HHsearch alignment for GI: 254780332 and conserved domain: PRK08694

>PRK08694 consensus.
Probab=100.00  E-value=0  Score=920.39  Aligned_cols=451  Identities=37%  Similarity=0.626  Sum_probs=415.7

Q ss_pred             HHHCCCCC--CHHCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHCCHHHCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHH
Q ss_conf             55278543--0102678997899999999983297899999944296663798889999999999983998686438889
Q gi|254780332|r    9 ILSIPKED--SSQYRESPNNIEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAIHQKIFEIMGKLVHMGKTANPVTVKTF   86 (504)
Q Consensus         9 ~~~~~~~~--~~~~~~~P~n~eaE~aVLG~lL~~p~~~~~v~~~L~pedFy~~~hr~IF~ai~~L~~~g~~iD~itl~~~   86 (504)
T Consensus         4 ~~~~~~~~~~~~~l~~pP~nlEAEqaVLGaiLld~~~~~~v~~~L~pedFy~~~H~~IF~ai~~L~~~g~piD~vTv~~~   83 (468)
T PRK08694          4 YAAMPSEDREVGALSLPPHSMEAEQSVLGGLMLENPAWDRIADVVSGEDFYRHEHRLIFRSIAKLINESRPADVITVQED   83 (468)
T ss_pred             CCCCCCCCCCHHHCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHCCHHHCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHH
T ss_conf             55689986224534899988999999999998093289999964598768988899999999999977998889999999


Q ss_pred             HHCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             73179832359489999999622112223677878789999999998765567751234445315666876554444320
Q gi|254780332|r   87 LSDQDMLGELTVPQYLARLASEAVSIINTEDYGRIIYGLALRRTLITIGEEMVNAAYEASLDKSPSIQIEEAERKLFHLA  166 (504)
Q Consensus        87 L~~~~~l~~igg~~yL~~L~~~~~s~~n~~~ya~~Ike~~~~R~li~~~~~i~~~a~~~~~~~~~~~~l~~~e~~l~~i~  166 (504)
T Consensus        84 L~~~~~l~~iGG~~yL~~L~~~~ps~an~~~YA~iVke~s~~R~li~~a~~i~~~a~~~~-~~d~~~il~~ae~~l~~i~  162 (468)
T PRK08694         84 LQRNEELEAAGGFEYLITLAQNTPSAANIRRYAEIVRERSIMRQLAEVGTEIARSAYNPQ-GRDAGQLLDEAENKVFQIA  162 (468)
T ss_pred             HHHCCCHHHCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCHHHHHHHHHHHHHHHH
T ss_conf             865598032383999999986188689999999999999999999999999999730456-8999999999999999999


Q ss_pred             CCC-CCCCCCCCHHHHHHHHHHHHHHHHH--HCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHH
Q ss_conf             113-4466543013433677899999874--1123664432101377655641677267762131002769999999999
Q gi|254780332|r  167 ENG-RYDGGFHTFSDAMTVAIDMAGQAFN--RDGRLAGVSTGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIAYNV  243 (504)
Q Consensus       167 ~~~-~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~Gi~TG~~~LD~~~gGl~~G~l~Viaarpg~GKTalalniA~~~  243 (504)
T Consensus       163 ~~~~~~~~~~~~~~d~l~~~~e~ie~~~~~~~~~~~~Gi~TG~~~LD~~t~Gl~~G~LiVIaaRPsmGKTalalnia~~~  242 (468)
T PRK08694        163 ESTAKSKQGFLEMPDLLKEVVQRIDMLYSRDNPDEVTGVPTGFIDLDKKTSGLQPGDLIIVAGRPSMGKTAFSINIAEHV  242 (468)
T ss_pred             HHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             72476667742099999999999999996059998751557968898764488878479996178653789999999999


Q ss_pred             HHHCCCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCEEEECC
Q ss_conf             85101112333332124797589995852179998789999874101100012137688998999999986278078258
Q gi|254780332|r  244 ADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIISEQTEVPSSKIRRGELTRPDYEKIVACSQVMQKLPLYIDQT  323 (504)
Q Consensus       244 A~~~~~~~~~~~~~~~~~g~~Vl~fSlEMs~~el~~R~is~~s~I~~~~i~~g~l~~~e~~~i~~a~~~l~~~~l~I~d~  323 (504)
T Consensus       243 a~~--------------~~~~V~~fSLEMs~~~l~~Rlla~~s~v~~~~i~~g~l~~~e~~~~~~a~~~l~~~pl~idd~  308 (468)
T PRK08694        243 AVE--------------GKLPVAVFSMEMGGAQLVMRMLGSVGRLDQSVLKTGRLEDEHWGRLNEAVVKLSDAPVYIDET  308 (468)
T ss_pred             HHH--------------CCCCEEEECCCCCHHHHHHHHHHHHCCCCHHHCCCCCCCHHHHHHHHHHHHHHHCCCEEEECC
T ss_conf             984--------------798479977889999999999997259863211048999999999999999986299689769


Q ss_pred             CCCCHHHHHHHHHHHCCCCC--CCEEEECCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCC
Q ss_conf             99889999998864022444--7467767135325664432113788999999999999882791999771382201689
Q gi|254780332|r  324 GGISMSQLATRARRLKRQRG--LDLLIVDYIQLMTTSKKIEENRVLEITGITMALKALAKELNIPIIALSQLSRQVENRD  401 (504)
Q Consensus       324 ~~~ti~~I~~~~r~~~~~~g--i~~vvIDYLqli~~~~~~~~~r~~~i~~is~~lK~lA~e~~ipvi~lsQLnR~~e~r~  401 (504)
T Consensus       309 ~~~t~~~i~a~~r~~~~~~~~kl~~vvIDYLqLi~~~~~-~~~r~~~i~~isr~LK~lAkel~ipvi~LsQLnR~~e~R~  387 (468)
T PRK08694        309 PGLTALELRARARRLARQFNNKLGLIVIDYLQLMAGSGR-SDNRASELGEISRSLKALAKELQVPIIALSQLSRTVESRT  387 (468)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCEEEEEHHHHCCCCCC-CCCHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCC
T ss_conf             999887999999999998389873899736754168887-6559999999999999999997998999632685423379


Q ss_pred             CCCCCCCCCCCCCHHHHHCCEEEEEECHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCEEEEEEEE
Q ss_conf             99984010143242233138788972556616442333322211100000011233883899997408997259999974
Q gi|254780332|r  402 NKRPQLSDLRESGSIEQDADVVLFVIRDEYYIRNKEPTNKDDILAYTKWQEDLKRVKGIADIIIAKQRHGPTGTVTLAFQ  481 (504)
Q Consensus       402 ~krP~lsDLr~Sg~IEqdAD~v~~l~R~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~elivaKnR~G~~g~~~~~f~  481 (504)
T Consensus       388 dkrP~lsDLReSG~IEqDAD~v~~l~R~~~y~~~~~-------------------~~~~~e~ivaK~R~G~~G~v~l~f~  448 (468)
T PRK08694        388 DKRPMMSDLRESGAIEQDADLIMFMYRDEYYNQDSP-------------------MKGLAECIIGKHRNGPVGKIFLTWT  448 (468)
T ss_pred             CCCCCCCCCCCCCCHHHHCCEEEEECCHHHCCCCCC-------------------CCCEEEEEEECCCCCCCCEEEEEEE
T ss_conf             999871301255510533768999634310388988-------------------7880799997057898615999985


Q ss_pred             CCCCCEEECCCCC
Q ss_conf             6854020077446
Q gi|254780332|r  482 AEFTRFSALSDSS  494 (504)
Q Consensus       482 ~~~~~f~~~~~~~  494 (504)
T Consensus       449 ~~~~rF~~~~~~~  461 (468)
T PRK08694        449 GQFTKFDNAAYIP  461 (468)
T ss_pred             CCCCCCCCCCCCC
T ss_conf             5867450566686