HHsearch alignment for GI: 254780332 and conserved domain: pfam07088

>pfam07088 GvpD GvpD gas vesicle protein. This family consists of several archaeal GvpD gas vesicle proteins. GvpD is thought to be involved in the regulation of gas vesicle formation.
Probab=97.38  E-value=0.0028  Score=44.44  Aligned_cols=72  Identities=22%  Similarity=0.206  Sum_probs=45.7

Q ss_pred             CCCCCCCCCHHHHHHH-HHHCCCCEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEE-ECCCCHH
Q ss_conf             3664432101377655-6416772677621310027699999999998510111233333212479758999-5852179
Q gi|254780332|r  198 RLAGVSTGIQTLDKQM-GGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFY-SLEMSSE  275 (504)
Q Consensus       198 ~~~Gi~TG~~~LD~~~-gGl~~G~l~Viaarpg~GKTalalniA~~~A~~~~~~~~~~~~~~~~~g~~Vl~f-SlEMs~~  275 (504)
T Consensus       236 ~ka~fstgi~dlD~IlsgG~~~GS~v~Ldlg~d~~~~~~~vl~l~ai~N------------fl~n~~~v~ivpp~~~sp~  303 (484)
T pfam07088       236 DKAEFSTGIGDLDKILSGGTNRGSVVHLDLGKDLSRDAWSVLTLPAIRN------------FLSNEMGVAVVPPREGSPG  303 (484)
T ss_pred             CCCCCCCCCCCHHHHHCCCCCCCCEEEEECCCCCCCCCEEEEHHHHHHH------------HHHCCCCEEEECCCCCCCH
T ss_conf             7540256888667761065466637999725787742023211287999------------9855783698565558821


Q ss_pred             HHHHHH
Q ss_conf             998789
Q gi|254780332|r  276 QLATRI  281 (504)
Q Consensus       276 el~~R~  281 (504)
T Consensus       304 l~~ndl  309 (484)
T pfam07088       304 LLHNDL  309 (484)
T ss_pred             HHCCCH
T ss_conf             202641