RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780338|ref|YP_003064751.1| hypothetical protein
CLIBASIA_01115 [Candidatus Liberibacter asiaticus str. psy62]
         (129 letters)



>gnl|CDD|179890 PRK04897, PRK04897, heat shock protein HtpX; Provisional.
          Length = 298

 Score = 28.4 bits (64), Expect = 0.54
 Identities = 14/87 (16%), Positives = 40/87 (45%), Gaps = 14/87 (16%)

Query: 7  LFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWSLIFSL 66
          L+  I+  K++   ++              V+  +L   +G ++    ++     LI +L
Sbjct: 2  LYEQIASNKRKTVFLL--------------VVFFLLLALVGAAVGYLFLNSGLGGLIIAL 47

Query: 67 VIILFISVLMLFDTAEIKVAKSPVREI 93
          +I +  +++M+F +  + ++ +  RE+
Sbjct: 48 IIGVIYALIMIFQSTNVVMSMNHAREV 74


>gnl|CDD|182935 PRK11059, PRK11059, regulatory protein CsrD; Provisional.
          Length = 640

 Score = 26.4 bits (59), Expect = 2.3
 Identities = 13/42 (30%), Positives = 18/42 (42%), Gaps = 5/42 (11%)

Query: 42  LPGDLGYSI-----PVFGMHLYTWSLIFSLVIILFISVLMLF 78
           L    G S+       FG + Y+     SL + +   VLMLF
Sbjct: 115 LLKHPGMSLRLKYVDPFGNYFYSLYATASLTLAIGFIVLMLF 156


>gnl|CDD|181031 PRK07562, PRK07562, ribonucleotide-diphosphate reductase subunit
           alpha; Validated.
          Length = 1220

 Score = 25.7 bits (57), Expect = 3.7
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 14/48 (29%)

Query: 68  IILFISVLMLFDTAEIKVAKSPVREIAIYLFVF----LIFANFISTIL 111
           ++L ISVLM         A+ P +EIA   + F    L +AN I  +L
Sbjct: 519 VVLEISVLM---------AQFPSKEIAELSYEFRTLGLGYAN-IGGLL 556


>gnl|CDD|150772 pfam10136, SpecificRecomb, Site-specific recombinase.  Members of
           this family of bacterial proteins are found in various
           putative site-specific recombinase transmembrane
           proteins.
          Length = 647

 Score = 25.6 bits (57), Expect = 4.2
 Identities = 9/33 (27%), Positives = 15/33 (45%), Gaps = 1/33 (3%)

Query: 44  GDLGYSIPVFGMH-LYTWSLIFSLVIILFISVL 75
            +LGY++   G   L   +  ++L  I  I  L
Sbjct: 570 ANLGYALGALGFDALGWPAFWWALAGIALIGAL 602


>gnl|CDD|181051 PRK07586, PRK07586, hypothetical protein; Validated.
          Length = 514

 Score = 25.2 bits (56), Expect = 4.9
 Identities = 6/16 (37%), Positives = 11/16 (68%)

Query: 107 ISTILECGLTQCFDNP 122
           + T+++ G+  CF NP
Sbjct: 8   VRTLVDGGVDVCFANP 23


>gnl|CDD|130917 TIGR01858, tag_bisphos_ald, class II aldolase, tagatose
          bisphosphate family.  This model describes
          tagatose-1,6-bisphosphate aldolases, and perhaps other
          closely related class II aldolases. This tetrameric,
          Zn2+-dependent enzyme is related to the class II
          fructose bisphosphate aldolase; fructose
          1,6-bisphosphate and tagatose 1,6 bisphosphate differ
          only in chirality at C4.
          Length = 282

 Score = 24.8 bits (54), Expect = 6.1
 Identities = 9/26 (34%), Positives = 16/26 (61%), Gaps = 2/26 (7%)

Query: 31 IIATRQVLIHILPGDLGYSIPVFGMH 56
          I++T+ +L     G  GY++P F +H
Sbjct: 1  IVSTKYMLQDAQAG--GYAVPAFNIH 24


>gnl|CDD|129779 TIGR00696, wecB_tagA_cpsF, bacterial polymer biosynthesis proteins,
           WecB/TagA/CpsF family.  The WecG member of this
           superfamily, believed to be
           UDP-N-acetyl-D-mannosaminuronic acid transferase, plays
           a role in enterobacterial common antigen (eca) synthesis
           in Escherichia coli. Another family member, the Bacillus
           subtilis TagA protein, is involved in the biosynthesis
           of the cell wall polymer poly(glycerol phosphate). The
           third family member, CpsF, CMP-N-acetylneuraminic acid
           synthetase has a role in the capsular polysaccharide
           biosynthesis pathway.
          Length = 177

 Score = 24.8 bits (54), Expect = 6.3
 Identities = 8/23 (34%), Positives = 15/23 (65%)

Query: 1   MIGIGFLFNLISGIKQRHYSIMI 23
           MIG+G  F++ SG+ +R    ++
Sbjct: 129 MIGVGGSFDVFSGLVKRAPRWLM 151


>gnl|CDD|177635 PHA03399, pif3, per os infectivity factor 3; Provisional.
          Length = 200

 Score = 24.5 bits (54), Expect = 8.0
 Identities = 17/70 (24%), Positives = 27/70 (38%), Gaps = 11/70 (15%)

Query: 60  WSLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLT--- 116
           W L+  L+I+L +    L    ++ +     R  A      +   N    I++C LT   
Sbjct: 3   WGLLVLLIILLIVYYYTLKFVQQLNLNDDEARSRANPPMNLVFERN---GIVDCSLTRLP 59

Query: 117 -----QCFDN 121
                QC DN
Sbjct: 60  CVTDQQCRDN 69


>gnl|CDD|151067 pfam10510, PIG-S, Phosphatidylinositol-glycan biosynthesis class
          S protein.  PIG-S is one of several key, core,
          components of the glycosylphosphatidylinositol (GPI)
          trans-amidase complex that mediates GPI anchoring in
          the endoplasmic reticulum. Anchoring occurs when a
          protein's C-terminal GPI attachment signal peptide is
          replaced with a pre-assembled GPI. Mammalian
          GPITransamidase consists of at least five components:
          Gaa1, Gpi8, PIG-S, PIG-T, and PIG-U, all five of which
          are required for function. It is possible that Gaa1,
          Gpi8, PIG-S, and PIG-T form a tightly associated core
          that is only weakly associated with PIG-U. The exact
          function of PIG-S is unclear.
          Length = 500

 Score = 24.6 bits (54), Expect = 8.2
 Identities = 8/32 (25%), Positives = 16/32 (50%)

Query: 63 IFSLVIILFISVLMLFDTAEIKVAKSPVREIA 94
          +  +++I+ + V + + T  I  A  P  EI 
Sbjct: 1  LAFVLLIILLGVPLWWKTTSIYRAPLPFDEIE 32


>gnl|CDD|180710 PRK06816, PRK06816, 3-oxoacyl-(acyl carrier protein) synthase
          III; Reviewed.
          Length = 378

 Score = 24.5 bits (54), Expect = 9.1
 Identities = 6/9 (66%), Positives = 8/9 (88%)

Query: 13 GIKQRHYSI 21
          GIK RHY++
Sbjct: 45 GIKTRHYAL 53


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.336    0.150    0.459 

Gapped
Lambda     K      H
   0.267   0.0726    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 2,139,193
Number of extensions: 129479
Number of successful extensions: 715
Number of sequences better than 10.0: 1
Number of HSP's gapped: 711
Number of HSP's successfully gapped: 107
Length of query: 129
Length of database: 5,994,473
Length adjustment: 83
Effective length of query: 46
Effective length of database: 4,201,009
Effective search space: 193246414
Effective search space used: 193246414
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 51 (23.4 bits)