BLAST/PSIBLAST alignment of GI: 254780338 and GI: 238919044 at iteration 1
>gi|238919044|ref|YP_002932558.1| hypothetical protein NT01EI_1112 [Edwardsiella ictaluri 93-146] Length = 189
>gi|238868612|gb|ACR68323.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146] Length = 189
 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 87/133 (65%), Gaps = 4/133 (3%)

Query: 1   MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTW 60
           +IG GFLFN+  GIK  HY I ++G + T  IA RQ+ +HILPGD GY      +H YTW
Sbjct: 56  LIGFGFLFNVRFGIKGAHYGIALIGCVITGSIAARQMFLHILPGDSGYGSTFLELHFYTW 115

Query: 61  SLIFSLVIILFISVLMLFDTAEIKVAKS---PV-REIAIYLFVFLIFANFISTILECGLT 116
           +L+ S+++I+ I+V+M+         ++   P+  +IAI LF  +I AN IST+LECG  
Sbjct: 116 ALLASIIVIVAIAVMMMLGEVRPTTGETISVPLWGKIAIALFALVIVANLISTVLECGGG 175

Query: 117 QCFDNPTFYQLLN 129
           QC DNPTFYQL+ 
Sbjct: 176 QCADNPTFYQLIG 188