BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780338|ref|YP_003064751.1| hypothetical protein CLIBASIA_01115 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780338|ref|YP_003064751.1| hypothetical protein CLIBASIA_01115 [Candidatus Liberibacter asiaticus str. psy62] Length = 129 Score = 258 bits (658), Expect = 4e-71, Method: Compositional matrix adjust. Identities = 129/129 (100%), Positives = 129/129 (100%) Query: 1 MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTW 60 MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTW Sbjct: 1 MIGIGFLFNLISGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTW 60 Query: 61 SLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLTQCFD 120 SLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLTQCFD Sbjct: 61 SLIFSLVIILFISVLMLFDTAEIKVAKSPVREIAIYLFVFLIFANFISTILECGLTQCFD 120 Query: 121 NPTFYQLLN 129 NPTFYQLLN Sbjct: 121 NPTFYQLLN 129 >gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Score = 20.8 bits (42), Expect = 8.2, Method: Composition-based stats. Identities = 12/51 (23%), Positives = 18/51 (35%) Query: 12 SGIKQRHYSIMILGAITTCIIATRQVLIHILPGDLGYSIPVFGMHLYTWSL 62 +G K ++I I C I R ++ H P P+ W L Sbjct: 400 AGEKGNANEVVIAALINACAILNRSIVKHSYPHSWRSKKPIIFRTTSQWFL 450 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.336 0.150 0.459 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,944 Number of Sequences: 1233 Number of extensions: 2898 Number of successful extensions: 23 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 12 length of query: 129 length of database: 328,796 effective HSP length: 65 effective length of query: 64 effective length of database: 248,651 effective search space: 15913664 effective search space used: 15913664 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 33 (17.3 bits)