.1| 50S ribosomal protein L9 [Candidatus Liberibacter asiaticus str. psy62] Length = 179 Score = 360 bits (923), Expect = e-101, Method: Compositional matrix adjust. Identities = 179/179 (100%), Positives = 179/179 (100%) Query: 1 MYDTQKNKKGKKIMEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILF 60 MYDTQKNKKGKKIMEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILF Sbjct: 1 MYDTQKNKKGKKIMEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILF 60 Query: 61 ESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGF 120 ESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGF Sbjct: 61 ESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGF 120 Query: 121 DVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARSTEEMVKQDILGEHEEEILS 179 DVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARSTEEMVKQDILGEHEEEILS Sbjct: 121 DVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARSTEEMVKQDILGEHEEEILS 179 >gi|254780772|ref|YP_003065185.1| surface antigen (D15) [Candidatus Liberibacter asiaticus str. psy62] Length = 781 Score = 28.1 bits (61), Expect = 0.094, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Query: 122 VNRGQINLKSPIKSVGIHNIMISL-HADVSTTITLNVARSTEEMVKQDI 169 VN N+K S+G N+M+ + H +S T TLN+ EE VK I Sbjct: 149 VNADVHNIKQAYASIGYLNVMVKVQHHSISPT-TLNITYVIEEGVKAKI 196 >gi|254780606|ref|YP_003065019.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 744 Score = 24.6 bits (52), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 8/77 (10%) Query: 110 DIADLLIEEGFDVNRGQINLKSPIKSVGIHNIMISLHADV---STTITLNVA-----RST 161 ++ADL++ G ++ L ++ GIH IM + V + TI N + T Sbjct: 537 EMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVT 596 Query: 162 EEMVKQDILGEHEEEIL 178 ++ + ILGEH E L Sbjct: 597 SKIDSRTILGEHGAEQL 613 >gi|254780200|ref|YP_003064613.1| ferrochelatase [Candidatus Liberibacter asiaticus str. psy62] Length = 343 Score = 23.1 bits (48), Expect = 2.8, Method: Compositional matrix adjust. Identities = 33/116 (28%), Positives = 47/116 (40%), Gaps = 16/116 (13%) Query: 22 VTNLG-PMGEVVKVKNGYARNYLLPKKKA-LRANKENKILF------ESQRSVLEAANLE 73 + NLG P G Y R +LL K+ L + + ILF + A + Sbjct: 23 LVNLGTPDGHDFFSLRRYLREFLLDKRVVELPSWQWRPILFGYILNFRPSKIKHAYAKIW 82 Query: 74 KKAKYEGI--------SKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGFD 121 AK E I + +LAK+ S+ D YG S ++I + L EEG D Sbjct: 83 NTAKNESILRTHTRDQATNLAKRLESISSIVVDWAMRYGKPSVKEIINNLREEGCD 138 >gi|255764474|ref|YP_003064854.2| glycosyl transferase group 1 [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 22.3 bits (46), Expect = 5.4, Method: Compositional matrix adjust. Identities = 8/21 (38%), Positives = 15/21 (71%) Query: 83 KDLAKKNFSLIRAAGDTGYLY 103 ++ A K+FS+++ A D G +Y Sbjct: 325 RERAVKHFSIVKEASDIGKVY 345 >gi|254780180|ref|YP_003064593.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Candidatus Liberibacter asiaticus str. psy62] Length = 360 Score = 21.9 bits (45), Expect = 7.2, Method: Compositional matrix adjust. Identities = 11/42 (26%), Positives = 22/42 (52%) Query: 128 NLKSPIKSVGIHNIMISLHADVSTTITLNVARSTEEMVKQDI 169 NL S + S+GI ++LH T + + V + + ++ +I Sbjct: 203 NLLSRLISIGIKVYFVTLHVGAGTFMPVKVEDTDDHIMHSEI 244 >gi|255764470|ref|YP_003064828.2| integral membrane protein TerC [Candidatus Liberibacter asiaticus str. psy62] Length = 523 Score = 21.6 bits (44), Expect = 8.1, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 14/25 (56%) Query: 95 AAGDTGYLYGSVSSRDIADLLIEEG 119 A G G VS+RD+ L+EEG Sbjct: 343 AQGSLDSFIGIVSARDLLRDLLEEG 367 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.312 0.131 0.345 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 109,072 Number of Sequences: 1233 Number of extensions: 4199 Number of successful extensions: 17 Number of sequences better than 100.0: 17 Number of HSP's better than 100.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 17 length of query: 179 length of database: 328,796 effective HSP length: 68 effective length of query: 111 effective length of database: 244,952 effective search space: 27189672 effective search space used: 27189672 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 35 (18.1 bits)