>TIGR01242 26Sp45 26S proteasome subunit P45 family; InterPro: IPR005937 Intracellular proteins, including short-lived proteins such as cyclin, Mos, Myc, p53, NF-kappaB, and IkappaB, are degraded by the ubiquitin-proteasome system. The 26S proteasome (a 2 MDa complex) is made up of two subcomplexes: the 20S proteasome and the regulatory complex. The former is a 700 kDa cylindrical protease complex consisting of four stacks of heptameric rings with 28 subunits (i.e., 7777) with molecular masses of about 20-35 kDa, whereas the latter is a 700-1000 kDa complex consisting of at least 18 subunits with molecular masses of 28-110 kDa, including 6 putative ATPases (Rpt1-Rpt6) and 12 non-ATPase subunits (Rpn1-12). Members of the 26S proteasome subunit P45 family: ATPase p45/Sug1/Rpt6 may be phosphorylated within the proteasome. This phosphorylation event may play a key role in ATP-dependent proteolysis because a good correlation exists between the inhibition pattern of protein kinase inhibitors against the phosphorylation of p45 and that against the ATP-dependent proteolytic activity , . More information about these protein can be found at Protein of the Month: AAA ATPases .; GO: 0016787 hydrolase activity, 0030163 protein catabolic process, 0005634 nucleus, 0005737 cytoplasm.

Probab=97.14 E-value=0.0039 Score=42.43 Aligned_cols=116 Identities=22% Similarity=0.358 Sum_probs=74.5 Q ss_pred CCCCCCCCCCHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEE--ECCCCHHHHHHHHHHCCCCC Q ss_conf 5666323781248888659857870899954987518899999999985039819999--86463047888875201577 Q gi|254780334|r 67 EEESRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYV--SGEEAIGQIRLRAQRLNTIN 144 (479) Q Consensus 67 ~~~~Ri~TGi~eLDrvLGGGl~~Gs~~Li~G~PGvGKSTL~Lqia~~~a~~g~~vlYv--S~EEs~~Qi~~Ra~Rl~~~~ 144 (479) T Consensus 135 ~E~v~LPlk~PeLF~~v--GI~PPKGvLLyGPPGtGKTLlAKAvA~et-----~ATFIrvVgSElV~Ky------I---G 198 (364) T TIGR01242 135 REAVELPLKKPELFEEV--GIEPPKGVLLYGPPGTGKTLLAKAVAHET-----NATFIRVVGSELVRKY------I---G 198 (364) T ss_pred HHHHHCCCCCCHHHHHC--CCCCCCCEEEECCCCCCHHHHHHHHHCCC-----CCEEEEEEHHHHHHHH------H---C T ss_conf 88873468883167762--88989865700757976889999863145-----5126886044444444------1---3 Q ss_pred CCHHEECCCCHHHHHHHHHHCCCCCEEEECHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH Q ss_conf 510000347889999999731698289972168766542044556367999999999997530 Q gi|254780334|r 145 SSVYIAIETNVEDIIATLITNEKPDLVIIDSIQTLWSQTAESSPGTVIQVRTSVQAMIQYAKK 207 (479) Q Consensus 145 ~~i~~~~e~~l~~il~~~i~~~~~~~vVIDSIQtl~~~~~~s~~GsvsQvre~~~~L~~~AK~ 207 (479) T Consensus 199 EG-----ArLV~~~F~-LAkEKaPsIiFIDEiDAiaakR~~~~TsG---dREV~RTlmQLLAE 252 (364) T TIGR01242 199 EG-----ARLVREVFE-LAKEKAPSIIFIDEIDAIAAKRVDSSTSG---DREVQRTLMQLLAE 252 (364) T ss_pred CH-----HHHHHHHHH-HHHCCCCCEEEEECHHHHHHHHCCCCCCC---CHHHHHHHHHHHHH T ss_conf 31-----689999999-85306981686101333543211467787---31578899999975

HHsearch alignment for GI: 254780334 and conserved domain: TIGR01242