HHsearch alignment for GI: 254780334 and conserved domain: cd00983

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response. RecA couples ATP hydrolysis to DNA strand exchange.
Probab=99.88  E-value=8e-21  Score=171.46  Aligned_cols=231  Identities=20%  Similarity=0.332  Sum_probs=169.1

Q ss_pred             CCCCEECCCCCCCCCCCCCCCCHHHHHHHC-CCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCHHHH
Q ss_conf             656403133345566632378124888865-9857870899954987518899999999985039819999864630478
Q gi|254780334|r   55 SISLFMLSEESIEEESRIQTHIDELDRVTG-GGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQI  133 (479)
Q Consensus        55 ~~~~~~l~~~~~~~~~Ri~TGi~eLDrvLG-GGl~~Gs~~Li~G~PGvGKSTL~Lqia~~~a~~g~~vlYvS~EEs~~Qi  133 (479)
T Consensus        19 ~~~~~~~~~~~~~~~~~i~TGs~~lD~alg~GGiP~GRivei~G~essGKTtlal~~ia~aQk~gg~~~~iDaE~a~d--   96 (325)
T cd00983          19 KGSIMKLGDDAVQDVEVIPTGSLSLDIALGIGGYPKGRIIEIYGPESSGKTTLALHAIAEAQKLGGTVAFIDAEHALD--   96 (325)
T ss_pred             CCCEEECCCCCCCCCCEECCCCHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHCCC--
T ss_conf             864589887778865346268199999975899668808999889877799999999999873598399996254259--


Q ss_pred             HHHHHHCCCCCCCHHEECCCCHHHH---HHHHHHCCCCCEEEECHHHHHHHH-HHCCCCCCH---HHHHHHHHH---HHH
Q ss_conf             8887520157751000034788999---999973169828997216876654-204455636---799999999---999
Q gi|254780334|r  134 RLRAQRLNTINSSVYIAIETNVEDI---IATLITNEKPDLVIIDSIQTLWSQ-TAESSPGTV---IQVRTSVQA---MIQ  203 (479)
Q Consensus       134 ~~Ra~Rl~~~~~~i~~~~e~~l~~i---l~~~i~~~~~~~vVIDSIQtl~~~-~~~s~~Gsv---sQvre~~~~---L~~  203 (479)
T Consensus        97 ~~~a~~lGVD~~~l~~~qp~~~Eq~l~i~~~li~s~~~dliViDSvaal~p~~E~e~~~~d~~vg~~ArlmskalRklt~  176 (325)
T cd00983          97 PVYAKKLGVDLDNLLISQPDTGEQALEIADSLVRSGAVDLIVVDSVAALVPKAEIEGEMGDSHVGLQARLMSQALRKLTG  176 (325)
T ss_pred             HHHHHHCCCCHHHEEEECCCHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             89999809984675896663899999999997515887679981511236578876011321143899999999999998


Q ss_pred             HHHHCCCEEEEEEEE-CCCCCC-------CCHHHHHHHHHEEEEEECCC--CCC----CCCCEEEEEEEECCCCCCCEEE
Q ss_conf             753079789998630-366543-------31145787753027851555--666----5442156763202567651279
Q gi|254780334|r  204 YAKKNGVAMVLVGHV-TKEGQI-------AGPRVIEHMVDAVLYFEGGT--RNT----QYDYRILRSVKNRFGPTDEIGV  269 (479)
Q Consensus       204 ~AK~~~i~vilighv-TK~G~i-------AGp~~LeH~VD~vl~~ege~--~~~----~~~~R~Lr~~KNRfG~t~e~gv  269 (479)
T Consensus       177 ~l~k~~~~lIfiNQ~R~kiG~mfg~pe~t~GG~Alkf~aSvrl~l~k~~~ik~~~~~iG~~i-kvkv~KnK~a~P~r~a~  255 (325)
T cd00983         177 SINKSNTTVIFINQLREKIGVMFGNPETTTGGNALKFYSSVRLDIRRIETIKDGDEVIGNRT-KVKVVKNKVAPPFKTAE  255 (325)
T ss_pred             HHCCCCCEEEEEEEEHHHCCCCCCCCCCCCCCCCHHCCCEEEEEEEECCCCCCCCCCEEEEE-EEEEEECCCCCCCCEEE
T ss_conf             75337807999554322157756898537997505512113899976131257885077699-99999788689986799


Q ss_pred             EEEC-CCCCEEECCHHHHHH
Q ss_conf             9851-566311014045551
Q gi|254780334|r  270 FEMS-DKGLQEVSDPSKIFL  288 (479)
Q Consensus       270 f~m~-~~Gl~~v~~ps~~fl  288 (479)
T Consensus       256 ~~i~yg~GId~~~elldla~  275 (325)
T cd00983         256 FDILFGEGISREGEIIDLAV  275 (325)
T ss_pred             EEECCCCCCCHHHHHHHHHH
T ss_conf             99467876342532999998