HHsearch alignment for GI: 254780334 and conserved domain: PRK10419

>PRK10419 nikE nickel transporter ATP-binding protein; Provisional.
Probab=97.92  E-value=0.00027  Score=50.93  Aligned_cols=153  Identities=17%  Similarity=0.246  Sum_probs=84.2

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCC----CHHHHHHHHHHCCCCCCCH--HE----------
Q ss_conf             8578708999549875188999999999850398199998646----3047888875201577510--00----------
Q gi|254780334|r   86 GFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEE----AIGQIRLRAQRLNTINSSV--YI----------  149 (479)
Q Consensus        86 Gl~~Gs~~Li~G~PGvGKSTL~Lqia~~~a~~g~~vlYvS~EE----s~~Qi~~Ra~Rl~~~~~~i--~~----------  149 (479)
T Consensus        34 ~i~~GE~l~ivGeSGsGKSTL~r~i~gl~~p~s-G~I~~~g~~l~~~~~~~~~~~rr~i~~VfQ~~~~slnP~~tv~~~i  112 (266)
T PRK10419         34 TLKSGETVALLGRSGCGKSTLARLLVGLESPSQ-GNISWRGEPLAKLNRAQRKAFRRDIQMVFQDSISAVNPRKTVREIL  112 (266)
T ss_pred             EECCCCEEEEECCCCCHHHHHHHHHHCCCCCCC-EEEEECCEECCCCCHHHHHHHHCCCEEEEECCHHHCCHHHHHHHHH
T ss_conf             888998999999999779999999966999996-2998899956758999999975473899739136368164899999


Q ss_pred             ----------------------ECCCCH-----------------HH-HHHHHHHCCCCCEEEECHHHHHHHHHHCCCCC
Q ss_conf             ----------------------034788-----------------99-99999731698289972168766542044556
Q gi|254780334|r  150 ----------------------AIETNV-----------------ED-IIATLITNEKPDLVIIDSIQTLWSQTAESSPG  189 (479)
Q Consensus       150 ----------------------~~e~~l-----------------~~-il~~~i~~~~~~~vVIDSIQtl~~~~~~s~~G  189 (479)
T Consensus       113 ~epl~~~~~~~~~~~~~~~~~~L~~vgL~~~~~~~yP~eLSGGq~QRVaIArA-L~~~P~lLi~DEPtsaLD~-------  184 (266)
T PRK10419        113 REPLRHLLSLDKAERLARASEMLKAVDLDDSVLDKRPPQLSGGQLQRVCLARA-LAVEPKLLILDEAVSNLDL-------  184 (266)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHCCHHHCCHHHHHHHHHHHH-HCCCCCEEEEECCCCCCCH-------
T ss_conf             99999814999999999999999874998898717843379278777898666-4069878999688653699-------


Q ss_pred             CHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCHHHHHHHHHEEEEEECCCCCCCCCCEEEEEEEECCCCCCCEEE
Q ss_conf             36799999999999753079789998630366543311457877530278515556665442156763202567651279
Q gi|254780334|r  190 TVIQVRTSVQAMIQYAKKNGVAMVLVGHVTKEGQIAGPRVIEHMVDAVLYFEGGTRNTQYDYRILRSVKNRFGPTDEIGV  269 (479)
Q Consensus       190 svsQvre~~~~L~~~AK~~~i~vilighvTK~G~iAGp~~LeH~VD~vl~~ege~~~~~~~~R~Lr~~KNRfG~t~e~gv  269 (479)
T Consensus       185 -~~q-~~il~ll~~l~~~~g~t~i~ITH--------Dl~~a~~~adri~Vm~~-----G---~iVE~-----G~~~~~~~  241 (266)
T PRK10419        185 -VLQ-AGVIRLLKKLQQQFGTACLFITH--------DLRLVERFCQRVMVMDN-----G---QIVET-----QVVGDKLT  241 (266)
T ss_pred             -HHH-HHHHHHHHHHHHHHCCEEEEECC--------CHHHHHHHCCEEEEEEC-----C---EEEEE-----CCCCCCCC
T ss_conf             -999-99999999999975989999889--------99999996898999989-----8---89998-----65630035


Q ss_pred             E
Q ss_conf             9
Q gi|254780334|r  270 F  270 (479)
Q Consensus       270 f  270 (479)
T Consensus       242 ~  242 (266)
T PRK10419        242 F  242 (266)
T ss_pred             C
T ss_conf             7