HHsearch alignment for GI: 254780334 and conserved domain: PRK07960

>PRK07960 fliI flagellum-specific ATP synthase; Validated.
Probab=97.48  E-value=0.0048  Score=41.77  Aligned_cols=107  Identities=21%  Similarity=0.222  Sum_probs=65.8

Q ss_pred             CCCCCCCCHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHC-C--CCCC
Q ss_conf             663237812488886598578708999549875188999999999850398199998646304788887520-1--5775
Q gi|254780334|r   69 ESRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRL-N--TINS  145 (479)
Q Consensus        69 ~~Ri~TGi~eLDrvLGGGl~~Gs~~Li~G~PGvGKSTL~Lqia~~~a~~g~~vlYvS~EEs~~Qi~~Ra~Rl-~--~~~~  145 (479)
T Consensus       156 ~epL~TGIraID~ll--pigrGQRigIfagsGvGKs~Ll~~iar~~-~adv~Vi~lIGERgrE-v~efi~~~l~~~~~~r  231 (455)
T PRK07960        156 EHVLDTGVRAINALL--TVGRGQRMGLFAGSGVGKSVLLGMMARYT-RADVIVVGLIGERGRE-VKDFIENILGAEGRAR  231 (455)
T ss_pred             CCCCCCCCEEEECCC--CCCCCCEEECCCCCCCCHHHHHHHHHHHH-CCCEEEEEEECEEHHH-HHHHHHHHHCCCCCCC
T ss_conf             872326844440336--71478776324899884999999998860-8985899720406289-9999999751477421


Q ss_pred             CHHEECCCC---HH---------HHHHHHHHCCCCCEEEECHHHHH
Q ss_conf             100003478---89---------99999973169828997216876
Q gi|254780334|r  146 SVYIAIETN---VE---------DIIATLITNEKPDLVIIDSIQTL  179 (479)
Q Consensus       146 ~i~~~~e~~---l~---------~il~~~i~~~~~~~vVIDSIQtl  179 (479)
T Consensus       232 svvv~atsd~~p~~r~~aa~~a~aiAEyFrd~Gk~VLl~~DslTr~  277 (455)
T PRK07960        232 SVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRY  277 (455)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHH
T ss_conf             2799842666848888789999999999985587379997364788