RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780338|ref|YP_003064751.1| hypothetical protein CLIBASIA_01115 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Length = 129 Score = 23.9 bits (51), Expect = 4.6 Identities = 6/13 (46%), Positives = 8/13 (61%) Query: 76 MLFDTAEIKVAKS 88 M ++ EI V KS Sbjct: 13 MQYNVKEIVVDKS 25 >d2v4ja2 d.58.36.2 (A:2-167) Dissimilatory sulfite reductase subunit alpha, DsrA {Desulfovibrio vulgaris [TaxId: 881]} Length = 166 Score = 23.2 bits (50), Expect = 6.9 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Query: 12 SGIKQRHYS---IMILGAITTCIIATRQVLIHILPGDLGYS 49 SG+ H S I++LG T + L H L DLG S Sbjct: 126 SGLTNMHGSTGDIVLLGTQTPQLEEIFFELTHNLNTDLGGS 166 >d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Length = 128 Score = 23.1 bits (49), Expect = 8.6 Identities = 7/13 (53%), Positives = 8/13 (61%) Query: 76 MLFDTAEIKVAKS 88 M F+T I V KS Sbjct: 13 MQFNTNAITVDKS 25 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.336 0.150 0.459 Gapped Lambda K H 0.267 0.0621 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 484,497 Number of extensions: 20029 Number of successful extensions: 70 Number of sequences better than 10.0: 1 Number of HSP's gapped: 70 Number of HSP's successfully gapped: 13 Length of query: 129 Length of database: 2,407,596 Length adjustment: 76 Effective length of query: 53 Effective length of database: 1,364,116 Effective search space: 72298148 Effective search space used: 72298148 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 48 (22.5 bits)