HHsearch alignment for GI: 254780334 and conserved domain: PRK08972

>PRK08972 fliI flagellum-specific ATP synthase; Validated.
Probab=97.03  E-value=0.024  Score=36.64  Aligned_cols=106  Identities=16%  Similarity=0.196  Sum_probs=60.6

Q ss_pred             CCCCCCCHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHH-C--CCCCCC
Q ss_conf             6323781248888659857870899954987518899999999985039819999864630478888752-0--157751
Q gi|254780334|r   70 SRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQR-L--NTINSS  146 (479)
Q Consensus        70 ~Ri~TGi~eLDrvLGGGl~~Gs~~Li~G~PGvGKSTL~Lqia~~~a~~g~~vlYvS~EEs~~Qi~~Ra~R-l--~~~~~~  146 (479)
T Consensus       142 epl~TGIkaID~l~--pigrGQRigIf~gsGvGKS~Ll~~i~r~~-~advvVi~lIGERgrE-v~efie~~l~~~~~~rs  217 (440)
T PRK08972        142 EPLDVGVRAINAML--TVGKGQRMGLFAGSGVGKSVLLGMMTRGT-TADVIVVGLVGERGRE-VKEFIEEILGEEGRARS  217 (440)
T ss_pred             CCCCCCCEEEECCC--CCCCCCEEEECCCCCCCHHHHHHHHHHCC-CCCEEEEEEECEEHHH-HHHHHHHHHCCCCCEEE
T ss_conf             61015834563436--71246466631578975899998887514-7878999862313699-99999998504774478


Q ss_pred             HHEECCCC---HH---------HHHHHHHHCCCCCEEEECHHHHH
Q ss_conf             00003478---89---------99999973169828997216876
Q gi|254780334|r  147 VYIAIETN---VE---------DIIATLITNEKPDLVIIDSIQTL  179 (479)
Q Consensus       147 i~~~~e~~---l~---------~il~~~i~~~~~~~vVIDSIQtl  179 (479)
T Consensus       218 vvV~atsd~~p~~R~~a~~~A~tiAEyFrd~G~~VLl~~DslTR~  262 (440)
T PRK08972        218 VVVAAPADTSPLMRLKGCETATRIAEYFRDQGLNVLLLMDSLTRY  262 (440)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHH
T ss_conf             999704888868899999999988999996799779996355677