RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780337|ref|YP_003064750.1| oxidoreductase protein [Candidatus Liberibacter asiaticus str. psy62] (257 letters) >gnl|CDD|31231 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]. Length = 251 Score = 136 bits (343), Expect = 6e-33 Identities = 75/248 (30%), Positives = 121/248 (48%), Gaps = 20/248 (8%) Query: 15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQ--LEKLKNALQKI-NKKIDI 71 +L ++ALVTG+S GIG A LAR GA V+ R + E L A+++ + Sbjct: 2 DLSGKVALVTGASSGIGRAIARALAREGARVVVAARRSEEEAAEALAAAIKEAGGGRAAA 61 Query: 72 FAFDLRDS-NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130 A D+ D ++E + +G++DIL+ NAGI G +P+ ++ E+ + VI VN++ Sbjct: 62 VAADVSDDEESVEALVAAAEEEFGRIDILVNNAGIAGPDAPLEELTEEDWDRVIDVNLLG 121 Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190 + + R+ P +KK R + +SS A P AY+ASKAA+ L + + E Sbjct: 122 AFLLTRAALPLMKK---QRIVNISSVAGLGGPPGQAAYAASKAALIGLTKALALELAPRG 178 Query: 191 LRVINIDPGPTRTSMRAKAMPAEDPNT-----------VPHPQKVAKIISFLCATQKIE- 238 +RV + PG T M A AE + P++VA ++FL + + Sbjct: 179 IRVNAVAPGYIDTPMTAALESAELEALKRLAARIPLGRLGTPEEVAAAVAFLASDEAASY 238 Query: 239 -TGKLFSV 245 TG+ V Sbjct: 239 ITGQTLPV 246 >gnl|CDD|33946 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]. Length = 246 Score = 128 bits (324), Expect = 1e-30 Identities = 65/225 (28%), Positives = 101/225 (44%), Gaps = 12/225 (5%) Query: 15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74 L ++AL+TG+S GIG TA LA +GA V+ R +LE L + + A Sbjct: 3 TLKGKVALITGASSGIGEATARALAEAGAKVVLAARREERLEALADEIGA--GAALALAL 60 Query: 75 DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134 D+ D A+E + + +G++DIL+ NAG L P+ + + +I NV N Sbjct: 61 DVTDRAAVEAAIEALPEEFGRIDILVNNAG-LALGDPLDEADLDDWDRMIDTNVKGLLNG 119 Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194 R+ P + + G I L S A P Y A+KAA+ A + +E T +RV Sbjct: 120 TRAVLPGMVERKSGHIINLGSIAGRYPYPGGAVYGATKAAVRAFSLGLRQELAGTGIRVT 179 Query: 195 NIDPGPTRTSMRA---------KAMPAEDPNTVPHPQKVAKIISF 230 I PG T+ + +A T P+ +A+ + F Sbjct: 180 VISPGLVETTEFSTVRFEGDDERADKVYKGGTALTPEDIAEAVLF 224 >gnl|CDD|35944 KOG0725, KOG0725, KOG0725, Reductases with broad range of substrate specificities [General function prediction only]. Length = 270 Score = 126 bits (317), Expect = 6e-30 Identities = 75/238 (31%), Positives = 117/238 (49%), Gaps = 21/238 (8%) Query: 16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKIN---KKIDIF 72 L ++ALVTG S GIG AL LA++GA V+ GRS +LE+ L + K+ Sbjct: 6 LAGKVALVTGGSSGIGKAIALLLAKAGAKVVITGRSEERLEETAQELGGLGYTGGKVLAI 65 Query: 73 AFDLRD-SNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMAN 131 D+ + +L + + K +GK+DIL+ NAG LG I + E+ F +++ N+ + Sbjct: 66 VCDVSKEVDVEKLVEFAVEKFFGKIDILVNNAGALGLTGSILDLSEEVFDKIMATNLRGS 125 Query: 132 WNIMRSF-DPWLKKSHCGRAIILSSGAAYK-CRPLWGAYSASKAAIEALARTWSKETVNT 189 ++ P LKKS G + +SS A AY SKAA+ L R+ +KE Sbjct: 126 AFCLKQAARPMLKKSKGGSIVNISSVAGVGPGPGSGVAYGVSKAALLQLTRSLAKELAKH 185 Query: 190 ALRVINIDPGPTRTSMRAKAMPAED----------PNTVP-----HPQKVAKIISFLC 232 +RV ++ PG +TS+RA + + VP P++VA+ +FL Sbjct: 186 GIRVNSVSPGLVKTSLRAAGLDDGEMEEFKEATDSKGAVPLGRVGTPEEVAEAAAFLA 243 >gnl|CDD|36419 KOG1205, KOG1205, KOG1205, Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 282 Score = 122 bits (308), Expect = 8e-29 Identities = 57/210 (27%), Positives = 103/210 (49%), Gaps = 4/210 (1%) Query: 15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI--NKKIDIF 72 L ++ L+TG+S GIG A ELA+ GA ++ R +LE++ L+K+ +K+ + Sbjct: 9 RLAGKVVLITGASSGIGEALAYELAKRGAKLVLVARRARRLERVAEELRKLGSLEKVLVL 68 Query: 73 AFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANW 132 D+ D +++ + + +G++D+L+ NAGI + + +V+ NV Sbjct: 69 QLDVSDEESVKKFVEWAIRHFGRVDVLVNNAGISLV-GFLEDTDIEDVRNVMDTNVFGTV 127 Query: 133 NIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192 + ++ P +KK + G +++SS A P YSASK A+E T +E + Sbjct: 128 YLTKAALPSMKKRNDGHIVVISSIAGKMPLPFRSIYSASKHALEGFFETLRQELIPLGTI 187 Query: 193 V-INIDPGPTRTSMRAKAMPAEDPNTVPHP 221 + I + PGP T K + E+ + P Sbjct: 188 IIILVSPGPIETEFTGKELLGEEGKSQQGP 217 >gnl|CDD|30648 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only]. Length = 265 Score = 120 bits (302), Expect = 5e-28 Identities = 66/236 (27%), Positives = 110/236 (46%), Gaps = 11/236 (4%) Query: 16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNAL-QKINKKIDIFAF 74 + + AL+TG+S GIG A +LAR G +I R +LE L L K ++++ Sbjct: 4 MKGKTALITGASSGIGAELAKQLARRGYNLILVARREDKLEALAKELEDKTGVEVEVIPA 63 Query: 75 DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134 DL D ALE + + +R G +D+L+ NAG G+ P ++ ++I +N++A + Sbjct: 64 DLSDPEALERLEDELKERGGPIDVLVNNAGF-GTFGPFLELSLDEEEEMIQLNILALTRL 122 Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194 ++ P + + G I + S A P YSA+KA + + + +E T ++V Sbjct: 123 TKAVLPGMVERGAGHIINIGSAAGLIPTPYMAVYSATKAFVLSFSEALREELKGTGVKVT 182 Query: 195 NIDPGPTRTSM----RAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVP 246 + PGPTRT + V P+ VA+ +E GK +P Sbjct: 183 AVCPGPTRTEFFDAKGSDVYLLSPGELVLSPEDVAEAALKA-----LEKGKREIIP 233 >gnl|CDD|143883 pfam00106, adh_short, short chain dehydrogenase. This family contains a wide variety of dehydrogenases. Length = 167 Score = 99.2 bits (248), Expect = 1e-21 Identities = 45/169 (26%), Positives = 73/169 (43%), Gaps = 10/169 (5%) Query: 21 ALVTGSSRGIGYYTALELARSGAYVIA-CGRSIS--QLEKLKNALQKINKKIDIFAFDLR 77 L+TG + G+G A LA GA + R +L L+ + ++ + A D+ Sbjct: 3 VLITGGTGGLGLALARWLAAEGARHLVLVSRRGDAPGAAELVAELEALGAEVTVAACDVA 62 Query: 78 DSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137 D +AL + G LD ++ NAG+L P+ ++ + F V++ V WN+ Sbjct: 63 DRDALAALLAALPAALGPLDGVVHNAGVLDD-GPLEELTPERFERVLAPKVTGAWNLHEL 121 Query: 138 FDPWLKKSHCGRAIIL-SSGAAYKCRPLWGAYSASKAAIEALARTWSKE 185 A +L SS A P Y+A+ AA++ALA E Sbjct: 122 TLD-----LDLGAFVLFSSVAGVLGSPGQANYAAANAALDALAEHRRAE 165 >gnl|CDD|36422 KOG1208, KOG1208, KOG1208, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism]. Length = 314 Score = 98.1 bits (244), Expect = 2e-21 Identities = 60/256 (23%), Positives = 103/256 (40%), Gaps = 28/256 (10%) Query: 13 HVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIF 72 ++L ++ALVTG++ GIG+ TA ELA GA+V+ R+ + E+ K +QK I Sbjct: 30 GIDLSGKVALVTGATSGIGFETARELALRGAHVVLACRNEERGEEAKEQIQKGKANQKIR 89 Query: 73 AF--DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMA 130 DL ++ K+ G LD+LI NAG++ P + + + + N + Sbjct: 90 VIQLDLSSLKSVRKFAEEFKKKEGPLDVLINNAGVMA---PPFSLTKDGLELTFATNYLG 146 Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAA------YKCRPLWG-------AYSASKAAIEA 177 ++ + P LK+S R + +SS AY+ SK A Sbjct: 147 HFLLTELLLPLLKRSAPSRIVNVSSILGGGKIDLKDLSGEKAKLYSSDAAYALSKLANVL 206 Query: 178 LARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-- 235 LA +K + + ++ PG +T+ ++ + K AT Sbjct: 207 LANELAKR-LKKGVTTYSVHPGVVKTTGLSRVNLLLRLLAKKLSWPLTKSPEQGAATTCY 265 Query: 236 -------KIETGKLFS 244 + +GK F Sbjct: 266 AALSPELEGVSGKYFE 281 >gnl|CDD|36423 KOG1209, KOG1209, KOG1209, 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism]. Length = 289 Score = 96.3 bits (239), Expect = 7e-21 Identities = 59/200 (29%), Positives = 83/200 (41%), Gaps = 6/200 (3%) Query: 20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDS 79 + + SS GIGY A E AR+G V A R + + +L K+D+ + Sbjct: 10 VLITGCSSGGIGYALAKEFARNGYLVYATARRLEPMAQLAIQFGLKPYKLDV----SKPE 65 Query: 80 NALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFD 139 + ++ A GKLD+L NAG P + VNV + + R+ Sbjct: 66 EVVTVSGEVRANPDGKLDLLYNNAGQ-SCTFPALDATIAAVEQCFKVNVFGHIRMCRALS 124 Query: 140 PWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPG 199 +L K+ G + + S A P YSASKAAI A ART E +RVIN G Sbjct: 125 HFLIKAK-GTIVNVGSLAGVVPFPFGSIYSASKAAIHAYARTLRLELKPFGVRVINAITG 183 Query: 200 PTRTSMRAKAMPAEDPNTVP 219 T + K +P P Sbjct: 184 GVATDIADKRLPETTIYNFP 203 >gnl|CDD|36232 KOG1014, KOG1014, KOG1014, 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism]. Length = 312 Score = 84.9 bits (210), Expect = 2e-17 Identities = 60/238 (25%), Positives = 100/238 (42%), Gaps = 8/238 (3%) Query: 21 ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK-KIDIFAFDL-RD 78 A+VTG++ GIG A ELA+ G V+ R+ +LE + +++ K ++ I A D + Sbjct: 52 AVVTGATDGIGKAYARELAKRGFNVVLISRTQEKLEAVAKEIEEKYKVEVRIIAIDFTKG 111 Query: 79 SNALELTKTYIAKRWGKLDILIANAGIL-GSISPIWQIKEKSFADVISVNVMANWNIMRS 137 E +A + IL+ N G+ + E ++I+VN+++ + + Sbjct: 112 DEVYEKLLEKLAG--LDVGILVNNVGMSYDYPESFLKYPEGELQNIINVNILSVTLLTQL 169 Query: 138 FDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINID 197 P + + G + + S A PL YSASKA ++ +R KE + + V ++ Sbjct: 170 ILPGMVERKKGIIVNIGSFAGLIPTPLLSVYSASKAFVDFFSRCLQKEYESKGIFVQSVI 229 Query: 198 PGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLT 255 P T M P VP P+ AK TG L Q + L Sbjct: 230 PYLVATKMAKYRKP---SLFVPSPETFAKSALNTIGNASETTGYLNHAIQVLLITLLP 284 >gnl|CDD|36415 KOG1201, KOG1201, KOG1201, Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism]. Length = 300 Score = 84.1 bits (208), Expect = 3e-17 Identities = 54/231 (23%), Positives = 94/231 (40%), Gaps = 14/231 (6%) Query: 18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF--D 75 + L+TG G+G ALE A+ GA ++ + E+ ++KI + A+ D Sbjct: 38 GEIVLITGGGSGLGRLIALEFAKRGAKLVLWDINKQGNEETVKEIRKIGE---AKAYTCD 94 Query: 76 LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIM 135 + D + + K G +DIL+ NAGI+ + + ++ VN +A++ Sbjct: 95 ISDREEIYRLAKKVKKEVGDVDILVNNAGIV-TGKKLLDCSDEEIQKTFDVNTIAHFWTT 153 Query: 136 RSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVIN 195 ++F P + +++ G + ++S A Y ASK A + S E I Sbjct: 154 KAFLPKMLENNNGHIVTIASVAGLFGPAGLADYCASKFAAVGFHESLSMELRALGKDGIK 213 Query: 196 ---IDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLF 243 + P T M A P + P+ VAK I + I T + Sbjct: 214 TTLVCPYFINTGMFDGATPFPTLAPLLEPEYVAKRI-----VEAILTNQAG 259 >gnl|CDD|36424 KOG1210, KOG1210, KOG1210, Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 331 Score = 79.6 bits (196), Expect = 8e-16 Identities = 59/224 (26%), Positives = 95/224 (42%), Gaps = 16/224 (7%) Query: 18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQ--KINKKIDIFAFD 75 R L+TG S G+G ALE R GA V RS +L + K L+ + + + D Sbjct: 33 RRHILITGGSSGLGLALALECKREGADVTITARSGKKLLEAKAELELLTQVEDVSYKSVD 92 Query: 76 LRDSNALELTKTYIAKRWGKLDILIANAG--ILGSISPIWQIKEKSFADVISVNVMANWN 133 + D +++ + G +D L AG + G + + ++ VN + N Sbjct: 93 VIDYDSVSKVIEELRDLEGPIDNLFCCAGVAVPGLFE---DLSPEVVEKLMDVNYLGTVN 149 Query: 134 IMRSFDPWLKK-SHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALR 192 + ++ +KK H GR I++SS A + AYS SK A+ LA +E + + Sbjct: 150 VAKAAARAMKKREHLGRIILVSSQLAMLGIYGYSAYSPSKFALRGLAEALRQELIKYGVH 209 Query: 193 VINIDPGPTRT---SMRAKAMPA-----EDPNTVPHPQKVAKII 228 V P T T K P E ++V +++AK I Sbjct: 210 VTLYYPPDTLTPGFERENKTKPEETKIIEGGSSVIKCEEMAKAI 253 >gnl|CDD|36418 KOG1204, KOG1204, KOG1204, Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 253 Score = 79.2 bits (195), Expect = 9e-16 Identities = 49/191 (25%), Positives = 71/191 (37%), Gaps = 13/191 (6%) Query: 22 LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81 L+TG+SRGIG + + + G + E L+ D+ + Sbjct: 10 LLTGASRGIGTGSVATILAEDDEALRYGVARLLAE-LEGLKVAYGDDFVHVVGDITEEQL 68 Query: 82 LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI--MRSFD 139 L + K+ GK DI+I NAG LG +S D + N+ M S Sbjct: 69 LGALREAPRKKGGKRDIIIHNAGSLGDVSKG----AVDLGDSDQWKKYWDLNLFSMVSLV 124 Query: 140 PWLKKSHCGR-----AIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194 W + +SS AA + W AY +SKAA + E +RV+ Sbjct: 125 QWALPKLKKSPVNGNVVNVSSLAAVRPFSSWAAYCSSKAARNMYFMVLASEEPFD-VRVL 183 Query: 195 NIDPGPTRTSM 205 N PG T M Sbjct: 184 NYAPGVVDTQM 194 >gnl|CDD|36823 KOG1610, KOG1610, KOG1610, Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism, General function prediction only]. Length = 322 Score = 78.4 bits (193), Expect = 2e-15 Identities = 50/195 (25%), Positives = 94/195 (48%), Gaps = 7/195 (3%) Query: 14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73 +L ++ L+TG G G A +L + G V A + E L+ + + ++ Sbjct: 25 DSLSDKAVLITGCDSGFGRLLAKKLDKKGFRVFAGCLTEEGAESLR--GETKSPRLRTLQ 82 Query: 74 FDLRDSNALELTKTYIAKRWGK--LDILIANAGILGSISPI-WQIKEKSFADVISVNVMA 130 D+ +++ ++ K G+ L L+ NAGI G + P W E + V++VN++ Sbjct: 83 LDVTKPESVKEAAQWVKKHLGEDGLWGLVNNAGISGFLGPDEWLTVE-DYRKVLNVNLLG 141 Query: 131 NWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTA 190 + ++F P L+++ GR + +SS P G Y SK A+EA + + +E Sbjct: 142 TIRVTKAFLPLLRRAR-GRVVNVSSVLGRVALPALGPYCVSKFAVEAFSDSLRRELRPFG 200 Query: 191 LRVINIDPGPTRTSM 205 ++V I+PG +T++ Sbjct: 201 VKVSIIEPGFFKTNL 215 >gnl|CDD|36414 KOG1200, KOG1200, KOG1200, Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism]. Length = 256 Score = 74.6 bits (183), Expect = 2e-14 Identities = 53/232 (22%), Positives = 96/232 (41%), Gaps = 12/232 (5%) Query: 10 SEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI 69 E+ L +++A VTG S GIG A LA+ GA V + E L Sbjct: 6 GEVVQRLMSKVAAVTGGSSGIGRAIAQLLAKKGARVAVADLDSAAAEATAGDLGGYGDHS 65 Query: 70 DIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVM 129 F+ D+ ++ ++ T + K G +L+ AGI + ++K++ + VI+VN+ Sbjct: 66 A-FSCDVSKAHDVQNTLEEMEKSLGTPSVLVNCAGITRD-GLLLRMKQEQWDSVIAVNLT 123 Query: 130 ANWNIMRSF--DPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETV 187 + + ++ + + I +SS Y+ASK + +T ++E Sbjct: 124 GVFLVTQAAVRAMVMNQQQGLSIINVSSIVGKIGNFGQTNYAASKGGVIGFTKTAARELA 183 Query: 188 NTALRVINIDPGPTRTSMRAKAMP---AEDPNTVP-----HPQKVAKIISFL 231 +RV + PG T M P + +P ++VA ++ FL Sbjct: 184 RKNIRVNVVLPGFIATPMTEAMPPKVLDKILGMIPMGRLGEAEEVANLVLFL 235 >gnl|CDD|33748 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]. Length = 245 Score = 74.2 bits (182), Expect = 4e-14 Identities = 48/207 (23%), Positives = 84/207 (40%), Gaps = 11/207 (5%) Query: 14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFA 73 + L+TG + GIG A G VI CGR+ +L + K +I+ Sbjct: 1 MKTTGNTILITGGASGIGLALAKRFLELGNTVIICGRNEERLAEAKAENPEIHT----EV 56 Query: 74 FDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKE--KSFADVISVNVMAN 131 D+ D ++ ++ K + L++LI NAGI + + ++ I+ N++A Sbjct: 57 CDVADRDSRRELVEWLKKEYPNLNVLINNAGIQRNED-LTGAEDLLDDAEQEIATNLLAP 115 Query: 132 WNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTAL 191 + P L + I +SSG A+ Y A+KAAI + ++ +T++ Sbjct: 116 IRLTALLLPHLLRQPEATIINVSSGLAFVPMASTPVYCATKAAIHSYTLALREQLKDTSV 175 Query: 192 RVINIDP----GPTRTSMRAKAMPAED 214 VI + P + MP Sbjct: 176 EVIELAPPLVDTTEGNTQARGKMPLSA 202 >gnl|CDD|36421 KOG1207, KOG1207, KOG1207, Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 245 Score = 73.2 bits (179), Expect = 7e-14 Identities = 58/196 (29%), Positives = 90/196 (45%), Gaps = 19/196 (9%) Query: 16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75 L + LVTG+ GIG L LA++GA VIA R+ + L L +++ I D Sbjct: 5 LAGVIVLVTGAGAGIGKEIVLSLAKAGAQVIAVARNEANLLSL---VKETPSLIIPIVGD 61 Query: 76 LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI- 134 L AL + +D L+ NAG+ + P +I ++SF +VNV A + Sbjct: 62 LSAWEALF---KLLVPV-FPIDGLVNNAGV-ATNHPFGEITQQSFDRTFAVNVRAVILVA 116 Query: 135 ---MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWG--AYSASKAAIEALARTWSKETVNT 189 R+ K G + +SS A+ RPL Y A+KAA++ L + + E Sbjct: 117 QLVARNLVDRQIK---GAIVNVSSQASI--RPLDNHTVYCATKAALDMLTKCLALELGPQ 171 Query: 190 ALRVINIDPGPTRTSM 205 +RV +++P T M Sbjct: 172 KIRVNSVNPTVVMTDM 187 >gnl|CDD|39371 KOG4169, KOG4169, KOG4169, 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism, General function prediction only]. Length = 261 Score = 71.1 bits (174), Expect = 3e-13 Identities = 56/197 (28%), Positives = 87/197 (44%), Gaps = 17/197 (8%) Query: 16 LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFD 75 L + ALVTG + GIG T+ L G V+ S E + LQ IN + + Sbjct: 3 LTGKNALVTGGAGGIGLATSKALLEKGIKVLVIDDSEENPEAIA-KLQAINPSVSVIFIK 61 Query: 76 LRDSNALELTKTY--IAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWN 133 +N +L + I +G +DILI AGIL +K + I+VN+ N Sbjct: 62 CDVTNRGDLEAAFDKILATFGTIDILINGAGIL---------DDKDWERTINVNLTGVIN 112 Query: 134 IMRSFDPWLKKSHCGRAII---LSSGAAYKCRPLWGAYSASKAAIEALARTWSKETV--N 188 + P++ K G+ I +SS A P++ Y+ASKA + R+ + Sbjct: 113 GTQLALPYMDKKQGGKGGIIVNMSSVAGLDPMPVFPVYAASKAGVVGFTRSLADLAYYQR 172 Query: 189 TALRVINIDPGPTRTSM 205 + +R + PG TRT + Sbjct: 173 SGVRFNAVCPGFTRTDL 189 >gnl|CDD|36824 KOG1611, KOG1611, KOG1611, Predicted short chain-type dehydrogenase [General function prediction only]. Length = 249 Score = 67.2 bits (164), Expect = 4e-12 Identities = 52/202 (25%), Positives = 87/202 (43%), Gaps = 18/202 (8%) Query: 22 LVTGSSRGIGYYTALEL-ARSGAYVIACG-RSISQLEKLKNALQKINKKIDIFAFDLRDS 79 +TG++RGIG EL G VI R + K + ++ I D+ Sbjct: 7 FITGANRGIGLGLVKELLKDKGIEVIIATARDPEKAATELALKSKSDSRVHIIQLDVTCD 66 Query: 80 NALELTKTYIAKRWG--KLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRS 137 +++ + K G L++LI NAGI S + + + + N + + ++ Sbjct: 67 ESIDNFVQEVEKIVGSDGLNLLINNAGIALSYNTVLKPSRAVLLEQYETNAVGPILLTQA 126 Query: 138 FDPWLKKSH---------CGRAIIL----SSGAAYKCRPL-WGAYSASKAAIEALARTWS 183 F P LKK+ RA I+ S+G+ RP AY SKAA+ A++ S Sbjct: 127 FLPLLKKAASKVSGDGLSVSRAAIINISSSAGSIGGFRPGGLSAYRMSKAALNMFAKSLS 186 Query: 184 KETVNTALRVINIDPGPTRTSM 205 + + + V++I PG +T M Sbjct: 187 VDLKDDHILVVSIHPGWVQTDM 208 >gnl|CDD|36413 KOG1199, KOG1199, KOG1199, Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]. Length = 260 Score = 58.5 bits (141), Expect = 2e-09 Identities = 61/240 (25%), Positives = 108/240 (45%), Gaps = 29/240 (12%) Query: 18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKI-DIFAFDL 76 +ALVTG + G+G TA LA+ GA V + L + K A + K++ F Sbjct: 9 GLVALVTGGASGLGKATAERLAKQGASVA-----LLDLPQSKGA--DVAKELGGKVVFTP 61 Query: 77 RDSNALELTKTYIAK---RWGKLDILIANAGILGSISPIWQIKEK------SFADVISVN 127 D + + + +AK ++G+LD L+ AGI + +++K F VI VN Sbjct: 62 ADVTSEKDVRAALAKAKAKFGRLDALVNCAGI-AYAFKTYNVQKKKHHDLEDFQRVIDVN 120 Query: 128 VMANWNIMRSFDPWL----KKSHCGRAIIL--SSGAAYKCRPLWGAYSASKAAIEALART 181 V+ +N++R + + R +I+ +S AA+ + AYSASK AI + Sbjct: 121 VLGTFNVIRLGAGLMGENEPDQNGQRGVIINTASVAAFDGQTGQAAYSASKGAIVGMTLP 180 Query: 182 WSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPN----TVPHPQKVAKIISFLCATQKI 237 +++ +R I PG T + + ++P + + +P P ++ + Q I Sbjct: 181 IARDLAGDGIRFNTIAPGLFDTPLLS-SLPEKVKSFLAQLIPFPSRLGHPHEYAHLVQAI 239 >gnl|CDD|30968 COG0623, FabI, Enoyl-[acyl-carrier-protein]. Length = 259 Score = 52.9 bits (127), Expect = 8e-08 Identities = 43/197 (21%), Positives = 85/197 (43%), Gaps = 14/197 (7%) Query: 15 NLDNRLALVTG--SSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKID-- 70 L+ + L+ G ++R I + A LA GA + Q E+L+ ++++ +++ Sbjct: 3 LLEGKRILIMGVANNRSIAWGIAKALAEQGAELAFTY----QGERLEKRVEELAEELGSD 58 Query: 71 -IFAFDLRDSNALELTKTYIAKRWGKLDIL---IANAGILGSISPIWQIKEKSFADVISV 126 + D+ + +++ I K+WGKLD L IA A + F + + Sbjct: 59 LVLPCDVTNDESIDALFATIKKKWGKLDGLVHSIAFAPKEELKGDYLDTSREGFLIAMDI 118 Query: 127 NVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKET 186 + + + ++ P + G + L+ + + P + +KAA+EA R + + Sbjct: 119 SAYSFTALAKAARPLMNNG--GSILTLTYLGSERVVPNYNVMGVAKAALEASVRYLAADL 176 Query: 187 VNTALRVINIDPGPTRT 203 +RV I GP RT Sbjct: 177 GKEGIRVNAISAGPIRT 193 >gnl|CDD|30800 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]. Length = 314 Score = 51.9 bits (123), Expect = 2e-07 Identities = 42/204 (20%), Positives = 67/204 (32%), Gaps = 37/204 (18%) Query: 22 LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81 LVTG + IG + L +G V R L+ L ++ DL D + Sbjct: 4 LVTGGAGFIGSHLVERLLAAGHDVRGLDRLRDGLDPL-------LSGVEFVVLDLTDRDL 56 Query: 82 LELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPW 141 ++ G D +I A S + A+ + VNV N++ Sbjct: 57 VD------ELAKGVPDAVIHLAA----QSSVPDSNASDPAEFLDVNVDGTLNLLE----A 102 Query: 142 LKKSHCGRAIILSSGAAY--KCRPLW-----------GAYSASKAAIEALARTWSKETVN 188 + + R + SS + PL Y SK A E L R +++ Sbjct: 103 ARAAGVKRFVFASSVSVVYGDPPPLPIDEDLGPPRPLNPYGVSKLAAEQLLRAYARLYGL 162 Query: 189 --TALRVINIDPGPTRTSMRAKAM 210 LR N+ GP + + Sbjct: 163 PVVILRPFNV-YGPGDKPDLSSGV 185 >gnl|CDD|144821 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions. Length = 235 Score = 47.7 bits (114), Expect = 3e-06 Identities = 40/176 (22%), Positives = 64/176 (36%), Gaps = 30/176 (17%) Query: 21 ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSN 80 LVTG + IG L + G VI GR +L + DL D + Sbjct: 1 ILVTGGTGFIGSALVRRLLQEGYEVIVLGRRRRS-----ESLNTGRIRFRFHEGDLTDPD 55 Query: 81 ALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDP 140 ALE +A+ + D +I L + S + E A+ I NV+ N++ Sbjct: 56 ALE---RLLAE--VQPDAVI----HLAAQSGVGASFEDP-AEFIRANVLGTLNLLE---- 101 Query: 141 WLKKSHCGRAIILSSGAAY-KCRPL----------WGAYSASKAAIEALARTWSKE 185 +++ R + SS Y Y+A+K A E L +++ Sbjct: 102 AARRAGVKRFVFASSSEVYGDVADPPITEDTPLGPLSPYAAAKLAGERLVLAYARA 157 >gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 305 Score = 41.2 bits (97), Expect = 3e-04 Identities = 18/44 (40%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Query: 19 RLALVTGSSRGIGYYTALELA-RSGAYVIACGRSISQLEKLKNA 61 R LVTG+S G+G + A++LA +GA+V+A S ++ E L+ Sbjct: 134 RRVLVTGASGGVGRF-AVQLAALAGAHVVAVVGSPARAEGLREL 176 >gnl|CDD|133446 cd01078, NAD_bind_H4MPT_DH, NADP binding domain of methylene tetrahydromethanopterin dehydrogenase. Methylene Tetrahydromethanopterin Dehydrogenase (H4MPT DH) NADP binding domain. NADP-dependent H4MPT DH catalyzes the dehydrogenation of methylene- H4MPT and methylene-tetrahydrofolate (H4F) with NADP+ as cofactor. H4F and H4MPT are both cofactors that carry the one-carbon units between the formyl and methyl oxidation level. H4F and H4MPT are structurally analogous to each other with respect to the pterin moiety, but each has distinct side chain. H4MPT is present only in anaerobic methanogenic archaea and aerobic methylotrophic proteobacteria. H4MPT seems to have evolved independently from H4F and functions as a distinct carrier in C1 metabolism. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an alpha-beta-alpha configuration. NAD binding involves numerous hydrogen and van der Waals contacts. Length = 194 Score = 37.8 bits (88), Expect = 0.003 Identities = 28/113 (24%), Positives = 42/113 (37%), Gaps = 18/113 (15%) Query: 21 ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINK--KIDIFAFDLRD 78 A+V G + +G A+ LAR GA V+ GR LE+ + A + + A + D Sbjct: 31 AVVLGGTGPVGQRAAVLLAREGARVVLVGR---DLERAQKAADSLRARFGEGVGAVETSD 87 Query: 79 -SNALELTKTYIAKRWGKLDILIAN--AGILGSISPIWQIKEKSFADVISVNV 128 + K D++ A AG+ W K A VN Sbjct: 88 DAARAAAIKG--------ADVVFAAGAAGVELLEKLAWA--PKPLAVAADVNA 130 >gnl|CDD|36715 KOG1502, KOG1502, KOG1502, Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms]. Length = 327 Score = 36.8 bits (85), Expect = 0.006 Identities = 43/210 (20%), Positives = 76/210 (36%), Gaps = 51/210 (24%) Query: 18 NRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKN--ALQKINKKIDIFAFD 75 + VTG+S IG + L G V R +K ++ L+ +++ +F D Sbjct: 6 GKKVCVTGASGFIGSWIVKLLLSRGYTVRGTVRDPEDEKKTEHLRKLEGAKERLKLFKAD 65 Query: 76 LRDSNALELTKTYIAKRWGKLDILIAN-AGILGSISPIWQIKEKSFADVISVNVMANWNI 134 L D + D I G+ + SP+ E ++I V N+ Sbjct: 66 LLDEGS--------------FDKAIDGCDGVFHTASPVDFDLEDPEKELIDPAVKGTKNV 111 Query: 135 MRSFDPWLKKSHCGRAIILSSGAA-------------------------YKCRPLWGAYS 169 + + KK+ + ++ +S A +C+ LW Y+ Sbjct: 112 LEA----CKKTKSVKRVVYTSSTAAVRYNGPNIGENSVVDEESWSDLDFCRCKKLW--YA 165 Query: 170 ASKAAIEALARTWSKETVNTALRVINIDPG 199 SK E A ++KE L ++ I+PG Sbjct: 166 LSKTLAEKAAWEFAKENG---LDLVTINPG 192 >gnl|CDD|36691 KOG1478, KOG1478, KOG1478, 3-keto sterol reductase [Lipid transport and metabolism]. Length = 341 Score = 35.4 bits (81), Expect = 0.015 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 11/97 (11%) Query: 19 RLALVTGSSRGIGYYTALELARSG------AYVIACGRSISQLEKLKNALQ----KINKK 68 ++AL+TG++ G+G L + C R++S+ E + AL+ K + Sbjct: 4 KVALITGANSGLGLAICKRLLAEDDENVRLTLCLTC-RNMSKAEAVCAALKAFHPKSTIE 62 Query: 69 IDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGI 105 + D+ + ++ I +R+ +LD + NAGI Sbjct: 63 VTYVLVDVSNMQSVFRASKDIKQRFQRLDYIYLNAGI 99 >gnl|CDD|36585 KOG1371, KOG1371, KOG1371, UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis]. Length = 343 Score = 34.1 bits (78), Expect = 0.035 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 5/66 (7%) Query: 22 LVTGSSRGIGYYTALELARSGAYVIA----CGRSISQLEKLKNALQKINKKIDIFAFDLR 77 LVTG + IG +T L L + G V+ + L++++ L + K + DL Sbjct: 6 LVTGGAGYIGSHTVLALLKRGYGVVIVDNLNNSYLESLKRVRQLLGE-GKSVFFVEGDLN 64 Query: 78 DSNALE 83 D+ ALE Sbjct: 65 DAEALE 70 >gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group contains proteins that share the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenase family. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine (His-51), the ribose of NAD, a serine (Ser-48), then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 332 Score = 32.7 bits (75), Expect = 0.11 Identities = 19/39 (48%), Positives = 28/39 (71%), Gaps = 2/39 (5%) Query: 22 LVTGSSRGIGYYTALELARS-GAYVIACGRSISQLEKLK 59 LVTG+ G+G + A++LA++ GA VIA RS +L+ LK Sbjct: 167 LVTGAGGGVGIH-AIQLAKALGARVIAVTRSPEKLKILK 204 >gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family. The medium chain reductase/dehydrogenases (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH) , quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Other MDR members have only a catalytic zinc, and some contain no coordinated zinc. Length = 271 Score = 31.9 bits (73), Expect = 0.17 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 22 LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLK 59 LV G+ G+G A +GA VI RS +LE K Sbjct: 139 LVLGAG-GVGLLAAQLAKAAGARVIVTDRSDEKLELAK 175 >gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 323 Score = 30.5 bits (70), Expect = 0.44 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Query: 22 LVTGSSRGIGYYTALELARS-GAYVIACGRS 51 LV G++ G+G A++LA++ GA VIA S Sbjct: 144 LVLGAAGGVGL-AAVQLAKALGARVIAAASS 173 >gnl|CDD|31046 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]. Length = 275 Score = 29.5 bits (65), Expect = 0.89 Identities = 17/63 (26%), Positives = 26/63 (41%), Gaps = 7/63 (11%) Query: 22 LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNA 81 LVTG++ +G EL G V A R+ A + +++ DLRD + Sbjct: 4 LVTGATGFVGGAVVRELLARGHEVRAAVRN-------PEAAAALAGGVEVVLGDLRDPKS 56 Query: 82 LEL 84 L Sbjct: 57 LVA 59 >gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 329 Score = 29.0 bits (66), Expect = 1.2 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 6/50 (12%) Query: 34 TALELARSGAYVIACGRSISQ-----LEKLKNALQKINKKIDIFAFDLRD 78 AL L G + CG +ISQ KN I K++ + F + D Sbjct: 229 AALTLLNKGGRIALCG-AISQYNATEPPGPKNLGNIITKRLTMQGFIVSD 277 >gnl|CDD|132758 cd07073, NR_LBD_AR, Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator. The ligand binding domain of the androgen receptor (AR): AR is a member of the nuclear receptor family. It is activated by binding either of the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for male primary sexual characteristics and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of an androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR-regulated genes and modulates their expression. Another mode of action is independent of their interactions with DNA. The receptors interact directly with signal transduction proteins in the cytoplasm, causing rapid changes in cell function, such as ion transport. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, AR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). The LBD is not only involved in binding to androgen, but also involved in binding of coactivator proteins and dimerization. A ligand dependent nuclear export signal is also present at the ligand binding domain. Length = 246 Score = 29.1 bits (65), Expect = 1.2 Identities = 12/30 (40%), Positives = 19/30 (63%) Query: 47 ACGRSISQLEKLKNALQKINKKIDIFAFDL 76 +C R QL KL +++Q I +++ F FDL Sbjct: 180 SCSRRFYQLTKLLDSVQPIARELHQFTFDL 209 >gnl|CDD|144480 pfam00899, ThiF, ThiF family. This family contains a repeated domain in ubiquitin activating enzyme E1 and members of the bacterial ThiF/MoeB/HesA family. Length = 134 Score = 28.7 bits (65), Expect = 1.6 Identities = 26/129 (20%), Positives = 38/129 (29%), Gaps = 50/129 (38%) Query: 29 GIGYYTALELARSGAYVIACGR---------SISQL----------------EKLKNALQ 63 G+G A LAR+G G+ +S L E K L+ Sbjct: 11 GLGSPAAEYLARAG-----VGKLTLVDFDTVELSNLNRQILFTESDIGKPKAEVAKERLR 65 Query: 64 KINKKIDIFAFDLR--DSNALELTKTY------------------IAKRWGKLDILIANA 103 IN +++ A+ R N EL K + G I Sbjct: 66 AINPDVEVEAYPERLTPENLEELLKGADLVVDALDNFAARYLLNDACVKRGIPLISAGAL 125 Query: 104 GILGSISPI 112 G G ++ I Sbjct: 126 GFDGQVTVI 134 >gnl|CDD|36441 KOG1227, KOG1227, KOG1227, Putative methyltransferase [General function prediction only]. Length = 351 Score = 28.0 bits (62), Expect = 2.7 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Query: 29 GIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKIN 66 GIGY+T L +GA V AC + +E L+ + N Sbjct: 204 GIGYFTLPFLVTAGAKTVFACEWNPWSVEALRRNAEANN 242 >gnl|CDD|32610 COG2717, COG2717, Predicted membrane protein [Function unknown]. Length = 209 Score = 27.9 bits (62), Expect = 3.0 Identities = 16/55 (29%), Positives = 25/55 (45%) Query: 91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKS 145 KRW KL L+ A ILG++ +W +K V+ + A ++R K Sbjct: 144 KRWKKLHRLVYLALILGALHYLWSVKIDMPEPVLYAIIFAVLLLLRVTKTRSKLR 198 >gnl|CDD|34587 COG4982, COG4982, 3-oxoacyl-[acyl-carrier protein]. Length = 866 Score = 27.7 bits (61), Expect = 3.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 166 GAYSASKAAIEALARTWSKET 186 GAY SK A++A+ W E+ Sbjct: 564 GAYGESKLALDAVVNRWHSES 584 >gnl|CDD|30949 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]. Length = 326 Score = 27.7 bits (61), Expect = 3.8 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 4/60 (6%) Query: 22 LVTGSSRGIGYYTALELARS-GAYVIACGRSISQLEKLKN--ALQKINKKIDIFAFDLRD 78 LV G++ G+G A++LA++ GA V+A S +LE LK A IN + + F +R+ Sbjct: 147 LVHGAAGGVGSA-AIQLAKALGATVVAVVSSSEKLELLKELGADHVINYREEDFVEQVRE 205 >gnl|CDD|31283 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]. Length = 588 Score = 27.2 bits (60), Expect = 4.4 Identities = 16/79 (20%), Positives = 33/79 (41%), Gaps = 3/79 (3%) Query: 8 NNSEIHVNLDNRLALVTGSSRGIGYYTALELARSG-AYVIACGRSISQLEKLKNALQKIN 66 + I L + LVTG IG ++ + +I R +L + L++ Sbjct: 240 DTELIGAMLTGKTVLVTGGGGSIGSELCRQILKFNPKEIILFSRDEYKLYLIDMELREKF 299 Query: 67 KKIDIFAF--DLRDSNALE 83 ++ + + D+RD + +E Sbjct: 300 PELKLRFYIGDVRDRDRVE 318 >gnl|CDD|32590 COG2520, COG2520, Predicted methyltransferase [General function prediction only]. Length = 341 Score = 27.2 bits (60), Expect = 4.6 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Query: 29 GIGYYTALELARSGA-YVIACGRSISQLEKLK-NA-LQKINKKIDIFAFDLRD 78 G+G ++ + +A+ G V A + +E LK N L K+ +++ D R+ Sbjct: 198 GVGPFS-IPIAKKGRPKVYAIDINPDAVEYLKENIRLNKVEGRVEPILGDARE 249 >gnl|CDD|34074 COG4359, COG4359, Uncharacterized conserved protein [Function unknown]. Length = 220 Score = 26.8 bits (59), Expect = 5.5 Identities = 26/107 (24%), Positives = 43/107 (40%), Gaps = 11/107 (10%) Query: 67 KKIDIFA-FD----LRDSNALELTKTYIAKRWGKL--DILIANAGILGSISPIWQIKEKS 119 KK IF+ FD L DSN +T T+ W L +L ++ S Sbjct: 2 KKPVIFSDFDGTITLNDSNDY-ITDTFGPGEWKALKDGVLSKTISFRDGFGRMFGSIHSS 60 Query: 120 FADVISVNVMANWNIMRSFDPWLK--KSHCGRAIILSSGAAYKCRPL 164 +++ ++ + I F +++ K H I++SSG PL Sbjct: 61 LEEILEF-LLKDIKIDPGFKEFVEWIKEHDIPFIVVSSGMDPFIYPL 106 >gnl|CDD|133451 cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NAD(P) binding domains of methylene-tetrahydrofolate dehydrogenase (m-THF DH) and m-THF DH/cyclohydrolase bifunctional enzymes (m-THF DH/cyclohydrolase). M-THF is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional DH/cyclodrolase form. In bacteria, mono-functional DH, as well as bifunctional DH/cyclodrolase are found. In addition, yeast (S. cerevisiae) also express a monofunctional DH. M-THF DH, like other amino acid DH-like NAD(P)-binding domains, is a member of the Rossmann fold superfamily which includes glutamate, leucine, and phenylalanine DHs, m-THF DH, methylene-tetrahydromethanopterin DH, m-THF DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an alpha-beta-alpha configuration. NAD binding involves numerous hydrogen and van der Waals contacts. Length = 140 Score = 26.7 bits (59), Expect = 5.9 Identities = 14/40 (35%), Positives = 19/40 (47%) Query: 9 NSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIAC 48 ++ V LD + LV G S +G L R GA V +C Sbjct: 19 LNKEGVRLDGKKVLVVGRSGIVGAPLQCLLQRDGATVYSC 58 >gnl|CDD|176249 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoreductases. yhfp putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 326 Score = 26.9 bits (60), Expect = 5.9 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 22 LVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLK 59 LVTG++ G+G LA+ G V+A + LK Sbjct: 151 LVTGATGGVGSLAVSILAKLGYEVVASTGKADAADYLK 188 >gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc-dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Length = 386 Score = 26.3 bits (59), Expect = 7.5 Identities = 13/40 (32%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Query: 190 ALRVINIDPGPTRTSMRAKAMPAE--DPNTVPHPQKVAKI 227 A RVI ID P R M + AE + V V + Sbjct: 209 AERVIAIDRVPERLEMARSHLGAETINFEEVDDV--VEAL 246 >gnl|CDD|32077 COG1893, ApbA, Ketopantoate reductase [Coenzyme metabolism]. Length = 307 Score = 26.4 bits (58), Expect = 7.5 Identities = 12/32 (37%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Query: 29 GIGYYTALELARSGAYVIACGRSISQLEKLKN 60 IG LA++G V RS +LE LK Sbjct: 10 AIGSLLGARLAKAGHDVTLLVRS-RRLEALKK 40 >gnl|CDD|30463 COG0114, FumC, Fumarase [Energy production and conversion]. Length = 462 Score = 26.3 bits (58), Expect = 7.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 8 NNSEIHVNLDNRLALVTGSSRGIGYYTALELAR 40 N I L+ L LVT + IGY A ++A+ Sbjct: 393 NEERIKELLERSLMLVTALNPHIGYDKAAKIAK 425 >gnl|CDD|153332 cd07648, F-BAR_FCHO, The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only proteins. F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Proteins in this group have been named FCH domain Only (FCHO) proteins. Vertebrates have two members, FCHO1 and FCHO2. These proteins contain an F-BAR domain and a C-terminal domain of unknown function named SAFF which is also present in endophilin interacting protein 1. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules. Length = 261 Score = 26.2 bits (58), Expect = 9.1 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Query: 76 LRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQI 115 LR+ +E +TY +K KL +N+ LG+ +P+W + Sbjct: 28 LRERATIE--ETY-SKALNKLAKQASNSSQLGTFAPLWLV 64 >gnl|CDD|176465 cd01362, Fumarase_classII, Class II fumarases. This subgroup contains Escherichia coli fumarase C, human mitochondrial fumarase, and related proteins. It is a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. Fumarase catalyzes the reversible hydration/dehydration of fumarate to L-malate during the Krebs cycle. Length = 455 Score = 26.3 bits (59), Expect = 9.4 Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 8 NNSEIHVNLDNRLALVTGSSRGIGYYTALELAR 40 N I L+ L LVT + IGY A ++A+ Sbjct: 390 NRERIAELLERSLMLVTALNPHIGYDKAAKIAK 422 >gnl|CDD|31285 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane]. Length = 340 Score = 25.9 bits (57), Expect = 9.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 168 YSASKAAIEALARTW 182 YSASKAA + L R + Sbjct: 152 YSASKAASDLLVRAY 166 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.132 0.394 Gapped Lambda K H 0.267 0.0714 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,999,469 Number of extensions: 149685 Number of successful extensions: 526 Number of sequences better than 10.0: 1 Number of HSP's gapped: 483 Number of HSP's successfully gapped: 61 Length of query: 257 Length of database: 6,263,737 Length adjustment: 92 Effective length of query: 165 Effective length of database: 4,275,709 Effective search space: 705491985 Effective search space used: 705491985 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 56 (25.4 bits)