>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family; InterPro: IPR004589 The ATP-dependent DNA helicase RecQ (3.6.1 from EC) is involved in genome maintenance . All homologues tested to date unwind paired DNA, translocating in a 3' to 5' direction and several have a preference for forked or 4-way DNA structures (e.g. Holliday junctions) or for G-quartet DNA. The yeast protein, Sgs1, is present in numerous foci that coincide with sites of de novo synthesis DNA, such as the replication fork, and protein levels peak during S-phase. A model has been proposed for Sgs1p action in the S-phase checkpoint response, both as a 'sensor' for damage during replication and a 'resolvase' for structures that arise at paused forks, such as the four-way 'chickenfoot' structure. The action of Sgs1p may serve to maintain the proper amount and integrity of ss DNA that is necessary for the binding of RPA (replication protein A, the eukaryotic ss DNA-binding protein)DNA pol complexes. Sgs1p would thus function by detecting (or resolving) aberrant DNA structures, and would thus contribute to the full activation of the DNA-dependent protein kinase, Mec1p and the effector kinase, Rad53p. Its ability to bind both the large subunit of RPA and the RecA-like protein Rad51p, place it in a unique position to resolve inappropriate fork structures that can occur when either the leading or lagging strand synthesis is stalled. Thus, RecQ helicases integrate checkpoint activation and checkpoint response. ; GO: 0008026 ATP-dependent helicase activity, 0006310 DNA recombination.

Probab=94.08 E-value=0.55 Score=26.96 Aligned_cols=153 Identities=22% Similarity=0.357 Sum_probs=86.3 Q ss_pred CCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCCC--HHHHHHHHH Q ss_conf 101377655641677267762131002769999999999851011123333321247975899958521--799987899 Q gi|254780332|r 205 GIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMS--SEQLATRII 282 (504) Q Consensus 205 G~~~LD~~~gGl~~G~l~Viaarpg~GKTalalniA~~~A~~~~~~~~~~~~~~~~~g~~Vl~fSlEMs--~~el~~R~i 282 (504) T Consensus 16 Q~e~I~~~L~g--~RD~~vvMp-TG~GKS-LCYQ~Pa~~----------------~~G~t~VI-sPLiSLm~DQV-~~L- 72 (497) T TIGR00614 16 QLEVINAVLEG--RRDCLVVMP-TGGGKS-LCYQLPALY----------------SDGLTLVI-SPLISLMEDQV-LQL- 72 (497) T ss_pred HHHHHHHHHCC--CCCEEEEEC-CCCCHH-HHHHHHHHH----------------CCCCEEEE-CCHHHHHHHHH-HHH- T ss_conf 89999987548--975699815-898603-676405675----------------08964997-36365689999-998- Q ss_pred HHHHHHCCCCCCCCCCCHHHHHHHHHHH-HHHHHCC-EEEECCCC-CCHH-HHHHHHHHHCCCCCCCEEEECCHHHCCCC Q ss_conf 9987410110001213768899899999-9986278-07825899-8899-99998864022444746776713532566 Q gi|254780332|r 283 SEQTEVPSSKIRRGELTRPDYEKIVACS-QVMQKLP-LYIDQTGG-ISMS-QLATRARRLKRQRGLDLLIVDYIQLMTTS 358 (504) Q Consensus 283 s~~s~I~~~~i~~g~l~~~e~~~i~~a~-~~l~~~~-l~I~d~~~-~ti~-~I~~~~r~~~~~~gi~~vvIDYLqli~~~ 358 (504) T Consensus 73 -~~~~i~A~~L~s-~~s~~~~~~v~~~~~~k~g~~kllYv--tPE~~~~~~~ll~~Le~~Y~~~~~~~iAvDEAHCiSqW 148 (497) T TIGR00614 73 -KASGIPATFLNS-SQSKEQQKEVLTDLSKKDGKLKLLYV--TPEKISKSKSLLQTLEKLYERKGITLIAVDEAHCISQW 148 (497) T ss_pred -HHCCCCEECCCC-CCCHHHHHHHHHHHHHHCCCEEEEEE--CHHHHHCCHHHHHHHHHHHHHCCCEEEEEECEEEECCC T ss_conf -744863010443-25778999999998730797589971--63465346478999999886449669998321543588 Q ss_pred CCCCCHHHHHHHHHHHHHHHHHHHH-CCCEEEEE Q ss_conf 4432113788999999999999882-79199977 Q gi|254780332|r 359 KKIEENRVLEITGITMALKALAKEL-NIPIIALS 391 (504) Q Consensus 359 ~~~~~~r~~~i~~is~~lK~lA~e~-~ipvi~ls 391 (504) T Consensus 149 GHDFR~~Y~~LG~----Lk---~~fP~vP~~ALT 175 (497) T TIGR00614 149 GHDFRPDYKALGS----LK---QKFPNVPIMALT 175 (497) T ss_pred CCCCCHHHHHHHH----HH---HHCCCCCEEEEE T ss_conf 8874079999657----88---854887436434

HHsearch alignment for GI: 254780332 and conserved domain: TIGR00614