RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780338|ref|YP_003064751.1| hypothetical protein
CLIBASIA_01115 [Candidatus Liberibacter asiaticus str. psy62]
         (129 letters)



>2wsc_F Photosystem I reaction center subunit III, chloroplastic;
           photosynthesis, electron transfer, membrane proteins,
           large complexes; HET: CL1 PQN BCR LMU LMG SUC UNL; 3.30A
           {Spinacia oleracea} PDB: 2wse_F* 2wsf_F* 2o01_F*
           (F:1-151)
          Length = 151

 Score = 26.6 bits (58), Expect = 1.2
 Identities = 7/37 (18%), Positives = 13/37 (35%)

Query: 93  IAIYLFVFLIFANFISTILECGLTQCFDNPTFYQLLN 129
           ++  L      A   +     GLT C ++  F +   
Sbjct: 60  LSSVLLSSWSVAPDAAMADIAGLTPCKESKQFAKREK 96


>1xcr_A Hypothetical protein PTD012; structural genomics,
           zinc-containing fold, splice variant, acetate buffer,
           metal binding protein; 1.70A {Homo sapiens} (A:)
          Length = 316

 Score = 24.7 bits (54), Expect = 4.5
 Identities = 11/40 (27%), Positives = 21/40 (52%), Gaps = 3/40 (7%)

Query: 9   NLISGIKQ---RHYSIMILGAITTCIIATRQVLIHILPGD 45
           N ++ +++   +HY    +G   T II   +V  HI+P +
Sbjct: 184 NFVTCMRETLEKHYGNKPIGMGGTFIIQKGKVKSHIMPAE 223


>1jb0_F Photosystem 1 reaction centre subunit III; membrane protein,
           multiprotein-pigment complex, photosynthesis; HET: CL1
           PQN BCR LHG LMG; 2.50A {Synechococcus elongatus}
           (F:1-79)
          Length = 79

 Score = 24.0 bits (52), Expect = 6.8
 Identities = 10/40 (25%), Positives = 16/40 (40%), Gaps = 1/40 (2%)

Query: 91  REIAIYLFVFLIFANFISTILE-CGLTQCFDNPTFYQLLN 129
           R +A+ L + L          +  GL  C D+P F +   
Sbjct: 3   RFLALLLVLTLWLGFTPLASADVAGLVPCKDSPAFQKRAA 42


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.336    0.150    0.459 

Gapped
Lambda     K      H
   0.267   0.0570    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 958,509
Number of extensions: 36501
Number of successful extensions: 144
Number of sequences better than 10.0: 1
Number of HSP's gapped: 142
Number of HSP's successfully gapped: 18
Length of query: 129
Length of database: 4,956,049
Length adjustment: 77
Effective length of query: 52
Effective length of database: 2,353,064
Effective search space: 122359328
Effective search space used: 122359328
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 50 (23.4 bits)