RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780338|ref|YP_003064751.1| hypothetical protein CLIBASIA_01115 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >gnl|CDD|36224 KOG1006, KOG1006, KOG1006, Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms]. Length = 361 Score = 26.1 bits (57), Expect = 2.9 Identities = 7/31 (22%), Positives = 14/31 (45%) Query: 2 IGIGFLFNLISGIKQRHYSIMILGAITTCII 32 I + L+ + +++ ILG IT + Sbjct: 147 ISLDKLYKRVYSVQKSRIPENILGHITVATV 177 >gnl|CDD|133031 cd04188, DPG_synthase, DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. Length = 211 Score = 26.0 bits (58), Expect = 3.4 Identities = 10/38 (26%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Query: 81 AEIKVAKSPVREIAIYLFVFLIFANFISTILECGLTQC 118 + V +S +R + F FL+ I + TQC Sbjct: 124 SAAVVKRSWLRNLLGRGFNFLVRLLLGLGIKD---TQC 158 >gnl|CDD|36999 KOG1788, KOG1788, KOG1788, Uncharacterized conserved protein [Function unknown]. Length = 2799 Score = 25.0 bits (54), Expect = 5.7 Identities = 28/101 (27%), Positives = 45/101 (44%), Gaps = 24/101 (23%) Query: 4 IGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWSLI 63 +GFL NLIS + R +++ IL I + +L+ + GD+ + V L+ Sbjct: 1526 LGFLENLISILWYRSHNLAILRQINL----VKHLLVTLQRGDV--EVLVLE------KLV 1573 Query: 64 FSLVIIL---FIS---------VLMLFDTAEIKVAKSPVRE 92 L IL F++ +M F+ EIK S +RE Sbjct: 1574 ILLRCILENGFLTPELEDVVRFAIMTFNPPEIKSQNSSMRE 1614 >gnl|CDD|107328 cd06333, PBP1_ABC-type_HAAT_like, Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. This subgroup includes the type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. Members of this subgroup are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine-binding protein (LIVBP); their ligand specificity has not been determined experimentally, however. Length = 312 Score = 24.4 bits (54), Expect = 8.9 Identities = 7/31 (22%), Positives = 11/31 (35%) Query: 26 AITTCIIATRQVLIHILPGDLGYSIPVFGMH 56 A+ T L + GY P++ H Sbjct: 191 AVLIWGSGTPAALPAKNLRERGYKGPIYQTH 221 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.336 0.150 0.459 Gapped Lambda K H 0.267 0.0746 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,653,011 Number of extensions: 87819 Number of successful extensions: 702 Number of sequences better than 10.0: 1 Number of HSP's gapped: 692 Number of HSP's successfully gapped: 146 Length of query: 129 Length of database: 6,263,737 Length adjustment: 83 Effective length of query: 46 Effective length of database: 4,470,190 Effective search space: 205628740 Effective search space used: 205628740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 52 (23.8 bits)