HHsearch alignment for GI: 254780332 and conserved domain: cd03255

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=97.29  E-value=0.0057  Score=42.05  Aligned_cols=173  Identities=18%  Similarity=0.239  Sum_probs=87.7

Q ss_pred             HHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECC---CCHHHHHH---HH
Q ss_conf             3776556416772677621310027699999999998510111233333212479758999585---21799987---89
Q gi|254780332|r  208 TLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLE---MSSEQLAT---RI  281 (504)
Q Consensus       208 ~LD~~~gGl~~G~l~Viaarpg~GKTalalniA~~~A~~~~~~~~~~~~~~~~~g~~Vl~fSlE---Ms~~el~~---R~  281 (504)
T Consensus        19 al~~isl~i~~Ge~~~iiG~sGsGKTTll~~i~G-l~~p--------------~~G~I~~~g~~i~~~~~~~~~~~rr~~   83 (218)
T cd03255          19 ALKGVSLSIEKGEFVAIVGPSGSGKSTLLNILGG-LDRP--------------TSGEVRVDGTDISKLSEKELAAFRRRH   83 (218)
T ss_pred             EEECEEEEECCCCEEEEECCCCCHHHHHHHHHHC-CCCC--------------CCEEEEECCEECCCCCHHHHHHHHHCC
T ss_conf             9856289986998999999999869999999966-9999--------------964999999998879989999986504


Q ss_pred             HH-------------HHHHHCCCCCCCCCCCH-HHHHHHHHHHHHHHHCCEEEECCC-CCCHHH--HHHHHHHHCCCCCC
Q ss_conf             99-------------98741011000121376-889989999999862780782589-988999--99988640224447
Q gi|254780332|r  282 IS-------------EQTEVPSSKIRRGELTR-PDYEKIVACSQVMQKLPLYIDQTG-GISMSQ--LATRARRLKRQRGL  344 (504)
Q Consensus       282 is-------------~~s~I~~~~i~~g~l~~-~e~~~i~~a~~~l~~~~l~I~d~~-~~ti~~--I~~~~r~~~~~~gi  344 (504)
T Consensus        84 Ig~v~Q~~~L~~~ltV~eni~~~-~~~~~~~~~~~~~~v~~~l~~l~-l~~~~~~~~~~LSGG~kQRv~iAraL~--~~P  159 (218)
T cd03255          84 IGFVFQSFNLLPDLTALENVELP-LLLAGVPKKERRERAEELLERVG-LGDRLNHYPSELSGGQQQRVAIARALA--NDP  159 (218)
T ss_pred             EEEECCCCCCCCCCCHHHHHHHH-HHHCCCCHHHHHHHHHHHHHHCC-CHHHHHCCCCCCCHHHHHHHHHHHHHH--CCC
T ss_conf             78986675215564399999999-99849998999999998767679-378873887638999999999999985--599


Q ss_pred             CEEEECCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHCCEEE
Q ss_conf             46776713532566443211378899999999999988279199977138220168999984010143242233138788
Q gi|254780332|r  345 DLLIVDYIQLMTTSKKIEENRVLEITGITMALKALAKELNIPIIALSQLSRQVENRDNKRPQLSDLRESGSIEQDADVVL  424 (504)
Q Consensus       345 ~~vvIDYLqli~~~~~~~~~r~~~i~~is~~lK~lA~e~~ipvi~lsQLnR~~e~r~~krP~lsDLr~Sg~IEqdAD~v~  424 (504)
T Consensus       160 ~llllD-----EPTs~-LD~--~~~~~i~~~l~~l~~~~~~tii~itH----------------d~----~~~~~aDrv~  211 (218)
T cd03255         160 KIILAD-----EPTGN-LDS--ETGKEVMELLRELNKEAGTTIVVVTH----------------DP----ELAEYADRII  211 (218)
T ss_pred             CEEEEE-----CCCCC-CCH--HHHHHHHHHHHHHHHHCCCEEEEECC----------------CH----HHHHHCCEEE
T ss_conf             999981-----88876-899--99999999999999962989999896----------------88----9998699899


Q ss_pred             EEE
Q ss_conf             972
Q gi|254780332|r  425 FVI  427 (504)
Q Consensus       425 ~l~  427 (504)
T Consensus       212 ~m~  214 (218)
T cd03255         212 ELR  214 (218)
T ss_pred             EEE
T ss_conf             998