RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780338|ref|YP_003064751.1| hypothetical protein
CLIBASIA_01115 [Candidatus Liberibacter asiaticus str. psy62]
         (129 letters)



>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 26.1 bits (57), Expect = 2.8
 Identities = 5/34 (14%), Positives = 11/34 (32%), Gaps = 11/34 (32%)

Query: 33  ATRQVL-------IHILPGDLGYSIPVFGMHLYT 59
           A+  +        +     D+   IPV+    + 
Sbjct: 435 ASDLINKDLVKNNVSFNAKDIQ--IPVY--DTFD 464



 Score = 25.7 bits (56), Expect = 3.1
 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 24/50 (48%)

Query: 17  RHYSIMILGAITTCII-------------ATRQVLIHIL---PG---DLG 47
           R  S  I   I  CII             AT     HIL   PG    LG
Sbjct: 469 RVLSGSISERIVDCIIRLPVKWETTTQFKAT-----HILDFGPGGASGLG 513


>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP,
           cyclic peptide, membrane protein; 3.80A {Mus musculus}
           PDB: 3g61_A* 3g60_A*
          Length = 1284

 Score = 25.4 bits (55), Expect = 4.5
 Identities = 11/105 (10%), Positives = 28/105 (26%), Gaps = 8/105 (7%)

Query: 7   LFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWSLIFSL 66
           +  +           M++G +   I      L+ ++ GD+  S    G          S 
Sbjct: 35  VLTMFRYAGWLDRLYMLVGTLAAIIHGVALPLMMLIFGDMTDSFASVG--------NVSK 86

Query: 67  VIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTIL 111
                         A+++   +        +   ++   +I    
Sbjct: 87  NSTNMSEADKRAMFAKLEEEMTTYAYYYTGIGAGVLIVAYIQVSF 131


>3fk5_A 3-oxoacyl-synthase III; bacterial blight, XOO4209, FABH,
          xanthomonas oryzae PV. oryzae KACC10331, cytoplasm,
          multifunctional enzyme; 2.05A {Xanthomonas oryzae PV}
          Length = 338

 Score = 24.1 bits (51), Expect = 9.3
 Identities = 10/46 (21%), Positives = 17/46 (36%), Gaps = 2/46 (4%)

Query: 7  LFNLISGIKQRHYSIMILGAITTCIIATRQVLIH--ILPGDLGYSI 50
          +   ++GI  R      + A      A R+ LI   I    +G  +
Sbjct: 42 VLGDVAGIHARRLWDQDVQASDAATQAARKALIDAGIGIEKIGLLV 87


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.336    0.150    0.459 

Gapped
Lambda     K      H
   0.267   0.0513    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 1,102,767
Number of extensions: 44387
Number of successful extensions: 189
Number of sequences better than 10.0: 1
Number of HSP's gapped: 188
Number of HSP's successfully gapped: 20
Length of query: 129
Length of database: 5,693,230
Length adjustment: 82
Effective length of query: 47
Effective length of database: 3,705,222
Effective search space: 174145434
Effective search space used: 174145434
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 51 (23.9 bits)