HHsearch alignment for GI: 254780334 and conserved domain: PRK06995

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated.
Probab=97.87  E-value=0.00049  Score=48.99  Aligned_cols=84  Identities=21%  Similarity=0.340  Sum_probs=60.9

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHC-CC-CCEEEEECCC----CHHHHHHHHHHCCCCCCCHHEECCCCHHHHHHH
Q ss_conf             78708999549875188999999999850-39-8199998646----304788887520157751000034788999999
Q gi|254780334|r   88 VRGSVILVGGDPGIGKSTLLMQTAASLAY-KK-HRITYVSGEE----AIGQIRLRAQRLNTINSSVYIAIETNVEDIIAT  161 (479)
Q Consensus        88 ~~Gs~~Li~G~PGvGKSTL~Lqia~~~a~-~g-~~vlYvS~EE----s~~Qi~~Ra~Rl~~~~~~i~~~~e~~l~~il~~  161 (479)
T Consensus       174 ~~ggV~alVGPTGVGKTTTiAKLAAr~~l~~g~~kVaLIT~DTYRIgAvEQLktYa~IlgvPv~vv--~~~~eL~~aL~-  250 (404)
T PRK06995        174 ERGGVFALVGPTGVGKTTTTAKLAARCVMRHGASKVALLTTDSYRIGGHEQLRIYGKILGVPVHAV--KDAADLRLALA-  250 (404)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEE--CCHHHHHHHHH-
T ss_conf             147558986688876375899999999998389837999768754789999999998759559995--99999999999-


Q ss_pred             HHHCCCCCEEEECHH
Q ss_conf             973169828997216
Q gi|254780334|r  162 LITNEKPDLVIIDSI  176 (479)
Q Consensus       162 ~i~~~~~~~vVIDSI  176 (479)
T Consensus       251 --~l~~~dlILIDTa  263 (404)
T PRK06995        251 --ELRNKHIVLIDTV  263 (404)
T ss_pred             --HHCCCCEEEEECC
T ss_conf             --7089999998099