HHsearch alignment for GI: 254780334 and conserved domain: cd03234

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors. The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in
Probab=97.46  E-value=0.0021  Score=44.38  Aligned_cols=31  Identities=29%  Similarity=0.392  Sum_probs=26.0

Q ss_pred             CCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             5985787089995498751889999999998
Q gi|254780334|r   84 GGGFVRGSVILVGGDPGIGKSTLLMQTAASL  114 (479)
Q Consensus        84 GGGl~~Gs~~Li~G~PGvGKSTL~Lqia~~~  114 (479)
T Consensus        27 s~~i~~Ge~~~ilGpnGsGKSTLl~~i~G~~   57 (226)
T cd03234          27 SLHVESGQVMAILGSSGSGKTTLLDAISGRV   57 (226)
T ss_pred             EEEEECCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             7899188099999899960999999996789