BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780339|ref|YP_003064752.1| hypothetical protein CLIBASIA_01120 [Candidatus Liberibacter asiaticus str. psy62] (88 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780339|ref|YP_003064752.1| hypothetical protein CLIBASIA_01120 [Candidatus Liberibacter asiaticus str. psy62] gi|254040016|gb|ACT56812.1| hypothetical protein CLIBASIA_01120 [Candidatus Liberibacter asiaticus str. psy62] Length = 88 Score = 174 bits (441), Expect = 3e-42, Method: Compositional matrix adjust. Identities = 88/88 (100%), Positives = 88/88 (100%) Query: 1 MIKSTKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGT 60 MIKSTKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGT Sbjct: 1 MIKSTKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGT 60 Query: 61 INQVLVLNVPTANSLQNWFLLSTNLSEC 88 INQVLVLNVPTANSLQNWFLLSTNLSEC Sbjct: 61 INQVLVLNVPTANSLQNWFLLSTNLSEC 88 >gi|166368875|ref|YP_001661148.1| hypothetical protein MAE_61340 [Microcystis aeruginosa NIES-843] gi|166091248|dbj|BAG05956.1| hypothetical protein MAE_61340 [Microcystis aeruginosa NIES-843] Length = 111 Score = 35.4 bits (80), Expect = 2.6, Method: Compositional matrix adjust. Identities = 17/67 (25%), Positives = 38/67 (56%), Gaps = 4/67 (5%) Query: 5 TKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQV 64 +K L E + N RV+IANI+ +++G + ++N+ + T + +A++ + ++ Sbjct: 47 SKIDKLSEEVNNLRVDIANIKGELTG----VNKRLDNLEFTNRTIFVAIVAALMAGLVKL 102 Query: 65 LVLNVPT 71 + N+PT Sbjct: 103 FLPNLPT 109 >gi|254781198|ref|YP_003065611.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] gi|254040875|gb|ACT57671.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 117 Score = 34.7 bits (78), Expect = 4.5, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 3/50 (6%) Query: 8 SNLKEAITNNRVEIANIRADMSGTSMK---IQSEINNMSWKILTTMIGCS 54 + L EAI +NR +IAN+R +++ ++ +++E+ + WKI T IG S Sbjct: 51 TKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGIS 100 >gi|317120703|gb|ADV02526.1| hypothetical protein SC1_gp235 [Liberibacter phage SC1] gi|317120807|gb|ADV02628.1| hypothetical protein SC1_gp235 [Liberibacter phage SC1] Length = 123 Score = 34.3 bits (77), Expect = 5.3, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 3/50 (6%) Query: 8 SNLKEAITNNRVEIANIRADMSGTSMK---IQSEINNMSWKILTTMIGCS 54 + L EAI +NR +IAN+R +++ ++ +++E+ + WKI T IG S Sbjct: 57 TKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGIS 106 Searching..................................................done Results from round 2 CONVERGED! >gi|254780339|ref|YP_003064752.1| hypothetical protein CLIBASIA_01120 [Candidatus Liberibacter asiaticus str. psy62] gi|254040016|gb|ACT56812.1| hypothetical protein CLIBASIA_01120 [Candidatus Liberibacter asiaticus str. psy62] Length = 88 Score = 142 bits (358), Expect = 1e-32, Method: Composition-based stats. Identities = 88/88 (100%), Positives = 88/88 (100%) Query: 1 MIKSTKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGT 60 MIKSTKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGT Sbjct: 1 MIKSTKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGT 60 Query: 61 INQVLVLNVPTANSLQNWFLLSTNLSEC 88 INQVLVLNVPTANSLQNWFLLSTNLSEC Sbjct: 61 INQVLVLNVPTANSLQNWFLLSTNLSEC 88 >gi|317120703|gb|ADV02526.1| hypothetical protein SC1_gp235 [Liberibacter phage SC1] gi|317120807|gb|ADV02628.1| hypothetical protein SC1_gp235 [Liberibacter phage SC1] Length = 123 Score = 36.7 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 3/50 (6%) Query: 8 SNLKEAITNNRVEIANIRADMSGTSMK---IQSEINNMSWKILTTMIGCS 54 + L EAI +NR +IAN+R +++ ++ +++E+ + WKI T IG S Sbjct: 57 TKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGIS 106 >gi|166368875|ref|YP_001661148.1| hypothetical protein MAE_61340 [Microcystis aeruginosa NIES-843] gi|166091248|dbj|BAG05956.1| hypothetical protein MAE_61340 [Microcystis aeruginosa NIES-843] Length = 111 Score = 36.7 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 17/68 (25%), Positives = 39/68 (57%), Gaps = 4/68 (5%) Query: 4 STKDSNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQ 63 ++K L E + N RV+IANI+ +++G + ++N+ + T + +A++ + + Sbjct: 46 NSKIDKLSEEVNNLRVDIANIKGELTG----VNKRLDNLEFTNRTIFVAIVAALMAGLVK 101 Query: 64 VLVLNVPT 71 + + N+PT Sbjct: 102 LFLPNLPT 109 >gi|254781198|ref|YP_003065611.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] gi|254040875|gb|ACT57671.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 117 Score = 36.3 bits (82), Expect = 1.3, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 32/50 (64%), Gaps = 3/50 (6%) Query: 8 SNLKEAITNNRVEIANIRADMSGTSMK---IQSEINNMSWKILTTMIGCS 54 + L EAI +NR +IAN+R +++ ++ +++E+ + WKI T IG S Sbjct: 51 TKLMEAILDNREDIANVRIEVANVRIEVANVRTEMLGLIWKIPATAIGIS 100 >gi|195327548|ref|XP_002030480.1| GM24548 [Drosophila sechellia] gi|194119423|gb|EDW41466.1| GM24548 [Drosophila sechellia] Length = 636 Score = 35.5 bits (80), Expect = 2.3, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 34/67 (50%) Query: 8 SNLKEAITNNRVEIANIRADMSGTSMKIQSEINNMSWKILTTMIGCSSAMLGTINQVLVL 67 SN+ +I+N+ + I + S+K +N +S+ ++ CSS ++ ++ Sbjct: 505 SNIVTSISNSTATTSTISKGTTNNSIKTTENVNVISYSPNSSTTSCSSKATSGVSGAVIT 564 Query: 68 NVPTANS 74 N+PT+ + Sbjct: 565 NIPTSTT 571 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.314 0.124 0.344 Lambda K H 0.267 0.0388 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,241,757,025 Number of Sequences: 14124377 Number of extensions: 33750799 Number of successful extensions: 132122 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 10 Number of HSP's that attempted gapping in prelim test: 132114 Number of HSP's gapped (non-prelim): 18 length of query: 88 length of database: 4,842,793,630 effective HSP length: 58 effective length of query: 30 effective length of database: 4,023,579,764 effective search space: 120707392920 effective search space used: 120707392920 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 75 (33.6 bits)