RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780333|ref|YP_003064746.1| alanine racemase [Candidatus Liberibacter asiaticus str. psy62] (370 letters) >gnl|CDD|31130 COG0787, Alr, Alanine racemase [Cell envelope biogenesis, outer membrane]. Length = 360 Score = 330 bits (847), Expect = 4e-91 Identities = 151/364 (41%), Positives = 209/364 (57%), Gaps = 13/364 (3%) Query: 8 RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67 +IDL AL++N ++ L+G A+ AVVK NAYG G ++A AL +AG F V S+EE Sbjct: 6 TAEIDLGALRHNLRALRELAGPAKLMAVVKANAYGHGAVRVAKALLDAGADGFGVASLEE 65 Query: 68 GVKLRLYTPQ-ARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125 ++LR A I VL G P +E ++ NL PV++S+ QL Sbjct: 66 AIELREAGITGAPILVLEGFFPAEELELAAAYNLTPVVNSLEQLEALKNAALKNKPLKVH 125 Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185 L++DTG NRLGL +EA+ + K L I SH ACAD+P QLERF Sbjct: 126 LKIDTGMNRLGLRPEEAVALAIDLIALKNLDLEGIFSHFACADEPEDPYTLKQLERFNLA 185 Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245 G + LA+S+G+LLGP+YHF + RPGI+LYG + + ++ V+T +ARII + Sbjct: 186 KQGLPGELSHLANSAGLLLGPDYHFDMVRPGIALYGLSPSGGLDNGLKPVMTLKARIIQV 245 Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305 R AGE V YG RD+ IAV AIGYADGYP LS G I G Sbjct: 246 RTVPAGETVGYGATFTAERDTRIAVVAIGYADGYPRALSN-----------GTPVLINGK 294 Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365 VPI+G+++MDM M D+TD ++VGD +++FG +I +D+VA A+GT NY+LL +G+R Sbjct: 295 RVPIVGRVSMDMIMVDLTDLPQVKVGDEVELFGEEITVDEVAEAAGTINYELLTLLGSRV 354 Query: 366 AKFY 369 + Y Sbjct: 355 PRVY 358 >gnl|CDD|143481 cd00430, PLPDE_III_AR, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase. This family includes predominantly bacterial alanine racemases (AR), some serine racemases (SerRac), and putative bifunctional enzymes containing N-terminal UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase (murF) and C-terminal AR domains. These proteins are fold type III PLP-dependent enzymes that play essential roles in peptidoglycan biosynthesis. AR catalyzes the interconversion between L- and D-alanine, which is an essential component of the peptidoglycan layer of bacterial cell walls. SerRac converts L-serine into its D-enantiomer (D-serine) for peptidoglycan synthesis. murF catalyzes the addition of D-Ala-D-Ala to UDPMurNAc-tripeptide, the final step in the synthesis of the cytoplasmic precursor of bacterial cell wall peptidoglycan. Members of this family contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. AR and other members of this family require dimer formation and the presence of the PLP cofactor for catalytic activity. Fungal ARs and eukaryotic serine racemases, which are fold types I and II PLP-dependent enzymes respectively, are excluded from this family. Length = 367 Score = 317 bits (814), Expect = 4e-87 Identities = 126/375 (33%), Positives = 190/375 (50%), Gaps = 24/375 (6%) Query: 8 RLKIDLTALKNNWHSMNALSG-NARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66 +IDL AL++N + L G + AVVK +AYG G ++A AL AG F V ++E Sbjct: 3 WAEIDLDALRHNLRVIRRLLGPGTKIMAVVKADAYGHGAVEVAKALEEAGADYFAVATLE 62 Query: 67 EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKL-MSCGVSHPYA 125 E ++LR A I VL G P + + + +L P +SS+ Q S G + Sbjct: 63 EALELREAGITAPILVLGGTPPEEAEEAIEYDLTPTVSSLEQAEALSAAAARLGKTLKVH 122 Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185 L++DTG RLG +EA + +L + +H A AD+P QLERF Sbjct: 123 LKIDTGMGRLGFRPEEAEELLEALKALPGLELEGVFTHFATADEPDKAYTRRQLERFLEA 182 Query: 186 ISH-----YKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTA 238 ++ LA+S+ IL P HF + RPGI+LYG + ++ ++ V++ Sbjct: 183 LAELEEAGIPPPLKHLANSAAILRFPEAHFDMVRPGIALYGLYPSPEVKSPLGLKPVMSL 242 Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298 +AR++ ++ AGE VSYG R + IA +GYADGYP LS G Sbjct: 243 KARVVQVKTVPAGEGVSYGRTYTAPRPTRIATLPVGYADGYPRALSN-----------KG 291 Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALASGTTN 354 + I+G PI+G++ MD TM D+TD ++VGD + +FG I +++A +GT N Sbjct: 292 EVLIRGKRAPIVGRVCMDQTMVDVTDIPDVKVGDEVVLFGRQGDEEITAEELAELAGTIN 351 Query: 355 YDLLVRIGTRYAKFY 369 Y++L RI R + Y Sbjct: 352 YEILCRISKRVPRIY 366 >gnl|CDD|143500 cd06827, PLPDE_III_AR_proteobact, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Proteobacterial Alanine Racemases. This subfamily is composed mainly of proteobacterial alanine racemases (EC 5.1.1.1), fold type III PLP-dependent enzymes that catalyze the interconversion between L- and D-alanine, which is an essential component of the peptidoglycan layer of bacterial cell walls. hese proteins are similar to other bacterial ARs and are fold type III PLP-dependent enzymes containing contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity. Length = 354 Score = 234 bits (600), Expect = 3e-62 Identities = 128/365 (35%), Positives = 185/365 (50%), Gaps = 25/365 (6%) Query: 7 LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66 R IDL AL++N + L+ N++ AVVK NAYG G ++A AL A F V +E Sbjct: 2 ARATIDLAALRHNLRLVRELAPNSKILAVVKANAYGHGLVRVAKAL--ADADGFAVACIE 59 Query: 67 EGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125 E + LR I +L G E + + NL V+ S QL + L +S P Sbjct: 60 EALALREAGITKPILLLEGFFSADELPLAAEYNLWTVVHSEEQLEW---LEQAALSKPLN 116 Query: 126 --LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERF 182 L++D+G +RLG S +E + + + L+ +H ACAD+P S + QL F Sbjct: 117 VWLKLDSGMHRLGFSPEEYAAAYQRLKASPNVASIVLM-THFACADEPDSPGTAKQLAIF 175 Query: 183 RTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAE 239 + G SLA+S+ IL P H RPGI LYG + DK ++ V+T Sbjct: 176 EQATAGLPG-PRSLANSAAILAWPEAHGDWVRPGIMLYGASPFADKSGADLGLKPVMTLS 234 Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299 + II +R+ AGE V YG R I V AIGY DGYP H+PS G Sbjct: 235 SEIIAVRELKAGESVGYGATWTAPRPMRIGVVAIGYGDGYP--------RHAPS---GTP 283 Query: 300 GFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359 + G P++G+++MDM D+TD +VGD ++++G + +D+VA A+GT Y+LL Sbjct: 284 VLVNGQRTPLVGRVSMDMLTVDLTDLPEAKVGDPVELWGKGLPVDEVAAAAGTIGYELLC 343 Query: 360 RIGTR 364 R+ R Sbjct: 344 RLTPR 348 >gnl|CDD|143498 cd06825, PLPDE_III_VanT, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, VanT and similar proteins. This subfamily is composed of Enterococcus gallinarum VanT and similar proteins. VanT is a membrane-bound serine racemase (EC 5.1.1.18) that is essential for vancomycin resistance in Enterococcus gallinarum. It converts L-serine into its D-enantiomer (D-serine) for peptidoglycan synthesis. The C-terminal region of this protein contains a PLP-binding TIM-barrel domain followed by beta-sandwich domain, which is homologous to the fold type III PLP-dependent enzyme, bacterial alanine racemase (AR). AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. On the basis of this similarity, it has been suggested that dimer formation of VanT is required for its catalytic activity, and that it catalyzes the racemization of serine in a mechanistically similar manner to that of alanine by bacterial AR. Some biochemical evidence indicates that VanT also exhibits alanine racemase activity and plays a role in the racemization of L-alanine. VanT contains a unique N-terminal transmembrane domain, which may function as an L-serine transporter. VanT serine racemases are not related to eukaryotic serine racemases, which are fold type II PLP-dependent enzymes. Length = 368 Score = 188 bits (479), Expect = 3e-48 Identities = 124/378 (32%), Positives = 183/378 (48%), Gaps = 31/378 (8%) Query: 9 LKIDLTALKNNWHSMN-ALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67 L+IDL+AL++N + L + AVVK NAYG G ++A L G+ F V +++E Sbjct: 4 LEIDLSALEHNVKEIKRLLPSTCKLMAVVKANAYGHGDVEVARVLEQIGIDFFAVATIDE 63 Query: 68 GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127 G++LR + I +L P + K + +L + S + +L V+ L+ Sbjct: 64 GIRLREAGIKGEILILGYTPPVRAKELKKYSLTQTLIS---EAYAEELSKYAVNIKVHLK 120 Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACAD--DPSSHV-NSVQLERFRT 184 VDTG +RLG S E +D + K ++S I SHL +D D Q+ F Sbjct: 121 VDTGMHRLGES-PEDIDSILAIYRLKNLKVSGIFSHLCVSDSLDEDDIAFTKHQIACFDQ 179 Query: 185 LISHYK--GIE---ASLASSSGILLGPNYHFQLTRPGISLYGGT----DKINKSHPMQTV 235 +++ K GIE + SS GIL P+ + RPGI LYG D ++ V Sbjct: 180 VLADLKARGIEVGKIHIQSSYGILNYPDLKYDYVRPGILLYGVLSDPNDPTKLGLDLRPV 239 Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295 ++ +A++IL+RK GE V YG +R + IA +IGYADGYP +LS Sbjct: 240 LSLKAKVILVRKVAKGEAVGYGRLFVASRTTRIATVSIGYADGYPRSLSN---------- 289 Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALASG 351 I G PI+G I MD M D+TD ++ GD + G D + D+VA + Sbjct: 290 QKAYVLINGKRAPIIGNICMDQLMVDVTDIPEVKEGDTATLIGQDGDEELSADEVARNAH 349 Query: 352 TTNYDLLVRIGTRYAKFY 369 T +LL RIG R + Y Sbjct: 350 TITNELLSRIGERVKRIY 367 >gnl|CDD|144675 pfam01168, Ala_racemase_N, Alanine racemase, N-terminal domain. Length = 216 Score = 162 bits (412), Expect = 2e-40 Identities = 76/219 (34%), Positives = 111/219 (50%), Gaps = 8/219 (3%) Query: 11 IDLTALKNNWHSMNALSG-NARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69 IDL AL++N ++ +G + AVVK NAYG G ++A AL AG F V +++E + Sbjct: 1 IDLDALRHNIRALRERAGRPVKLMAVVKANAYGHGAVRVARALA-AGADGFGVATLQEAL 59 Query: 70 KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM-SCGVSHPYALQV 128 +LR A I VL P + + + +LIP + S+ Q S G L+V Sbjct: 60 ELREAGITAPILVLGFFPPEELALAAEYDLIPTVDSLEQAEALSAAAAKLGRPLRVHLKV 119 Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188 DTG RLG + +E L +L +++H ACAD+P + N QL RFR L Sbjct: 120 DTGMGRLGFTPEELPALAEALALPGL-RLEGLMTHFACADEPDA-TNRAQLARFRELADA 177 Query: 189 YKG--IEASLASSSGILLGPNYH-FQLTRPGISLYGGTD 224 + SL +S+ +LL P + F + RPGI+LYG Sbjct: 178 LEAAGPVLSLGNSAALLLAPLHEGFDMVRPGIALYGARP 216 >gnl|CDD|144438 pfam00842, Ala_racemase_C, Alanine racemase, C-terminal domain. Length = 125 Score = 144 bits (365), Expect = 5e-35 Identities = 58/135 (42%), Positives = 79/135 (58%), Gaps = 11/135 (8%) Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294 V++ +AR++ +R AGE V YGG RD+ IA IGYADGYP LS Sbjct: 1 VMSLKARVLQVRTLPAGEGVGYGGTFTAERDTRIATVPIGYADGYPRALSN--------- 51 Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTN 354 G I G PI+G+++MD TM D+TD ++VGD + +FGP I D+VA A+GT Sbjct: 52 --RGYVLINGKRAPIVGRVSMDQTMVDVTDIPDVKVGDEVTLFGPQITADEVAEAAGTIP 109 Query: 355 YDLLVRIGTRYAKFY 369 Y+LL R+G R + Y Sbjct: 110 YELLTRLGPRVPRIY 124 >gnl|CDD|143499 cd06826, PLPDE_III_AR2, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme, Alanine Racemase 2. This subfamily is composed of bacterial alanine racemases (EC 5.1.1.1) with similarity to Yersinia pestis and Vibrio cholerae alanine racemase (AR) 2. ARs catalyze the interconversion between L- and D-alanine, an essential component of the peptidoglycan layer of bacterial cell walls. These proteins are similar to other bacterial ARs and are fold type III PLP-dependent enzymes containing contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity. Length = 365 Score = 118 bits (299), Expect = 2e-27 Identities = 100/378 (26%), Positives = 159/378 (42%), Gaps = 34/378 (8%) Query: 9 LKIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67 L+I A +NN + L GN + AV+K +AYG G + P++ + +TS EE Sbjct: 4 LEISTGAFENNIKLLKKLLGGNTKLCAVMKADAYGHGIALVMPSIIAQNIPCVGITSNEE 63 Query: 68 GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM-SCGVSHPYAL 126 +R +I + P + + N+ +I S+ Q L G + P L Sbjct: 64 ARVVREAGFTGKILRVRTATPSEIEDALAYNIEELIGSLDQAEQIDSLAKRHGKTLPVHL 123 Query: 127 QVDT-GFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQ--LERFR 183 +++ G +R GL L + +L I + P + V+ L RF Sbjct: 124 ALNSGGMSRNGLEL--STAQGKEDAVAIATLPNLKIVGI-MTHFPVEDEDDVRAKLARFN 180 Query: 184 T----LISHYK----GIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTV 235 LIS+ K I A+S L P H + RPG LYG D S + + Sbjct: 181 EDTAWLISNAKLKREKITLHAANSFATLNVPEAHLDMVRPGGILYG--DTPP-SPEYKRI 237 Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295 ++ ++R+ + G V Y LTRDSL+A +GY+DGY + S Sbjct: 238 MSFKSRVASLNTYPKGSTVGYDRTFTLTRDSLLANIPVGYSDGYRRSFSN---------- 287 Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFG----PDIKLDDVALASG 351 I G VP++GK++M+ M D+TD ++ GD + +FG +I ++ SG Sbjct: 288 -KAHVLINGQRVPVVGKVSMNTVMVDVTDIPGVKAGDEVVLFGKQGGAEITAAEIEEGSG 346 Query: 352 TTNYDLLVRIGTRYAKFY 369 T +L G + Y Sbjct: 347 TILAELYTLWGQTNPRVY 364 >gnl|CDD|144985 pfam01601, Corona_S2, Coronavirus S2 glycoprotein. The coronavirus spike glycoprotein forms the characteristic 'corona' after which the group is named. The Spike glycoprotein is translated as a large polypeptide that is subsequently cleaved to S1 pfam01600 and S2. Length = 609 Score = 27.6 bits (62), Expect = 5.1 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Query: 123 PYALQVDTGFNRLGLS---LQEALDFTHNSFNKKLGQLSL 159 P+A QV N +GL+ LQE NSFNK LG + Sbjct: 227 PFATQVQARLNYVGLTTDVLQENQKLIANSFNKALGNIQD 266 >gnl|CDD|143490 cd06815, PLPDE_III_AR_like_1, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase-like 1. This subfamily is composed of uncharacterized bacterial proteins with similarity to bacterial alanine racemases (AR), which are fold type III PLP-dependent enzymes containing an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. It catalyzes the interconversion between L- and D-alanine, which is an essential component of the peptidoglycan layer of bacterial cell walls. Members of this subfamily may act as PLP-dependent enzymes. Length = 353 Score = 27.5 bits (62), Expect = 5.9 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 5/53 (9%) Query: 8 RLKIDLTALKNNWHSMNAL--SGNARTAAVVKDNAYGLGCEKIAPALYNAGVQ 58 RL+I+L+ +++N + L S V K G +IA AL G+ Sbjct: 3 RLEINLSKIRHNAKVLVELCKSRGIEVTGVTK---VVCGDPEIAEALLEGGIT 52 >gnl|CDD|143482 cd00622, PLPDE_III_ODC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase. This subfamily is composed mainly of eukaryotic ornithine decarboxylases (ODC, EC 4.1.1.17) and ODC-like enzymes from prokaryotes represented by Vibrio vulnificus LysineOrnithine decarboxylase. These are fold type III PLP-dependent enzymes that differ from most bacterial ODCs which are fold type I PLP-dependent enzymes. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. Members of this subfamily contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity. Also members of this subfamily are proteins with homology to ODC but do not possess any catalytic activity, the Antizyme inhibitor (AZI) and ODC-paralogue (ODC-p). AZI binds to the regulatory protein Antizyme with a higher affinity than ODC and prevents ODC degradation. ODC-p is a novel ODC-like protein, present only in mammals, that is specifically exressed in the brain and testes. ODC-p may function as a tissue-specific antizyme inhibitory protein. Length = 362 Score = 27.5 bits (62), Expect = 6.5 Identities = 8/30 (26%), Positives = 15/30 (50%) Query: 53 YNAGVQDFFVTSVEEGVKLRLYTPQARIFV 82 GV+ F S +E K+ + P A++ + Sbjct: 88 AELGVRLFTFDSEDELEKIAKHAPGAKLLL 117 >gnl|CDD|48459 cd03761, proteasome_beta_type_5, proteasome beta type-5 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.. Length = 188 Score = 27.1 bits (60), Expect = 7.8 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Query: 114 KLMSCGVSHPYALQV-DTGFNRLGLSLQEALDFTHNS 149 L S G YA V D+G+ R LS++EA D + Sbjct: 124 DLFSVGSGSTYAYGVLDSGY-RYDLSVEEAYDLARRA 159 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0737 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,335,992 Number of extensions: 229515 Number of successful extensions: 540 Number of sequences better than 10.0: 1 Number of HSP's gapped: 509 Number of HSP's successfully gapped: 13 Length of query: 370 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 275 Effective length of database: 4,210,882 Effective search space: 1157992550 Effective search space used: 1157992550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 58 (26.1 bits)